LOCUS       AM747720             3870082 bp    DNA     circular BCT 06-FEB-2015
DEFINITION  Burkholderia cenocepacia J2315 chromosome 1, complete genome.
ACCESSION   AM747720
VERSION     AM747720.1
DBLINK      BioProject:PRJNA339
            BioSample:SAMEA1705928
KEYWORDS    al0001 gene; sodium/hydrogen exchanger family protein.
SOURCE      Burkholderia cenocepacia J2315
  ORGANISM  Burkholderia cenocepacia J2315
            Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
            Burkholderiaceae; Burkholderia; Burkholderia cepacia complex.
REFERENCE   1  (bases 1 to 3870082)
  AUTHORS   Holden M.T.G.
  JOURNAL   Submitted (20-JUN-2007) to the INSDC. Holden M.T.G., The Pathogen
            Sequencing Unit, The Wellcome Trust Sanger Institute, The Wellcome
            Trust Genome Campus, CB10 1SA, UNITED KINGDOM.
REFERENCE   2
  AUTHORS   Holden M.T., Seth-Smith H.M., Crossman L.C., Sebaihia M.,
            Bentley S.D., Cerdeno-Tarraga A.M., Thomson N.R., Bason N.,
            Quail M.A., Sharp S., Cherevach I., Churcher C., Goodhead I.,
            Hauser H., Holroyd N., Mungall K., Scott P., Walker D., White B.,
            Rose H., Iversen P., Mil-Homens D., Rocha E.P., Fialho A.M.,
            Baldwin A., Dowson C., Barrell B.G., Govan J.R., Vandamme P.,
            Hart C.A., Mahenthiralingam E., Parkhill J.
  TITLE     The genome of Burkholderia cenocepacia J2315, an epidemic pathogen
            of cystic fibrosis patients
  JOURNAL   J. Bacteriol. 191(1), 261-277(2009).
   PUBMED   18931103
FEATURES             Location/Qualifiers
     source          1..3870082
                     /organism="Burkholderia cenocepacia J2315"
                     /chromosome="1"
                     /strain="J2315"
                     /mol_type="genomic DNA"
                     /country="United Kingdom:Edinburgh"
                     /isolation_source="cystic fibrosis patient"
                     /note="representative of the ET12 epidemic lineage"
                     /db_xref="taxon:216591"
     CDS             431..1645
                     /transl_table=11
                     /locus_tag="BCAL0001"
                     /product="sodium/hydrogen exchanger family protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0001"
                     /db_xref="EnsemblGenomes-Tr:CAO00536"
                     /db_xref="GOA:B3KYE3"
                     /db_xref="InterPro:IPR006153"
                     /db_xref="InterPro:IPR038770"
                     /db_xref="UniProtKB/TrEMBL:B3KYE3"
                     /protein_id="CAO00536.1"
                     /translation="MKSAFSFLPNWPLTPDAVFWAGLALFAAGLCGELCYRAWRLPRI
                     TGYAVIGLIAGSFGFGVIDASTDETSRLLMDVALGLLLFELGSRLDLRWIRRNPWLVA
                     SSLAEATLTFVLVLFVMLALGVSGMVALVLSAIAIATSPSMVIQLKTELRAEGQVSQR
                     LITLTALNSVYAIVLTKLVTSWLHQEAYGNVFATILQPLYLLAGSFIVAYLVARSCNY
                     LFRHMTATMRDEHSFVALFGLVMLAIAVAQALKLSTLLTLLLAGIIVKNLEARPQLWP
                     EHFGTAGWLLTVVLFVLTLTSFTWGDIALGGLLAIVLIVTRLVAKLAGVVAFAKPSGL
                     GMKQGVALGIALTPMSALSYLLVDDTYQLYPNFDPHLRAIVMCSIVILQLVSPFVVYR
                     CLSAVGERSDGN"
     misc_feature    join(473..541,560..628,770..838,899..958,1001..1069,
                     1127..1222,1265..1333,1346..1414,1442..1501,1535..1603)
                     /locus_tag="BCAL0001"
                     /note="10 probable transmembrane helices predicted for
                     BCAL0001 by TMHMM2.0 at aa 15-37, 44-66, 114-136, 157-176,
                     191-213, 233-264, 279-301, 306-328, 338-357 and 369-391"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    479..1603
                     /locus_tag="BCAL0001"
                     /note="HMMPfam hit to PF00999, Sodium/hydrogen exchanger
                     family, score 8.4e-11"
                     /inference="protein motif:HMMPfam:PF00999"
     CDS             1660..2775
                     /transl_table=11
                     /locus_tag="BCAL0002"
                     /product="carboxylate-amine ligase YbdK"
                     /db_xref="EnsemblGenomes-Gn:BCAL0002"
                     /db_xref="EnsemblGenomes-Tr:CAR50307"
                     /db_xref="GOA:B4E558"
                     /db_xref="InterPro:IPR006336"
                     /db_xref="InterPro:IPR011793"
                     /db_xref="InterPro:IPR014746"
                     /db_xref="UniProtKB/Swiss-Prot:B4E558"
                     /protein_id="CAR50307.1"
                     /translation="MALETFVNSEPFTFGVELEIQVVNTHNYDLTKAASDLMRLIQGE
                     TFPGNITPEITESMIELSTGICHSHEQAVSELHAIRDVLVKAADQLNVGLAGGGTHAF
                     QQWSDRQIYDAPRFQYISELYGYLAKQFTVFGQHVHIGCPDPDSALFLLHSMSRFIPH
                     FIALSASSPFVQNVDTGFHSARLNSVFAFPLSGRAPFVLTWDSFEEYFTKMVNTGVVN
                     SMKDFYWDIRPKPGYGTIEVRVMDTPLSVDRAAAIACYIQTLARYLLTDRPLKLSEDD
                     YLVYTFNRFEACRFGLEGTCVNPQTGERRTIAEDILDTLDRIAPHAAALGSRAALDEI
                     GALAKARVNDASWLRTVFKQEKSLNETVRQQCLRWRE"
     misc_feature    1696..2535
                     /locus_tag="BCAL0002"
                     /note="HMMPfam hit to PF04107, Glutamate-cysteine ligase
                     family 2(GCS2), score 1.3e-60"
                     /inference="protein motif:HMMPfam:PF04107"
     CDS             3283..3921
                     /transl_table=11
                     /locus_tag="BCAL0003"
                     /product="MarR family regulatory protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0003"
                     /db_xref="EnsemblGenomes-Tr:CAR50308"
                     /db_xref="GOA:B4E559"
                     /db_xref="InterPro:IPR000835"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR036388"
                     /db_xref="InterPro:IPR036390"
                     /db_xref="UniProtKB/TrEMBL:B4E559"
                     /protein_id="CAR50308.1"
                     /translation="MSEGVYGNQAAGRVTHSLLRLSTAMRSEAWDWAEGAGLTPTQGE
                     ILVLLLQRKGPMRLGEIARETQLTAATTSDAVSTLETKGLVEKRRALDDGRALAVRLS
                     ARGRTAAKKALQWPEFLTKAVGKLGADEQGTLYRALLKTLRELQVAGATPPQRMCLTC
                     THFQPGKPSKKTVHHCAALDIAMSDSDLRLDCSVQEEADAATQKKTWKIFAG"
     misc_feature    3394..3606
                     /locus_tag="BCAL0003"
                     /note="HMMPfam hit to PF01047, MarR family, score 1.1e-12"
                     /inference="protein motif:HMMPfam:PF01047"
     misc_feature    3397..3543
                     /locus_tag="BCAL0003"
                     /note="HMMPfam hit to PF01022, Bacterial regulatory
                     protein, arsR family, score 1.4e-05"
                     /inference="protein motif:HMMPfam:PF01022"
     CDS             3950..4660
                     /transl_table=11
                     /locus_tag="BCAL0004"
                     /product="cysteine peptidase, family C26"
                     /db_xref="EnsemblGenomes-Gn:BCAL0004"
                     /db_xref="EnsemblGenomes-Tr:CAR50309"
                     /db_xref="GOA:B4E560"
                     /db_xref="InterPro:IPR017926"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:B4E560"
                     /protein_id="CAR50309.1"
                     /translation="MNAEVVAIRHVHFEDLGSFEQVLGERGRRVRYVDVGSSRVEVLD
                     VLEPSLLVVLGGPLSVYDDAQYPTIAPLLALVRQRIDAGLPILGICLGAQFIARALGA
                     RVYPAAQHELGWAPLTLTDAGRASPLRHLDGATTSMLHWHGDTFDLPGGAIHLASTPA
                     CRHQAFAWGQHVLALQCHPEIRTDRFEPWLIANAGEIAATPGVDARQLRADTAQHGPV
                     LEAAARRMFAEWLGSVGL"
     misc_feature    3983..4543
                     /locus_tag="BCAL0004"
                     /note="HMMPfam hit to PF00117, Glutamine amidotransferase
                     class-I, score 4.3e-13"
                     /inference="protein motif:HMMPfam:PF00117"
     misc_feature    4202..4237
                     /note="PS00442 Glutamine amidotransferases class-I active
                     site."
