LOCUS       AY084720                1094 bp    mRNA    linear   PLN 27-JAN-2006
DEFINITION  Arabidopsis thaliana clone 115884 mRNA, complete sequence.
ACCESSION   AY084720
VERSION     AY084720.1
KEYWORDS    FLI_CDNA.
SOURCE      Arabidopsis thaliana (thale cress)
  ORGANISM  Arabidopsis thaliana
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Camelineae; Arabidopsis.
REFERENCE   1  (bases 1 to 1094)
  AUTHORS   Haas,B.J., Volfovsky,N., Town,C.D., Troukhan,M., Alexandrov,N.,
            Feldmann,K.A., Flavell,R.B., White,O. and Salzberg,S.L.
  TITLE     Full-length messenger RNA sequences greatly improve genome
            annotation
  JOURNAL   Genome Biol. 3 (6), RESEARCH0029 (2002)
   PUBMED   12093376
REFERENCE   2  (bases 1 to 1094)
  AUTHORS   Alexandrov,N.N., Troukhan,M.E., Brover,V.V., Tatarinova,T.,
            Flavell,R.B. and Feldmann,K.A.
  TITLE     Features of Arabidopsis genes and genome discovered using
            full-length cDNAs
  JOURNAL   Plant Mol. Biol. 60 (1), 69-85 (2006)
   PUBMED   16463100
REFERENCE   3  (bases 1 to 1094)
  AUTHORS   Brover,V., Troukhan,M., Alexandrov,N., Lu,Y.-P., Flavell,R. and
            Feldmann,K.
  TITLE     Direct Submission
  JOURNAL   Submitted (11-MAR-2002) Ceres, Inc, 3007 Malibu Canyon Road,
            Malibu, CA 90265, USA
COMMENT     This clone sequence is one of 5,000 Ceres full-length cDNAs made
            available to TIGR and Genbank. The following quality assessment of
            this set was done by comparison with known proteins: two percent of
            the clones are estimated to be 5'-truncated; less than one percent
            are 3'-truncated; approximately two percent represent alternative
            splice variants, including unspliced introns and spliced exons; one
            percent may contain premature stop codons; five percent may have
            frame shifts in a coding region. A sequence is considered to be
            5'-truncated if it lacks the translation initiation start (ATG). A
            sequence is considered to be 3'-truncated if it lacks the
            C-terminal end of the encoded protein. Please note that these cDNA
            sequences are derived from the Ws or LAer ecotypes and therefore
            may contain polymorphisms when compared to sequences from Col-0.
            Genset carried out the library production and sequencing of the
            full-length clones. Ceres, Inc. carried out the clustering of the
            5' sequences, selection of clones, and sequence assembly.
FEATURES             Location/Qualifiers
     source          1..1094
                     /organism="Arabidopsis thaliana"
                     /mol_type="mRNA"
                     /db_xref="taxon:3702"
                     /clone="115884"
     CDS             82..963
                     /codon_start=1
                     /product="major intrinsic protein (MIP)- like"
                     /protein_id="AAM61294.1"
                     /translation="MAEISGNGGDARDGAVVVNLKEEDEQQQQQAIHKPLKKQDSLLS
                     ISVPFLQKLMAEVLGTYFLIFAGCAAVAVNTQHDKAVTLLGIAIVWGLTVMVLVYSLG
                     HISGAHFNPAVTIAFASCGRFPLKQVPAYVISQVIGSTLAAATLRLLFGLDQDVCSGK
                     HDVFVGTLPSGSNLQSFVIEFIITFYLMFVISGVATDNRAIGELAGLAVGSTVLLNVI
                     IAGPVSGASMNPGRSLGPAMVYSCYRGLWIYIVSPIVGAVSGAWVYNMVRYTDKPLRE
                     ITKSGSFLKTVRNGSSR"
BASE COUNT          292 a          217 c          257 g          328 t
ORIGIN      
        1 aacacaaagt cataacagtc gtttaaagtc tgatcctttc ttttttattt ttctttagtg
       61 tgtgagaaga gaaatatagt tatggcggag atctcgggaa acggtggtga tgctagagac
      121 ggagctgtgg tggtcaatct caaggaagaa gacgaacaac aacaacaaca agctattcat
      181 aaacccttga agaaacaaga ctctctcctc tctatctctg tccctttctt acaaaagttg
      241 atggcggagg ttttgggaac atacttcttg atattcgccg gttgtgccgc ggtggctgta
      301 aacacacaac atgacaaagc cgtgactctt ctagggatcg ccatcgtttg gggacttacc
      361 gtcatggtcc ttgtttactc tctcggtcac atctccggtg ctcatttcaa tccggccgtc
      421 acaatcgcat tcgcttcttg cggccgtttc cctcttaaac aggttccggc ttatgtgata
      481 tcacaagtga tcggatcaac gctagcggcg gcgactttac ggctcttgtt cggacttgat
      541 caagatgttt gtagtgggaa acacgatgtg ttcgtcggaa cattaccatc tggatcgaat
      601 ttgcagtcgt ttgtgatcga gtttatcatt actttctacc taatgttcgt tatttctggc
      661 gttgccaccg ataatagagc gatcggagaa cttgctggac tagcagtagg atcaacagtg
      721 ctacttaacg tgataattgc cgggccggta tcgggagcat cgatgaatcc aggacgaagt
      781 ttaggacctg caatggtcta cagttgctac agaggacttt ggatctacat agtttctcca
      841 attgttggtg cagtttcggg tgcgtgggtt tataacatgg ttcgatatac tgataagcca
      901 ttacgagaaa taactaaaag cggttctttt ttaaagaccg tgcgaaacgg tagctctcgt
      961 taagaaaaag aaaaacatga ctatgttgta ctagtcatcg gaggttaagt tgtatcacta
     1021 aagaagaaac tggaatattt tgtattaaag tgtttttaaa tttggattac cgcaaatgga
     1081 taaacattta tggc
//