                     /inference="protein motif:Prosite:PS00442"
     CDS             4871..5983
                     /transl_table=11
                     /locus_tag="BCAL0005"
                     /product="putative NADH-dependent flavin oxidoreductase"
                     /db_xref="EnsemblGenomes-Gn:BCAL0005"
                     /db_xref="EnsemblGenomes-Tr:CAR50310"
                     /db_xref="GOA:B4E561"
                     /db_xref="InterPro:IPR001155"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:B4E561"
                     /protein_id="CAR50310.1"
                     /translation="MTALFSPFTLRGVTLPNRIVISPMCQYSAERGEATDWHMIHLGH
                     LALSGAGLLCIEATAVEPDGRITHGDLGLWDDVTEAALKPVLAAIRKHSPVRIAMQLS
                     HAGRKASSAAPWEGGQLVPVADGGWLPHGPSAVPHKDGETPPLALDAAGLNRIREAFA
                     ASAKRAARLGIDAIEVHAAHGYLLHQFLSPLANQRTDEYGGSRDNRMRFPLEIFEIVR
                     AAFPEDQPVGVRVSATDWVEGGWELDDTIAFAHELKRRGCDWIDVSSGGVSPLQKIPL
                     SPGYQVPFAQAVKRAVGMPTIAVGLINEPAHANRLIEAGDADFVAMARAMLYDPRWPW
                     HAAAELGAQVTAPPQYWRSQPREHKALFGDVAFGQR"
     misc_feature    4877..5899
                     /locus_tag="BCAL0005"
                     /note="HMMPfam hit to PF00724, NADH:flavin oxidoreductase
                     / NADH oxidas, score 4.2e-68"
                     /inference="protein motif:HMMPfam:PF00724"
     CDS             6161..6691
                     /transl_table=11
                     /locus_tag="BCAL0006"
                     /product="putative protein lysine methyltransferase
                     protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0006"
                     /db_xref="EnsemblGenomes-Tr:CAR50311"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="InterPro:IPR003616"
                     /db_xref="UniProtKB/TrEMBL:B4E562"
                     /protein_id="CAR50311.1"
                     /translation="MSSRRIAVRRSGVHGKGVFAVAPIKAGERVVEYKGERISWKEAL
                     RRHPHDPSEPNHTFYFALDEGGVIDGKIDGNSARWINHSCAPNCEAEEVKGRVYIHAL
                     RDIEPEEELFYDYGLVIDAKLTKKLKREYACHCGAESCRGTLLATSDEGGKKKKKKDK
                     KDGKSASGSKDKKHKK"
     misc_feature    6161..6529
                     /locus_tag="BCAL0006"
                     /note="HMMPfam hit to PF00856, SET domain, score 1.3e-24"
                     /inference="protein motif:HMMPfam:PF00856"
     CDS             complement(6845..8329)
                     /transl_table=11
                     /locus_tag="BCAL0007"
                     /product="two-component regulatory system, sensor kinase
                     protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0007"
                     /db_xref="EnsemblGenomes-Tr:CAR50312"
                     /db_xref="GOA:B4E563"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="InterPro:IPR013727"
                     /db_xref="InterPro:IPR036097"
                     /db_xref="InterPro:IPR036890"
                     /db_xref="UniProtKB/TrEMBL:B4E563"
                     /protein_id="CAR50312.1"
                     /translation="MSPDPAVTTSLRRSLLRRLAAPLSMLALMSGLIAYWLAWQYTQH
                     VIDRSLADLATAISKQIQIAGPDAPFTVPPLAQAMFSDPAEALIYRISDGEQELAGDP
                     KLPLQGINVRRMHHAYVFEAEYDNRAVRVAQVRVDDVEGGKPMVVEVAQPVRHRYRIA
                     AEFLVAIMMPLLLLLLAGWGIVWRVVNQQLGPLTHLADSLNRQTHTSLEPVDETDVPL
                     EIRPLTSAMNALLGRLKTALDAQRKFIADAAHQLRTPLTAVKLHAEQAAVARDPHQTF
                     AAVRELRAAADRAVRLSNQLLSLARAEPGEQAARFVDVDLAAMAFETGAEWVPRALAS
                     HVDLGFQRSDDPGDDEKLIVRGNPVLLREVIANLLDNALKYVPLARPDGARITVNVAR
                     AALEGNQPAAEIVVEDNGPGVPANQQADLFKRFFRGDAQSGNGVETGAGLGLAIVHDI
                     IAMHGGTVSYEDAPEGGSRFVVRVPLAARTEKPASETPAAAPTH"
     misc_feature    complement(6899..7264)
                     /locus_tag="BCAL0007"
                     /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
                     gyrase B-, and HSP90, score 2.6e-36"
                     /inference="protein motif:HMMPfam:PF02518"
     misc_feature    complement(7415..7612)
                     /locus_tag="BCAL0007"
                     /note="HMMPfam hit to PF00512, His Kinase A
                     (phosphoacceptor) domain, score 3.6e-14"
                     /inference="protein motif:HMMPfam:PF00512"
     misc_feature    complement(7622..7831)
                     /locus_tag="BCAL0007"
                     /note="HMMPfam hit to PF00672, HAMP domain, score 2.7e-06"
                     /inference="protein motif:HMMPfam:PF00672"
     misc_feature    complement(join(7781..7849,8213..8272))
                     /locus_tag="BCAL0007"
                     /note="2 probable transmembrane helices predicted for
                     BCAL0007 by TMHMM2.0 at aa 20-39 and 161-183"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    complement(7838..8266)
                     /locus_tag="BCAL0007"
                     /note="HMMPfam hit to PF08521, Two-component sensor kinase
                     N-terminal, score 3.8e-48"
                     /inference="protein motif:HMMPfam:PF08521"
     sig_peptide     complement(8228..8329)
                     /locus_tag="BCAL0007"
                     /note="Signal peptide predicted for BCAL0007 by SignalP
                     2.0 HMM (Signal peptide probability 0.871) with cleavage
                     site probability 0.792 between residues 34 and 35"
                     /inference="protein motif:SignalP:2.0"
     CDS             complement(8450..9142)
                     /transl_table=11
                     /locus_tag="BCAL0008"
                     /product="two-component regulatory system, response
                     regulator protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0008"
                     /db_xref="EnsemblGenomes-Tr:CAR50313"
                     /db_xref="GOA:B4E564"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR001867"
                     /db_xref="InterPro:IPR011006"
                     /db_xref="InterPro:IPR016032"
                     /db_xref="InterPro:IPR036388"
                     /db_xref="InterPro:IPR039420"
                     /db_xref="UniProtKB/TrEMBL:B4E564"
                     /protein_id="CAR50313.1"
                     /translation="MRLLLIEDDRPIARGIQSSLEQAGFTVDMVHDGIFAEQALAQNR
                     HELVILDLGLPGIDGMTLLTRFRQTNRHTPVIVLTARDELNDRIQGLNSGADDYMLKP
                     FEPAELEARIRAVMRRSGPHSDMPRPEVSLGGVRLSGVDRRIFNDDKPLELSPREFAV
                     LEMLLLRHGRVVSKAQLQDHLTHFGGDLGDTAIEVYVHRVRKKLEQCRVEIVTVRGFG
                     YLLQEIRQTASV"
     misc_feature    complement(8480..8701)
                     /locus_tag="BCAL0008"
                     /note="HMMPfam hit to PF00486, Transcriptional regulatory
                     protein, C te, score 1.5e-22"
                     /inference="protein motif:HMMPfam:PF00486"
     misc_feature    complement(8804..9142)
                     /locus_tag="BCAL0008"
                     /note="HMMPfam hit to PF00072, Response regulator receiver
                     domain, score 6.5e-36"
                     /inference="protein motif:HMMPfam:PF00072"
     CDS             9265..9495
                     /transl_table=11
                     /locus_tag="BCAL0008A"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0008A"
                     /db_xref="EnsemblGenomes-Tr:CAR50314"
                     /db_xref="InterPro:IPR022191"
                     /db_xref="UniProtKB/TrEMBL:B4E565"
                     /protein_id="CAR50314.1"
                     /translation="MSDISIHDLEAAINFWRARSPSSGDELKLCEEASALSKPYALLI
                     VQRESALQLEGLDPKARKAYETYVRLKDGLES"
     CDS             complement(9588..9896)
                     /transl_table=11
                     /locus_tag="BCAL0009"
                     /product="pterin-4-alpha-carbinolamine dehydratase"
                     /EC_number="4.2.1.96"
                     /db_xref="EnsemblGenomes-Gn:BCAL0009"
                     /db_xref="EnsemblGenomes-Tr:CAR50315"
                     /db_xref="GOA:B4E566"
                     /db_xref="InterPro:IPR001533"
                     /db_xref="InterPro:IPR036428"
                     /db_xref="UniProtKB/Swiss-Prot:B4E566"
                     /protein_id="CAR50315.1"
                     /translation="MIHKLTSEERKTRLEGLPHWTAVPGRDAIQRRLRFADFNEAFGF
                     MTRVAIKAQEMNHHPEWFNVYNRVDVTLSTHDADGLTERDIELARFIDGAATHAQPGA
                     "
     misc_feature    complement(9609..9896)
                     /locus_tag="BCAL0009"
                     /note="HMMPfam hit to PF01329, Pterin 4 alpha
                     carbinolamine dehydratase, score 2.4e-36"
                     /inference="protein motif:HMMPfam:PF01329"
     CDS             complement(10057..10950)
                     /transl_table=11
                     /gene="phhA"
                     /locus_tag="BCAL0010"
                     /product="phenylalanine-4-hydroxylase"
                     /EC_number="1.14.16.1"
                     /note="Possible alternative upstream translational start
                     sites"
                     /db_xref="EnsemblGenomes-Gn:BCAL0010"
                     /db_xref="EnsemblGenomes-Tr:CAR50316"
                     /db_xref="GOA:B4E567"
                     /db_xref="InterPro:IPR001273"
                     /db_xref="InterPro:IPR005960"
                     /db_xref="InterPro:IPR018301"
                     /db_xref="InterPro:IPR019774"
                     /db_xref="InterPro:IPR036329"
                     /db_xref="InterPro:IPR036951"
                     /db_xref="UniProtKB/TrEMBL:B4E567"
                     /protein_id="CAR50316.1"
                     /translation="MSTVVTAKLQEQFDAGLETRADFTIDQPLHCYGQVDHAVWKQLY
                     ARQSALLRGRACDAFVAGLGKIELPADHVPSFADVNRQLKPATGWEIVAVPGLVPDRV
                     FFEHLANRRFPVTWWMRRPDQLDYLQEPDCFHDLFGHVPLLIDPVFADYMQAYGRTAL
                     AVADDEAALARLARLYWYTVEFGLIRDPRGTDGLSIYGAGIVSSKGESLYSLESAAPN
                     RLGFDLERVMRTKYRIDTFQKTYFVIDDFAQLFALADVDGRALADRLAALPEFAAGAV
                     LDTDRVLHRGTGDGWPDDADA"
     misc_feature    complement(10150..10929)
                     /gene="phhA"
                     /locus_tag="BCAL0010"
                     /note="HMMPfam hit to PF00351, Biopterin-dependent
                     aromatic amino acid h, score 2e-11"
                     /inference="protein motif:HMMPfam:PF00351"
     misc_feature    complement(10528..10563)
                     /note="PS00367 Biopterin-dependent aromatic amino acid
                     hydroxylases signature."
                     /inference="protein motif:Prosite:PS00367"
     CDS             11090..11575
                     /transl_table=11
                     /locus_tag="BCAL0011"
                     /product="AnsC family regulatory protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0011"
                     /db_xref="EnsemblGenomes-Tr:CAR50317"
                     /db_xref="GOA:B4E568"
                     /db_xref="InterPro:IPR000485"
                     /db_xref="InterPro:IPR011008"
                     /db_xref="InterPro:IPR019887"
                     /db_xref="InterPro:IPR019888"
                     /db_xref="InterPro:IPR036388"
                     /db_xref="InterPro:IPR036390"
                     /db_xref="UniProtKB/TrEMBL:B4E568"
                     /protein_id="CAR50317.1"
                     /translation="MLELDHFDLALLDVLQRFGRATHQQLGEEVPLSPSQIGRRLQRL
                     EAAGVIEGYRVMLRPEKLGLGVTAFTSLKLKHHGDSIIEQFQQQIDVLPEVLECHAVV
                     GDADYLLRIVAPDLNALSQFVMKKLMRVPGVDSVRSNIVLTTFKRNGALPLAHLAPGA
                     A"
     misc_feature    11150..11215
                     /note="Predicted helix-turn-helix motif with score
                     1383.000, SD 3.90 at aa 26-47, sequence
                     ATHQQLGEEVPLSPSQIGRRLQ"
                     /inference="protein motif:helixturnhelix:EMBOSS"
     misc_feature    11291..11521
                     /locus_tag="BCAL0011"
                     /note="HMMPfam hit to PF01037, AsnC family, score 3e-28"
                     /inference="protein motif:HMMPfam:PF01037"
     CDS             complement(11647..12180)
                     /transl_table=11
                     /locus_tag="BCAL0012"
                     /product="putative adenylate cyclase"
                     /db_xref="EnsemblGenomes-Gn:BCAL0012"
                     /db_xref="EnsemblGenomes-Tr:CAR50318"
                     /db_xref="InterPro:IPR008173"
                     /db_xref="InterPro:IPR023577"
                     /db_xref="InterPro:IPR033469"
                     /db_xref="UniProtKB/TrEMBL:B4E569"
                     /protein_id="CAR50318.1"
                     /translation="MARNIEIKARAREFDRLREQAAQLATEAPLFYRQQDFFYDVPRG
                     RLKLRRFEDGTPAELIFYQRDDRDGPKASYYTRSPVTNPDAMHSLLATALTTRGIVTK
                     ERHVYLAGRTRIHLDRVDGLGDFIELEVVLGPDDDEAGGEAEAHEVFAKLGVAQEDLV
                     AVAYVDLLNADAQPETA"
     misc_feature    complement(11671..12177)
                     /locus_tag="BCAL0012"
                     /note="HMMPfam hit to PF01928, CYTH domain, score 2.4e-19"
                     /inference="protein motif:HMMPfam:PF01928"
     CDS             complement(12385..13284)
                     /transl_table=11
                     /locus_tag="BCAL0013"
                     /product="LysR family regulatory protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0013"
                     /db_xref="EnsemblGenomes-Tr:CAR50319"
                     /db_xref="GOA:B4E570"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="InterPro:IPR036388"
                     /db_xref="InterPro:IPR036390"
                     /db_xref="UniProtKB/TrEMBL:B4E570"
                     /protein_id="CAR50319.1"
                     /translation="MDLTLLRAFATVAREGNLTRAAAQLHLTQPAVSLQIKHLQETLG
                     VALFTRTSRGLALTRDGQTLLPHAERALAAAADVQRAAAALRHEVRGRLRIGTILDPG
                     FLRLGGFLRALVETHPQIETALRHGMSGWVIEQVRARALDVGYYIGRPEEDSPRDEAL
                     FHTVTLTRFEYRVLAPAGWKERVQRAHDWRALAALPWIWTPPASAHHRLLSRRFADAG
                     AQPVKVAEVDQEQSMLDLVKSGIGLTLARDSTALAEAHAHALTIVEHVTVPTELTFVT
                     LAERRDEPAIAAALRLIEAQWAI"
     misc_feature    complement(12391..13029)
                     /locus_tag="BCAL0013"
                     /note="HMMPfam hit to PF03466, LysR substrate binding
                     domain, score 2e-27"
                     /inference="protein motif:HMMPfam:PF03466"
     misc_feature    complement(13099..13278)
                     /locus_tag="BCAL0013"
                     /note="HMMPfam hit to PF00126, Bacterial regulatory
                     helix-turn-helix, score 9.4e-20"
                     /inference="protein motif:HMMPfam:PF00126"
     misc_feature    complement(13174..13239)
                     /note="Predicted helix-turn-helix motif with score
                     1604.000, SD 4.65 at aa 16-37, sequence
                     GNLTRAAAQLHLTQPAVSLQIK"
                     /inference="protein motif:helixturnhelix:EMBOSS"
     CDS             13473..15158
                     /transl_table=11
                     /locus_tag="BCAL0014"
                     /product="putative GMC oxidoreductase"
                     /db_xref="EnsemblGenomes-Gn:BCAL0014"
                     /db_xref="EnsemblGenomes-Tr:CAR50320"
                     /db_xref="GOA:B4E571"
                     /db_xref="InterPro:IPR000172"
                     /db_xref="InterPro:IPR007867"
                     /db_xref="InterPro:IPR012132"
                     /db_xref="InterPro:IPR036188"
                     /db_xref="UniProtKB/TrEMBL:B4E571"
                     /protein_id="CAR50320.1"
                     /translation="MSTQRTLEGEFDYVIVGAGTAGCVLANRLTEDPDISVLLLEAGG
                     KDDYHWIHIPVGYLYCIGNPRTDWLYKTQPEAALNGRALSYPRGRVLGGCSSINGMIY
                     MRGQREDYDHWAQETGDAGWSWDSVLPIFKRSEDHHAGASDAHGAGGYWRVEKQRLRW
                     EILESFAQAAQQTGIPATDDFNRGDNAGVGYFEVNQKRGVRWNTSKGFLRPAMARPNL
                     TVITGAHAQRVIFDGRRAVGVEYRGGGTDYVACARAEVLLTSGAVNSPQLLELSGIGD
                     GRRLQALGIDVVQDLPGVGENLQDHLQLRMAFRVDGVRTLNTLSAHWWGKLMIGAEYA
                     LLQRGPMSMAPSQLGAFAKSDPDDPALMRPDLQYHVQPLSLERFGEPLHRFNAFTASV
                     CHLRPTSRGSVHVTSADPGSAPAIAPNYLSTDHDRHVAANALRLTRRIASAPALARYR
                     PEEILPGPQYRTEAELVDAAGAVGTTIFHPVGTCRMGRADDERAVVDSRLRVRGIAGL
                     RIVDASVMPFITSGNTNSPTLMIAERASDMIRADRRAAREATAVRTEAAVTAV"
     misc_feature    13503..14420
                     /locus_tag="BCAL0014"
                     /note="HMMPfam hit to PF00732, GMC oxidoreductase, score
                     1.8e-105"
                     /inference="protein motif:HMMPfam:PF00732"
     misc_feature    13509..13541
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
                     /inference="protein motif:Prosite:PS00013"
     misc_feature    14253..14297
                     /note="PS00624 GMC oxidoreductases signature 2."
                     /inference="protein motif:Prosite:PS00624"
     misc_feature    14640..15077
                     /locus_tag="BCAL0014"
                     /note="HMMPfam hit to PF05199, GMC oxidoreductase, score
                     2.5e-53"
                     /inference="protein motif:HMMPfam:PF05199"
     CDS             15597..16376
                     /transl_table=11
                     /locus_tag="BCAL0015"
                     /product="putative branched-chain amino acid ABC
                     transporter ATP-binding protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0015"
                     /db_xref="EnsemblGenomes-Tr:CAR50321"
                     /db_xref="GOA:B4E572"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR032823"
                     /db_xref="UniProtKB/TrEMBL:B4E572"
                     /protein_id="CAR50321.1"
                     /translation="MILGDTILETRGLTKEFRGFTAVNGVNLRVRRGAIHALIGPNGA
                     GKTTCFNLLTKFLTPTAGQIVFNGIDITDERPAQVARRGIIRSFQISAVFPHLTALQN
                     VRIGLQRALGTEFHFWRSERTLKRLDDRAMDLLTQVGLTDFAHVPTVELAYGRKRALE
                     IATTLAMEPELMLLDEPTQGMGHEDVDRVTALIKKVASGRTILMVEHNMNVIAGISDT
                     ITVLQRGEVLAEGSYAEVSKNPLVIEAYMGSADAALAGAHA"
     misc_feature    15693..16271
                     /locus_tag="BCAL0015"
                     /note="HMMPfam hit to PF00005, ABC transporter, score
                     5.9e-45"
                     /inference="protein motif:HMMPfam:PF00005"
     misc_feature    15714..15737
                     /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
                     /inference="protein motif:Prosite:PS00017"
     CDS             16373..17128
                     /transl_table=11
                     /locus_tag="BCAL0016"
                     /product="putative branched-chain amino acid ABC
                     transporter ATP-binding protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0016"
                     /db_xref="EnsemblGenomes-Tr:CAR50322"
                     /db_xref="GOA:B4E573"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:B4E573"
                     /protein_id="CAR50322.1"
                     /translation="MKHSEREERELSGVESGTPALEITGLEAWYGESHILHGVDLTVH
                     RGEVVTLLGRNGAGRTTTLRAIMGLTGRRSGSIKVAGHETIGLATHRIAHYGIGYCPE
                     ERGIFSSLSCEENLMLPPLIGSREHAMSLDEIYAMFPNLASRRQSQGTRLSGGEQQML
                     AVARILRTGANLLLLDEISEGLAPVIVQALARMIVALKARGYTIVMVEQNFRFAAPLA
                     DRFYVMEHGSIVEHFRASELEGKMPTLHDLLGV"
     misc_feature    16508..17053
                     /locus_tag="BCAL0016"
                     /note="HMMPfam hit to PF00005, ABC transporter, score
                     1.1e-34"
                     /inference="protein motif:HMMPfam:PF00005"
     misc_feature    16826..16870
                     /note="PS00211 ABC transporters family signature."
                     /inference="protein motif:Prosite:PS00211"
     CDS             17206..18405
                     /transl_table=11
                     /locus_tag="BCAL0017"
                     /product="putative branched-chain amino acid ABC
                     transporter periplasmic protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0017"
                     /db_xref="EnsemblGenomes-Tr:CAR50323"
                     /db_xref="InterPro:IPR028081"
                     /db_xref="InterPro:IPR028082"
                     /db_xref="UniProtKB/TrEMBL:B4E574"
                     /protein_id="CAR50323.1"
                     /translation="MKMKTLAQACLALATAAFTAGAAHAADTVKIGFITDMSGLYADI
                     DGQGGLEAIRMAVADFGGKVLGKPIEVVYADHQNKADIAASKAREWMDRGGLDLLVGG
                     TNSATALSMNQVAAEKKKVYINIGAGADTLTNEQCTPYTVHYAYDTMALAKGTGSAVV
                     KQGGKSWFFLTADYAFGKALEKNTSDVVKANGGQVLGAVRHPLSASDFSSFLLQAQSS
                     KAQILGLANAGGDTINSIKAAKEFGITKTMKLAALLMFIDDVHSLGLETTQGLVLTDS
                     WYWNRDAASRQWAQRYFGKMKKMPSSLQAADYSSVTTYLKAVQAAGTTDSDKVMAELK
                     KIKISDFYAKGYIRQDGSMIHDMYLMEVKKPSESKEPWDYYKVLATIPGEQAFGTKQE
                     TRCALWK"
     sig_peptide     17206..17280
                     /locus_tag="BCAL0017"
                     /note="Signal peptide predicted for BCAL0017 by SignalP
                     2.0 HMM (Signal peptide probability 1.000) with cleavage
                     site probability 1.000 between residues 52 and 53"
                     /inference="protein motif:SignalP:2.0"
     CDS             18538..19422
                     /transl_table=11
                     /locus_tag="BCAL0018"
                     /product="putative branched-chain amino acid ABC
                     transporter permease"
                     /db_xref="EnsemblGenomes-Gn:BCAL0018"
                     /db_xref="EnsemblGenomes-Tr:CAR50324"
                     /db_xref="GOA:B4E575"
                     /db_xref="InterPro:IPR001851"
                     /db_xref="UniProtKB/TrEMBL:B4E575"
                     /protein_id="CAR50324.1"
                     /translation="MEIFGIPLPAMLSQLLLGLVNGSFYAILSLGLAVIFGLLNVINF
                     AHGALFMLGAMLAWMGLSYFGLPYWAMLALAPLMVGAFGIAIERSMLRWLYKLDHLYG
                     LLLTFGLTLVVEGVFRSIYGSSGQPYDVPSQLSGATNLGFMFLPNYRAWVVVASLAVC
                     LATWFVIEKTRLGAYLRAGTENPKLVEAFGVNVPMMITLTYGFGVALAAFAGVLAAPV
                     IQVSPLMGQPMIITVFAVVVIGGMGSILGSIVTGLLLGVIEGFTRVFYPEASATVVFV
                     IMAIVLLFRPAGLFGKEK"
     misc_feature    18577..19383
                     /locus_tag="BCAL0018"
                     /note="HMMPfam hit to PF02653, Branched-chain amino acid
                     transport syst, score 2.1e-35"
                     /inference="protein motif:HMMPfam:PF02653"
     misc_feature    join(18580..18648,18652..18720,18730..18798,18835..18903,
                     18979..19038,19132..19200,19243..19311,19330..19398)
                     /locus_tag="BCAL0018"
                     /note="8 probable transmembrane helices predicted for
                     BCAL0018 by TMHMM2.0 at aa 15-37, 39-61, 65-87, 100-122,
                     148-167, 199-221, 236-258 and 265-287"
                     /inference="protein motif:TMHMM:2.0"
     CDS             19422..20399
                     /transl_table=11
                     /locus_tag="BCAL0019"
                     /product="putative branched-chain amino acid ABC
                     transporter permease"
                     /db_xref="EnsemblGenomes-Gn:BCAL0019"
                     /db_xref="EnsemblGenomes-Tr:CAR50325"
                     /db_xref="GOA:B4E576"
                     /db_xref="InterPro:IPR001851"
                     /db_xref="UniProtKB/TrEMBL:B4E576"
                     /protein_id="CAR50325.1"
                     /translation="MQRKVLYGVLLAALLAAPFIGAYPVFVMKVLAFALFAAAFNLLI
                     GYTGLLSFGHAMFLATAGYATGYSMQTLGFTPELGVLVGTVAATLLGLVVGLFAIRRQ
                     GIYFAMITLAFAQMVYFIYLQAPFTHGEDGLQGVPRGRLFGLLDLSNDVALYYVVLVV
                     VVAACAFIVRVVHSPFGQVLVAIKENEARAISLGYDTDRFKLLAFILSAGLAGLAGSL
                     KVLVLGFETLSDAYWTMSGLVVLMTLVGGMGTLFGPLLGAALIVALEDRLGDIGEWLA
                     STTGVAWFHSLGESATIVTGLIFIACVLAFRRGIVGEMVARVKPLRASS"
     sig_peptide     19422..19532
                     /locus_tag="BCAL0019"
                     /note="Signal peptide predicted for BCAL0019 by SignalP
                     2.0 HMM (Signal peptide probability 1.000) with cleavage
                     site probability 0.694 between residues 37 and 38"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    join(19434..19502,19545..19613,19650..19718,19728..19787,
                     19872..19940,20028..20096,20133..20201,20271..20339)
                     /locus_tag="BCAL0019"
                     /note="8 probable transmembrane helices predicted for
                     BCAL0019 by TMHMM2.0 at aa 5-27, 42-64, 77-99, 103-122,
                     151-173, 203-225, 238-260 and 284-306"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    19485..20330
                     /locus_tag="BCAL0019"
                     /note="HMMPfam hit to PF02653, Branched-chain amino acid
                     transport syst, score 6.5e-20"
                     /inference="protein motif:HMMPfam:PF02653"
     CDS             21481..22638
                     /transl_table=11
                     /locus_tag="BCAL0020"
                     /product="putative branched-chain amino acid ABC
                     transporter periplasmic substrate binding protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0020"
                     /db_xref="EnsemblGenomes-Tr:CAR50326"
                     /db_xref="InterPro:IPR028081"
                     /db_xref="InterPro:IPR028082"
                     /db_xref="UniProtKB/TrEMBL:B4E577"
                     /protein_id="CAR50326.1"
                     /translation="MKMNRWMEALLAAGLVCAAATASAQVKIGVTLSATGPAASLGIP
                     EKNTIALLPKEIAGKSVQYIVLDDASDTSRAVQNVRKLIDEDHVDAIIGSSVTPNSLA
                     MLDPVSQGKTPTISLAASAQIIAPMDAKRAWMFKVPQNDQLMADAIAGYMAKHGVKTV
                     GFIGFADAYGDSWYKTFDAAAAKNGLKLVSNERYNRTDASVMGQVLKLLGSNPDAVLI
                     AGSGTPAALPAKTLKERGYKGKVYQTHGVANNDFLRVCGKDCEGEILPAGPVLVTDQL
                     PDSNPVKKPALGYKAAYEKAYGAGSLSTFGGHAWDAGLLLQRAIPEALKKGQPGTEAF
                     REALRASLESVKDLPVSHGVINMTATDHNGFDTRARVMVQIVDGKWKLQAE"
     sig_peptide     21481..21552
                     /locus_tag="BCAL0020"
                     /note="Signal peptide predicted for BCAL0020 by SignalP
                     2.0 HMM (Signal peptide probability 1.000) with cleavage
                     site probability 0.899 between residues 24 and 25"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    21580..22617
                     /locus_tag="BCAL0020"
                     /note="HMMPfam hit to PF01094, Receptor family ligand
                     binding region, score 2e-06"
                     /inference="protein motif:HMMPfam:PF01094"
     CDS             22845..23900
                     /transl_table=11
                     /locus_tag="BCAL0021"
                     /product="putative branched-chain amino acid ABC
                     transporter permease"
                     /db_xref="EnsemblGenomes-Gn:BCAL0021"
                     /db_xref="EnsemblGenomes-Tr:CAR50327"
                     /db_xref="GOA:B4E578"
                     /db_xref="InterPro:IPR001851"
                     /db_xref="UniProtKB/TrEMBL:B4E578"
                     /protein_id="CAR50327.1"
                     /translation="MDLSIAAILAQDGITTGAIYALLSLALVLVFSVTRVIFIPQGEF
                     VAYGALTLAALQAQKFPATCWLLFAMGIACFLLEVGSLIRHRERRHQLGRTLATLASR
                     YILLPLAVFAITRSFAAQPMPMLAQIALTLAIVVPMGPFVYRLVYQPIAEGTTLLLLI
                     VSVAVHFAMVGLGLVMFGAEGSRTNAFSDASLAIGSMTVSVQSILVVVTALVLIGALY
                     VYFGRTIAGKALRATSVNRLGARLVGIGTTEAGRLAFTFAAGLGVLSGILVGPLTTIY
                     YDSGFLIGLKGFVGAIIGGLVSYPLAAAGSLLVGVLESYSSFWASAYKEVIVFTLIIP
                     VLLWRSFVTPHAEEEEE"
     misc_feature    22869..23852
                     /locus_tag="BCAL0021"
                     /note="HMMPfam hit to PF02653, Branched-chain amino acid
                     transport syst, score 5e-05"
                     /inference="protein motif:HMMPfam:PF02653"
     misc_feature    join(22893..22961,23025..23093,23130..23198,23211..23279,
                     23313..23381,23439..23507,23601..23669,23712..23780,
                     23817..23870)
                     /locus_tag="BCAL0021"
                     /note="9 probable transmembrane helices predicted for
                     BCAL0021 by TMHMM2.0 at aa 17-39, 61-83, 96-118, 123-145,
                     157-179, 199-221, 253-275, 290-312 and 325-342"
                     /inference="protein motif:TMHMM:2.0"
     CDS             23905..25689
                     /transl_table=11
                     /locus_tag="BCAL0022"
                     /product="putative branched-chain amino acid ABC
                     transporter ATP-binding membrane protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0022"
                     /db_xref="EnsemblGenomes-Tr:CAR50328"
                     /db_xref="GOA:B4E579"
                     /db_xref="InterPro:IPR001851"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR032823"
                     /db_xref="UniProtKB/TrEMBL:B4E579"
                     /protein_id="CAR50328.1"
                     /translation="MKTMVRNKTFWVFLVVLFALPVLPGALQVPEYWITLLNYIGLYA
                     IVAIGLVLLTGVGGMTSFGQAAFVGIGAYATAFLTTRYGVSPWLALIVGVVLTALVAL
                     VLGAVTMRLSGHFLPLGTIAWGLALFYLFGNLELLGKYDGINGIPALNLFGIELESGR
                     SLYFLIWAVVLAAIVSVQNLLNSRPGRAIRALRGGGVMAEAMGVNTAWMRVVIFVYAA
                     VLAAVSGFLYAHLQRAVNPTPFGLNHGIEFLFMAVVGGVSHVWGAVLGAAILTVLQDY
                     LQTLLPKLLGSEGNFEIIVFGVLMVLLLQYARQGVWPFVAKLFPRGPRAHVPEQADPL
                     PQRAKPVAGEPLLVVDNARKQFGGLVAVNDVSFDVKAGQIIGLIGPNGAGKSTTFNLV
                     TGVLKPTGGAITFRGERIDGLTSRQIVRRGIGRTFQHVKLLPAMTVLENVAIGAHLRG
                     HTGVWRSIARLNAHEEAQLLAEAARQIRRVGLEKHMYDEAGSLALGQQRILEIARALC
                     CDPTLLLLDEPAAGLRYQEKQQLADLLRRLKAEGMSVLLVEHDMDFVMNLTDRLVVME
                     FGTRIAEGLPQDVQQDPAVLEAYLGGVE"
     sig_peptide     23905..23988
                     /locus_tag="BCAL0022"
                     /note="Signal peptide predicted for BCAL0022 by SignalP
                     2.0 HMM (Signal peptide probability 0.983) with cleavage
                     site probability 0.464 between residues 28 and 29"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    join(23929..23988,23998..24066,24085..24144,24154..24222,
                     24241..24300,24385..24453,24523..24591,24649..24717,
                     24754..24822)
                     /locus_tag="BCAL0022"
                     /note="9 probable transmembrane helices predicted for
                     BCAL0022 by TMHMM2.0 at aa 9-28, 32-54, 61-80, 84-106,
                     113-132, 161-183, 207-229, 249-271 and 284-306"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    23998..24813
                     /locus_tag="BCAL0022"
                     /note="HMMPfam hit to PF02653, Branched-chain amino acid
                     transport syst, score 2.5e-28"
                     /inference="protein motif:HMMPfam:PF02653"
     misc_feature    25018..25608
                     /locus_tag="BCAL0022"
                     /note="HMMPfam hit to PF00005, ABC transporter, score
                     7.5e-56"
                     /inference="protein motif:HMMPfam:PF00005"
     misc_feature    25039..25062
                     /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
                     /inference="protein motif:Prosite:PS00017"
     CDS             25704..26444
                     /transl_table=11
                     /locus_tag="BCAL0023"
                     /product="putative branched-chain amino acid ABC
                     transporter ATP-binding protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0023"
                     /db_xref="EnsemblGenomes-Tr:CAR50329"
                     /db_xref="GOA:B4E580"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:B4E580"
                     /protein_id="CAR50329.1"
                     /translation="MPILEVRGLAVRYGKVEALHGAAIKVGAGQIVSVIGPNGAGKST
                     LLNAIMGALPVTGHASGAIVYRGNDVGALPVEQRVARGMCLVPEKRELFSTMTVEDNL
                     VLGAYRRKQAGEANFLDQLDHVFALFPRLKERRRQAAGTLSGGERQMLAVGRALMGKP
                     DLLMLDEPSLGLAPLIVKEIFHIISALRGTGVATLLIEQNARAALQISDYGYVLETGE
                     FALEGPAAELAQNPRVIETYLGLAKKTA"
     misc_feature    25788..26354
                     /locus_tag="BCAL0023"
                     /note="HMMPfam hit to PF00005, ABC transporter, score
                     7.2e-46"
                     /inference="protein motif:HMMPfam:PF00005"
     misc_feature    25809..25832
                     /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
                     /inference="protein motif:Prosite:PS00017"
     misc_feature    26127..26171
                     /note="PS00211 ABC transporters family signature."
                     /inference="protein motif:Prosite:PS00211"
     CDS             26985..28955
                     /transl_table=11
                     /gene="gidA"
                     /locus_tag="BCAL0024"
                     /product="tRNA uridine 5-carboxymethylaminomethyl
                     modification enzyme GidA"
                     /db_xref="EnsemblGenomes-Gn:BCAL0024"
                     /db_xref="EnsemblGenomes-Tr:CAR50330"
                     /db_xref="GOA:B4E581"
                     /db_xref="InterPro:IPR002218"
                     /db_xref="InterPro:IPR004416"
                     /db_xref="InterPro:IPR020595"
                     /db_xref="InterPro:IPR026904"
                     /db_xref="InterPro:IPR036188"
                     /db_xref="UniProtKB/Swiss-Prot:B4E581"
                     /protein_id="CAR50330.1"
                     /translation="MLFPTEFDVIVVGGGHAGTEAALASARMGAKTLLLTHNIETLGQ
                     MSCNPSIGGIGKGHLVKEVDALGGAMAAATDESGIQFRILNSSKGPAVRATRAQADRI
                     LYKAAIRHRLENQPNLWLFQQAVDDLMVEGDRVVGAVTQIGIRFRARAVVLTAGTFLD
                     GKIHVGLNNYTGGRAGDPAAVSLSSRLKELKLPQGRLKTGTPPRIDGRTIDFSKLDEQ
                     PGDLDPIPVFSFLGRAEQHPQQLPCWVTHTNERTHDIIRGGLDRSPMYTGVIEGVGPR
                     YCPSIEDKIHRFASKESHQIFLEPEGLTTNEFYPNGISTSLPFDVQLELVHSMRGLEN
                     AHILRPGYAIEYDYFDPRALKASLETKAINGLFFAGQINGTTGYEEAAAQGLLAGLNA
                     GRYVQEKEAWCPRRDQAYLGVLVDDLVTRGVAEPYRMFTSRAEYRLSLREDNADMRLT
                     EIGRELGLVDDARWDAFSRKRDAVSRETERLKSTWVTPKTLPAEEATALLGKAIDHEY
                     SLAELLRRPGVSYDGVCGLKGGECGPAEPLTDDPVLLEQIKEQVEIGIKYQGYIERQA
                     SEIERNDANENTRLPDGIDYREVRGLSFEVSQKLNEFRPETIGQASRISGVTPAAISL
                     LMVHLKRRGLGRRNGTAAEAAEQGGGTVPTQQ"
     misc_feature    27006..28184
                     /gene="gidA"
                     /locus_tag="BCAL0024"
                     /note="HMMPfam hit to PF01134, Glucose inhibited division
                     protein A, score 1.4e-274"
                     /inference="protein motif:HMMPfam:PF01134"
     misc_feature    27006..28181
                     /gene="gidA"
                     /locus_tag="BCAL0024"
                     /note="HMMPfam hit to PF01266, FAD dependent
                     oxidoreductase, score 0.0016"
                     /inference="protein motif:HMMPfam:PF01266"
     misc_feature    27804..27848
                     /note="PS01280 Glucose inhibited division protein A family
                     signature 1."
                     /inference="protein motif:Prosite:PS01280"
     misc_feature    28089..28160
                     /note="PS01281 Glucose inhibited division protein A family
                     signature 2."
                     /inference="protein motif:Prosite:PS01281"
     CDS             28952..29638
                     /transl_table=11
                     /gene="gidB"
                     /locus_tag="BCAL0025"
                     /product="methyltransferase GidB"
                     /EC_number="2.1.-.-"
                     /note="Possible alternative translational start site after
                     codon 16"
                     /db_xref="EnsemblGenomes-Gn:BCAL0025"
                     /db_xref="EnsemblGenomes-Tr:CAR50331"
                     /db_xref="GOA:B4E582"
                     /db_xref="InterPro:IPR003682"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/Swiss-Prot:B4E582"
                     /protein_id="CAR50331.1"
                     /translation="MTARRAPAVNRDVLEQMLVEGTAALDLTLTDAQRNQLLDYVALL
                     GKWNAVYNLTAIRDPKQMLIQHILDSLSIVPHLRGRTSARVLDVGSGGGLPGIVLAIV
                     EPGWQVTLNDIVQKKSAFQTQMRAELKLVNLSVVTGRVESLQPGVEVPEKFDMIVSRA
                     FADLSDFVKLARHLVAPGGSIWAMKGVHPDDEIARLPEGSHVKQTIRLAVPMLDAERH
                     LFEVAVDDAN"
     misc_feature    29048..29611
                     /gene="gidB"
                     /locus_tag="BCAL0025"
                     /note="HMMPfam hit to PF02527, Glucose inhibited division
                     protein, score 5.5e-58"
                     /inference="protein motif:HMMPfam:PF02527"
     misc_feature    29207..29500
                     /gene="gidB"
                     /locus_tag="BCAL0025"
                     /note="HMMPfam hit to PF08241, Methyltransferase domain,
                     score 0.0011"
                     /inference="protein motif:HMMPfam:PF08241"
     CDS             29690..30469
                     /transl_table=11
                     /locus_tag="BCAL0026"
                     /product="chromosome partitioning protein ParA"
                     /db_xref="EnsemblGenomes-Gn:BCAL0026"
                     /db_xref="EnsemblGenomes-Tr:CAR50332"
                     /db_xref="InterPro:IPR025669"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:B4E583"
                     /protein_id="CAR50332.1"
                     /translation="MAKIFCVANQKGGVGKTTTSVNLAASLAAQEQRVLLIDLDPQGN
                     ATMGSGIDKAACEATVYEVLVDGVSVTDARVRPEGVTYDVLPANRELSGAEIELISID
                     NRERRLKAALERVADDYDFVLIDCPPTLSLLTLNGLCAAHGVVIPMQCEYFALEGLSD
                     LVNTIKQVHANMNRDLKIIGLLRVMFDPRITLQQQVSDQLKAHFGDKVFDAVIPRNVR
                     LAEAPSYGLPGVVFDRSSRGAQAYIQFGAEMIERVRAFEVS"
     misc_feature    29702..30352
                     /locus_tag="BCAL0026"
                     /note="HMMPfam hit to PF01656, CobQ/CobB/MinD/ParA
                     nucleotide binding domai, score 1.4e-58"
                     /inference="protein motif:HMMPfam:PF01656"
     CDS             30501..31394
                     /transl_table=11
                     /locus_tag="BCAL0027"
                     /product="chromosome partitioning protein ParB"
                     /db_xref="EnsemblGenomes-Gn:BCAL0027"
                     /db_xref="EnsemblGenomes-Tr:CAR50333"
                     /db_xref="GOA:B4E584"
                     /db_xref="InterPro:IPR003115"
                     /db_xref="InterPro:IPR004437"
                     /db_xref="InterPro:IPR036086"
                     /db_xref="InterPro:IPR041468"
                     /db_xref="UniProtKB/TrEMBL:B4E584"
                     /protein_id="CAR50333.1"
                     /translation="MNAVPKKKGLGRGLEALLGGSADITEAVKIEGAPNTLALGKLQA
                     GKYQPRTRMDEGSLQELAASIRAQGVMQPILVRPISSDKYEIIAGERRFRAARLAGLD
                     EVPVLVKDVSDQAAAAMALIENIQREDLNPLEEAHGIQRLLDEFGFTHEQAAESVGRS
                     RSAVSNLLRLLNLASPVQTMLLAGDLDMGHARALLAVDAATQITLAHQVVNKRMSVRE
                     TEKLVAHTTKEAPAVKARAKDDGGRDTRRLEEELSDLLASTVKIKLGRRGRGQVLIDF
                     GNLDALEGILARLRGNVATEE"
     misc_feature    30603..30875
                     /locus_tag="BCAL0027"
                     /note="HMMPfam hit to PF02195, ParB-like nuclease domain,
                     score 2e-35"
                     /inference="protein motif:HMMPfam:PF02195"
     misc_feature    30942..31007
                     /note="Predicted helix-turn-helix motif with score
                     1768.000, SD 5.21 at aa 148-169, sequence
                     FTHEQAAESVGRSRSAVSNLLR"
                     /inference="protein motif:helixturnhelix:EMBOSS"
     CDS             31405..32535
                     /transl_table=11
                     /locus_tag="BCAL0028"
                     /product="putative citrate transporter protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0028"
                     /db_xref="EnsemblGenomes-Tr:CAR50334"
                     /db_xref="GOA:B4E585"
                     /db_xref="InterPro:IPR004680"
                     /db_xref="UniProtKB/TrEMBL:B4E585"
                     /protein_id="CAR50334.1"
                     /translation="MEQTGAPAPRRWLGWLAQEPVLSVLALGLIVLQWVRPQPFSVLA
                     DRVDWQTVATLAGLLMLTKALELSGCLMWLAHRIVHHVHSERGLAMLLVGFAAVLSMW
                     LTNDVALFVVVPLMVSLRALTPLPFRRLVIVVALAVNAGSVATPLGNPQNLFLWQLSG
                     VSFGRFVVTLGPLAVALMALLLVLTALMFRAKPLDLSGDAASFPVQRMHALIAAVLFA
                     AFVLLADAHHPLPGLVGVAIVLLAVKRDAVLKIDWLLLLIFVLMFVVLRSAAALPVVH
                     DAVAHAQLDSPLRVYAAGAALSQVISNVPAAILLSEFTHDWRALAFGVSVGGFGFAIG
                     SLANLIAVRLAKEPRMWLPFHLVSIPFALVSAALGAWLLMHG"
     misc_feature    join(31441..31509,31675..31743,31777..31845,31903..31971,
                     32032..32133,32161..32229,32266..32334,32362..32430,
                     32455..32523)
                     /locus_tag="BCAL0028"
                     /note="9 probable transmembrane helices predicted for
                     BCAL0028 by TMHMM2.0 at aa 13-35, 91-113, 125-147,
                     167-189, 210-243, 253-275, 288-310, 320-342 and 351-373"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    31441..32388
                     /locus_tag="BCAL0028"
                     /note="HMMPfam hit to PF03600, Citrate transporter, score
                     5.2e-05"
                     /inference="protein motif:HMMPfam:PF03600"
     CDS             33104..33628
                     /transl_table=11
                     /locus_tag="BCAL0029"
                     /product="putative ATP synthase protein I AtpI"
                     /db_xref="EnsemblGenomes-Gn:BCAL0029"
                     /db_xref="EnsemblGenomes-Tr:CAR50335"
                     /db_xref="GOA:B4E586"
                     /db_xref="InterPro:IPR005598"
                     /db_xref="UniProtKB/TrEMBL:B4E586"
                     /protein_id="CAR50335.1"
                     /translation="MAGQAPDDRHDDQRTQRTASAAGARRESDDDWDVEQQDNNIVPL
                     TRAEAERLFGPNVSKPSRVTPYKVVFAQVVLSLVATLAWWLFSKSPGAAAQSAFLGGA
                     IGWVPSAVFVARLKAGGSATVMSWVMGEALKLALTIGMFTAVAFGWAGVHWVPFLVTY
                     LVVLKTYWIALAWR"
     misc_feature    join(33305..33364,33374..33442,33479..33547,33560..33619)
                     /locus_tag="BCAL0029"
                     /note="4 probable transmembrane helices predicted for
                     BCAL0029 by TMHMM2.0 at aa 68-87, 91-113, 126-148 and
                     153-172"
                     /inference="protein motif:TMHMM:2.0"
     CDS             33738..34589
                     /transl_table=11
                     /gene="atpB"
                     /locus_tag="BCAL0030"
                     /product="ATP synthase A chain"
                     /EC_number="3.6.3.14"
                     /db_xref="EnsemblGenomes-Gn:BCAL0030"
                     /db_xref="EnsemblGenomes-Tr:CAR50336"
                     /db_xref="GOA:B4E587"
                     /db_xref="InterPro:IPR000568"
                     /db_xref="InterPro:IPR023011"
                     /db_xref="InterPro:IPR035908"
                     /db_xref="UniProtKB/TrEMBL:B4E587"
                     /protein_id="CAR50336.1"
                     /translation="MAASEGTRGPDPSEYIAHHLQNFSTSHQTSIFDIHVWNLDTLFW
                     SIVCGIVTIVLLRLAARKATSGVPGRFQCAIEMLVEMVEDQSKAIVHGNRTFIAPLAL
                     TVFVWVALMNSLDFLPVDLPGRVIGLLGLSDVISHHRIVPTADLNGTLGIALGVFVLM
                     IYYSIKIKGAGGFVHELLSAPFGAHPLLWIPNLALNIVEYLAKTVSLGMRLFGNMYAG
                     ELLFLLIALLGSMWSFGGDATFLGFVGHVIAGSVWAIFHILIVLLQAFIFMMLTLVYL
                     GQAHDKH"
     misc_feature    33849..34571
                     /gene="atpB"
                     /locus_tag="BCAL0030"
                     /note="HMMPfam hit to PF00119, ATP synthase A chain, score
                     2.9e-55"
                     /inference="protein motif:HMMPfam:PF00119"
     misc_feature    join(33858..33917,34002..34070,34173..34232,34371..34439,
                     34497..34565)
                     /gene="atpB"
                     /locus_tag="BCAL0030"
                     /note="5 probable transmembrane helices predicted for
                     BCAL0030 by TMHMM2.0 at aa 47-66, 95-117, 152-171, 218-240
                     and 260-282"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    34353..34382
                     /note="PS00449 ATP synthase a subunit signature."
                     /inference="protein motif:Prosite:PS00449"
     CDS             34665..34934
                     /transl_table=11
                     /gene="atpE"
                     /locus_tag="BCAL0031"
                     /product="ATP synthase C chain"
                     /EC_number="3.6.3.14"
                     /db_xref="EnsemblGenomes-Gn:BCAL0031"
                     /db_xref="EnsemblGenomes-Tr:CAR50337"
                     /db_xref="GOA:B4EEY4"
                     /db_xref="InterPro:IPR000454"
                     /db_xref="InterPro:IPR002379"
                     /db_xref="InterPro:IPR005953"
                     /db_xref="InterPro:IPR020537"
                     /db_xref="InterPro:IPR035921"
                     /db_xref="InterPro:IPR038662"
                     /db_xref="UniProtKB/TrEMBL:B4EEY4"
                     /protein_id="CAR50337.1"
                     /translation="MQAYIANIQGLTAIGIGIIIGLGAIGACIGIALMGGKYIEACAR
                     QPELINPLQTKMFLLAGLIDAAFLIGVGVAMLFAFANPLLSKLAG"
     misc_feature    34695..34904
                     /gene="atpE"
                     /locus_tag="BCAL0031"
                     /note="HMMPfam hit to PF00137, ATP synthase subunit C,
                     score 5e-18"
                     /inference="protein motif:HMMPfam:PF00137"
     misc_feature    join(34701..34769,34830..34898)
                     /gene="atpE"
                     /locus_tag="BCAL0031"
                     /note="2 probable transmembrane helices predicted for
                     BCAL0031 by TMHMM2.0 at aa 15-37 and 58-80"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    34716..34748
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
                     /inference="protein motif:Prosite:PS00013"
     misc_feature    34791..34856
                     /note="PS00605 ATP synthase c subunit signature."
                     /inference="protein motif:Prosite:PS00605"
     CDS             35064..35534
                     /transl_table=11
                     /gene="atpF"
                     /locus_tag="BCAL0032"
                     /product="ATP synthase B chain"
                     /EC_number="3.6.3.14"
                     /db_xref="EnsemblGenomes-Gn:BCAL0032"
                     /db_xref="EnsemblGenomes-Tr:CAR50338"
                     /db_xref="GOA:B4EEY5"
                     /db_xref="InterPro:IPR002146"
                     /db_xref="InterPro:IPR005864"
                     /db_xref="InterPro:IPR028987"
                     /db_xref="UniProtKB/Swiss-Prot:B4EEY5"
                     /protein_id="CAR50338.1"
                     /translation="MNLNATLFAQMVVFLVLAWFTMKFVWPPLINALDERSKKIADGL
                     AAAEKGKAELDAAHKRVDQELAQARNDGQQRIADAEKRAQAVAEEIKANAQAEAARIV
                     AQAKAEAEQQIVKAREALRGEVAALAVKGAEQILKREVDQTAHAQLLNQLKAEL"
     misc_feature    35094..35474
                     /gene="atpF"
                     /locus_tag="BCAL0032"
                     /note="HMMPfam hit to PF00430, ATP synthase B/B' CF(0),
                     score 3e-25"
                     /inference="protein motif:HMMPfam:PF00430"
     CDS             35537..36076
                     /transl_table=11
                     /gene="atpH"
                     /locus_tag="BCAL0033"
                     /product="ATP synthase delta chain"
                     /EC_number="3.6.3.14"
                     /db_xref="EnsemblGenomes-Gn:BCAL0033"
                     /db_xref="EnsemblGenomes-Tr:CAR50339"
                     /db_xref="GOA:B4EEY6"
                     /db_xref="InterPro:IPR000711"
                     /db_xref="InterPro:IPR026015"
                     /db_xref="UniProtKB/Swiss-Prot:B4EEY6"
                     /protein_id="CAR50339.1"
                     /translation="MAELATIARPYAEALFRVAEGGDIAAWSTLVQELAQVARLPEVL
                     SVASSPKVTRTQVAELLLAAAKSPLAAGAEAKNFVQMLVDNHRIALLPEIAEQFEALK
                     NEREGAADAEIVSAFPLNGADLDSLVSGLERKFKRKLKPTVEVDSSLIGGVRVTVGDE
                     VLDTSVRARLASMQAALTA"
     misc_feature    35555..36067
                     /gene="atpH"
                     /locus_tag="BCAL0033"
                     /note="HMMPfam hit to PF00213, ATP synthase delta (OSCP)
                     subunit, score 9.6e-32"
                     /inference="protein motif:HMMPfam:PF00213"
     CDS             36121..37662
                     /transl_table=11
                     /gene="atpA"
                     /locus_tag="BCAL0034"
                     /product="ATP synthase alpha chain"
                     /EC_number="3.6.3.14"
                     /db_xref="EnsemblGenomes-Gn:BCAL0034"
                     /db_xref="EnsemblGenomes-Tr:CAR50340"
                     /db_xref="GOA:B4EEY7"
                     /db_xref="InterPro:IPR000194"
                     /db_xref="InterPro:IPR000793"
                     /db_xref="InterPro:IPR004100"
                     /db_xref="InterPro:IPR005294"
                     /db_xref="InterPro:IPR020003"
                     /db_xref="InterPro:IPR023366"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR033732"
                     /db_xref="InterPro:IPR036121"
                     /db_xref="InterPro:IPR038376"
                     /db_xref="UniProtKB/Swiss-Prot:B4EEY7"
                     /protein_id="CAR50340.1"
                     /translation="MQLNPSEISELIKSRIQGLEASADVRNQGTVISVTDGIVRIHGL
                     SDVMQGEMLEFPGNTFGLALNLERDSVGAVILGEYEHISEGDIVKTTGRILEVPVGPE
                     LVGRVVDALGNPIDGKGPVNAKLTDAIEKIAPGVIWRKSVSQPVQTGIKSIDAMVPIG
                     RGQRELIIGDRQCGKTAVALDAIINQKGKDLICIYVAIGQKASSIMNVVRKLEETGAM
                     EYTIVVAASASDSAAMQYLAPYAGCTMGEYFRDRGQDALIIYDDLTKQAWAYRQISLL
                     LRRPPGREAYPGDVFYLHSRLLERAARVSEEYVEKFTNGEVKGKSGSLTALPVIETQA
                     GDVTAFVPTNVISITDGQIFLETDLFNAGIRPAINAGVSVSRVGGAAQTKVVKKLSGG
                     IRTDLAQYRELAAFAQFASDLDEATRKQLERGRRVTELLKQPQYQPLQVWELAVSLYA
                     ANNGYLDDLDVKQVLSFEKGLRDNLKTSHADLIKRIEDTKDLSKDDEGALRSAIEAFK
                     KSGAY"
     misc_feature    36190..36396
                     /gene="atpA"
                     /locus_tag="BCAL0034"
                     /note="HMMPfam hit to PF02874, ATP synthase alpha/beta
                     family, beta-ba, score 2.2e-19"
                     /inference="protein motif:HMMPfam:PF02874"
     misc_feature    36562..37245
                     /gene="atpA"
                     /locus_tag="BCAL0034"
                     /note="HMMPfam hit to PF00006, ATP synthase alpha/beta
                     family, nucleot, score 5.7e-122"
                     /inference="protein motif:HMMPfam:PF00006"
     misc_feature    36625..36648
                     /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
                     /inference="protein motif:Prosite:PS00017"
     misc_feature    37216..37245
                     /note="PS00152 ATP synthase alpha and beta subunits
                     signature."
                     /inference="protein motif:Prosite:PS00152"
     misc_feature    37279..37593
                     /gene="atpA"
                     /locus_tag="BCAL0034"
                     /note="HMMPfam hit to PF00306, ATP synthase alpha/beta
                     chain, C termin, score 1.6e-33"
                     /inference="protein motif:HMMPfam:PF00306"
     CDS             37731..38606
                     /transl_table=11
                     /gene="atpG"
                     /locus_tag="BCAL0035"
                     /product="ATP synthase gamma chain"
                     /EC_number="3.6.3.14"
                     /db_xref="EnsemblGenomes-Gn:BCAL0035"
                     /db_xref="EnsemblGenomes-Tr:CAR50341"
                     /db_xref="GOA:B4EEY8"
                     /db_xref="InterPro:IPR000131"
                     /db_xref="InterPro:IPR023632"
                     /db_xref="InterPro:IPR035968"
                     /db_xref="UniProtKB/Swiss-Prot:B4EEY8"
                     /protein_id="CAR50341.1"
                     /translation="MAGMKEIRGKIKSVQNTRKITKAMEMVAASKMRRAQERMRAARP
                     YADKVRAIAAHMSRANPEYRHPFMVANDGAQTAGIILVTTDKGLCGGLNTNVLRATVQ
                     KFKELEEKGQKVEATAIGGKGLGFLNRFGAKVMSQVVHLGDTPHLDKLIGAVKTQLDL
                     YSEGKLSAVYIAYTRFVNTMKQEAVIEQLLPLSSDHFEADDGTPATSWDYIYEPDAQA
                     VVDELLVRYVEALVYQAVAENMASEQSARMVAMKAASDNAKTVISELQLVYNKSRQAA
                     ITKELSEIVGGAAAV"
     misc_feature    37734..38603
                     /gene="atpG"
                     /locus_tag="BCAL0035"
                     /note="HMMPfam hit to PF00231, ATP synthase, score
                     7.8e-134"
                     /inference="protein motif:HMMPfam:PF00231"
     misc_feature    38559..38600
                     /note="PS00153 ATP synthase gamma subunit signature."
                     /inference="protein motif:Prosite:PS00153"
     CDS             38673..40067
                     /transl_table=11
                     /gene="atpD"
                     /locus_tag="BCAL0036"
                     /product="ATP synthase beta chain"
                     /EC_number="3.6.3.14"
                     /db_xref="EnsemblGenomes-Gn:BCAL0036"
                     /db_xref="EnsemblGenomes-Tr:CAR50342"
                     /db_xref="GOA:B4EEY9"
                     /db_xref="InterPro:IPR000194"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004100"
                     /db_xref="InterPro:IPR005722"
                     /db_xref="InterPro:IPR020003"
                     /db_xref="InterPro:IPR024034"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR036121"
                     /db_xref="UniProtKB/Swiss-Prot:B4EEY9"
                     /protein_id="CAR50342.1"
                     /translation="MSTAALVEGKIVQCIGAVIDVEFPRDSMPKIYDALILDGSELTL
                     EVQQQLGDGVVRTICLGASDGLRRGLTVKNTAKPISVPVGKPTLGRIMDVLGRPIDEA
                     GPIDSDVTRSIHQKAPAFDELSPSTELLETGIKVIDLICPFAKGGKVGLFGGAGVGKT
                     VNMMELINNIAKEHGGYSVFAGVGERTREGNDFYHEMKDSNVLDKVALVYGQMNEPPG
                     NRLRVALTGLTMAEHFRDEGLDVLFFVDNIYRFTLAGTEVSALLGRMPSAVGYQPTLA
                     EEMGKLQERITSTKKGSITSVQAVYVPADDLTDPSPATTFGHLDATVVLSRDIASLGI
                     YPAVDPLDSTSRQIDPNVIGEEHYSITRRVQQTLQRYKELRDIIAILGMDELSPEDKL
                     SVARARKIQRFLSQPFHVAEVFTGSPGKYVPLKETIRGFKMIVDGECDHLPEQAFYMV
                     GTIDEAFEKAKKIQ"
     misc_feature    38703..38900
                     /gene="atpD"
                     /locus_tag="BCAL0036"
                     /note="HMMPfam hit to PF02874, ATP synthase alpha/beta
                     family, beta-ba, score 3.2e-23"
                     /inference="protein motif:HMMPfam:PF02874"
     misc_feature    39066..39707
                     /gene="atpD"
                     /locus_tag="BCAL0036"
                     /note="HMMPfam hit to PF00006, ATP synthase alpha/beta
                     family, nucleot, score 1.9e-96"
                     /inference="protein motif:HMMPfam:PF00006"
     misc_feature    39129..39152
                     /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
                     /inference="protein motif:Prosite:PS00017"
     misc_feature    39678..39707
                     /note="PS00152 ATP synthase alpha and beta subunits
                     signature."
                     /inference="protein motif:Prosite:PS00152"
     misc_feature    39744..40064
                     /gene="atpD"
                     /locus_tag="BCAL0036"
                     /note="HMMPfam hit to PF00306, ATP synthase alpha/beta
                     chain, C termin, score 4.6e-48"
                     /inference="protein motif:HMMPfam:PF00306"
     CDS             40189..40614
                     /transl_table=11
                     /gene="atpC"
                     /locus_tag="BCAL0037"
                     /product="ATP synthase epsilon chain"
                     /EC_number="3.6.3.14"
                     /db_xref="EnsemblGenomes-Gn:BCAL0037"
                     /db_xref="EnsemblGenomes-Tr:CAR50343"
                     /db_xref="GOA:B4EEZ0"
                     /db_xref="InterPro:IPR001469"
                     /db_xref="InterPro:IPR020546"
                     /db_xref="InterPro:IPR020547"
                     /db_xref="InterPro:IPR036771"
                     /db_xref="InterPro:IPR036794"
                     /db_xref="UniProtKB/Swiss-Prot:B4EEZ0"
                     /protein_id="CAR50343.1"
                     /translation="MATIKVDVVSAEEQIFSGEAKFVALPGETGELGILPGHTPLITR
                     IRPGAVRIEVEGGNDEFVFVAGGILEVQPGAVTVLADTAIRGKDLDAAKAEEARKRAE
                     ETLQNVKSDLDLAKAQSELATAMAQLEAIQRLAKIRSRH"
     misc_feature    40195..40443
                     /gene="atpC"
                     /locus_tag="BCAL0037"
                     /note="HMMPfam hit to PF02823, ATP synthase, Delta/Epsilon
                     chain, beta, score 2.5e-31"
                     /inference="protein motif:HMMPfam:PF02823"
     misc_feature    40447..40590
                     /gene="atpC"
                     /locus_tag="BCAL0037"
                     /note="HMMPfam hit to PF00401, ATP synthase, Delta/Epsilon
                     chain, long, score 0.0026"
                     /inference="protein motif:HMMPfam:PF00401"
     CDS             40897..42624
                     /transl_table=11
                     /locus_tag="BCAL0038"
                     /product="putative long-chain-fatty-acid--CoA ligase"
                     /db_xref="EnsemblGenomes-Gn:BCAL0038"
                     /db_xref="EnsemblGenomes-Tr:CAR50344"
                     /db_xref="GOA:B4EEZ1"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR020845"
                     /db_xref="InterPro:IPR025110"
                     /db_xref="InterPro:IPR042099"
                     /db_xref="UniProtKB/TrEMBL:B4EEZ1"
                     /protein_id="CAR50344.1"
                     /translation="MAADLGVGALIAPENGLSYVRGATDVPLSEATIGRFLLDTAGRF
                     PDRPAVVFREQQVRWTWREFANEIDVLAAGLAALGIVKGDCVGIWSPNRSEWLLTQFA
                     TARIGAVLVNINPAYRLSELEYALNKVGCKAVIAAERFKSSAYVEMLQTIAPELATAT
                     PGDLHAARVPSLRTIVSMGEVAPAGMFRFADVMARGRRAVDPALLDAIGATLSANDPI
                     NIQFTSGTTGSPKGATLTHRNVVNNARSIAMAMRFTEQDSLCIPVPLYHCFGMVLAVL
                     ACVSKGAAMVFPGEAFDPVATLAAVAEERCTALHGVPTMFIAELDHPEFAKFDLSTLR
                     TGIMAGSPCPIETMKRVVSQMHLSEITIAYGMTETSPVSFQSSTDDPLEKRTTTVGRI
                     QPHLEVKIVDPSGDIVPVGATGELCTKGYSVMLGYWDDDAKTREVLVDGWMHTGDLAT
                     LDADGYCNIVGRLKDMVIRGGENVYPREIEEFLFRHPKIQSAQVFGVPDAKYGEELCA
                     WIVLRADEQMTEDDVRAFCNGQIAHYKIPRYIRFVDELPMTVTGKVQKFVMRDRMIEE
                     LKLDVQKTA"
     misc_feature    41074..42378
                     /locus_tag="BCAL0038"
                     /note="HMMPfam hit to PF00501, AMP-binding enzyme, score
                     8e-129"
                     /inference="protein motif:HMMPfam:PF00501"
     misc_feature    41554..41589
                     /note="PS00455 Putative AMP-binding domain signature."
                     /inference="protein motif:Prosite:PS00455"
     misc_feature    41698..41730
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
                     /inference="protein motif:Prosite:PS00013"
     CDS             complement(43359..44171)
                     /transl_table=11
                     /gene="pheC"
                     /locus_tag="BCAL0039"
                     /product="periplasmic cyclohexadienyl dehydratase"
                     /EC_number="4.2.1.51"
                     /db_xref="EnsemblGenomes-Gn:BCAL0039"
                     /db_xref="EnsemblGenomes-Tr:CAR50345"
                     /db_xref="GOA:B4EEZ2"
                     /db_xref="InterPro:IPR001638"
                     /db_xref="InterPro:IPR018313"
                     /db_xref="InterPro:IPR037298"
                     /db_xref="UniProtKB/TrEMBL:B4EEZ2"
                     /protein_id="CAR50345.1"
                     /translation="MKTFATLATLAAAAAFCCAAAHAQSTATAAPASAATAGSRLDDV
                     LARGALRVCTTGDYKPYSYYRADGRFEGIDIDMAESLAKSLGVKTDYVKTSWSNLTND
                     FVAKCDIAVGGVSTTLERQKRVFFTQPYVVDGKTPIVRCADADKYQTVAQIDRPETRV
                     IVNPGGTNERFAKQFFTHANLTVYPDNVTIFKQILAGKADVMVTDASETLLQQKLNPG
                     LCSVHPDKPFQFGEKAYMVPRGDVVFQQYVDQWLHLARSTGEYQAISDKWLK"
     misc_feature    complement(43362..44024)
                     /gene="pheC"
                     /locus_tag="BCAL0039"
                     /note="HMMPfam hit to PF00497, Bacterial extracellular
                     solute-binding prot, score 5.9e-22"
                     /inference="protein motif:HMMPfam:PF00497"
     misc_feature    complement(43917..43958)
                     /note="PS01039 Bacterial extracellular solute-binding
                     proteins, family 3 signature."
                     /inference="protein motif:Prosite:PS01039"
     CDS             44321..45415
                     /transl_table=11
                     /gene="hemE"
                     /locus_tag="BCAL0040"
                     /product="uroporphyrinogen decarboxylase"
                     /EC_number="4.1.1.37"
                     /db_xref="EnsemblGenomes-Gn:BCAL0040"
                     /db_xref="EnsemblGenomes-Tr:CAR50346"
                     /db_xref="GOA:B4EEZ3"
                     /db_xref="InterPro:IPR000257"
                     /db_xref="InterPro:IPR006361"
                     /db_xref="InterPro:IPR038071"
                     /db_xref="UniProtKB/Swiss-Prot:B4EEZ3"
                     /protein_id="CAR50346.1"
                     /translation="MAHNLLNDTFLRALLREPTDYTPIWLMRQAGRYLPEYNATRARA
                     GSFLGLAKNPDYATEVTLQPLERFPLDAAILFSDILTIPDAMGLGLDFQVGEGPKFAH
                     PVRTEADVAKLAVPDIEATLGYVTGAVREIRRALTDAQGRQRVPLIGFSGSPWTLACY
                     MVEGGGSDDFRTVKSMAYSRPDLMHRILDVNAQAVAAYLNAQIEAGAQAVMIFDTWGG
                     ALADGAYQRFSLDYIRRVVSQLKREHDGERVPVITFTKGGGLWLEEIAATGVDAVGLD
                     WTVNLGAARERVAGRVALQGNLDPTILFAPPAAVREQARAVLDSYGNHPGHVFNLGHG
                     ISQFTSPDHVAELVDEVHTHSRAIRSGAAG"
     misc_feature    44333..45382
                     /gene="hemE"
                     /locus_tag="BCAL0040"
                     /note="HMMPfam hit to PF01208, Uroporphyrinogen
                     decarboxylase (URO-D), score 2.6e-165"
                     /inference="protein motif:HMMPfam:PF01208"
     misc_feature    44387..44416
                     /note="PS00906 Uroporphyrinogen decarboxylase signature
                     1."
                     /inference="protein motif:Prosite:PS00906"
     misc_feature    44765..44812
                     /note="PS00907 Uroporphyrinogen decarboxylase signature
                     2."
                     /inference="protein motif:Prosite:PS00907"
     misc_feature    44765..44797
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
                     /inference="protein motif:Prosite:PS00013"
     CDS             45867..48128
                     /transl_table=11
                     /gene="priA"
                     /locus_tag="BCAL0041"
                     /product="primosomal protein N'"
                     /db_xref="EnsemblGenomes-Gn:BCAL0041"
                     /db_xref="EnsemblGenomes-Tr:CAR50347"
                     /db_xref="GOA:B4EEZ4"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR005259"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR040498"
                     /db_xref="InterPro:IPR041222"
                     /db_xref="InterPro:IPR041236"
                     /db_xref="InterPro:IPR042115"
                     /db_xref="UniProtKB/TrEMBL:B4EEZ4"
                     /protein_id="CAR50347.1"
                     /translation="MSGTYLRVALDHPLATLFDYRCDAQPAPVPGTLVQVPFGKRQAV
                     GLVCEVTTHTDVPPSRLRAVDAICADLPPLSPDWLALVSFAADYYQRGRGEVALPALP
                     QALRDAGRWGRLLAPEVRYQPTEAGRAALPDALPARGAALRRLAQALVDTGSLTLPDA
                     RALHPKAAATLDDWAARGWVDVEEIGWADTPVAKPVDNLSTNGGRTVPPALTDQQAEA
                     LDAIRAAHGFAPFLLHGVTGSGKTEVYLHALASLLDARPDAQALVLVPEINLTPQFEA
                     AFRARFAGALADDAIVTLHSGLAEGERARNWLAAHTGRARIVLGTRLAVLASMPTLAL
                     IVVDEEHEPAYKQQEGLRYSARDLAVWRAKQLGITVVLGSATPSLESWWQAEQGRYTR
                     LTLSRRAVADATLPTVRLIDLEEERRRGRASMGGLSGPLVAALKARLERGEQSLVFLN
                     RRGYAPQLACDACGWVAGCPRCSAYVVLHKPEHALRCHHCGWEARIPRSCPECGNVDI
                     APLGRGTQRIEEALAEAVPGARILRIDADSTRRKGSAQALFSDVHAGEVDILVGTQMI
                     AKGHDFQRVSLVGVLNADTALFSHDFRASERLFAQLMQVSGRAGRAGLPGEVMVQTRY
                     PRHALYHALGRQDYVGFANSTLAERRDAHLPPFVYQALLRAEGRTLDAALAFLLQAAA
                     ALPGLPGADRVTVYDAVPMTIVKVANVHRAQLLLESASRAALQHALRAWQPALRALKG
                     VLRWSVEVDPLDI"
     misc_feature    46488..47003
                     /gene="priA"
                     /locus_tag="BCAL0041"
                     /note="HMMPfam hit to PF04851, Type III restriction
                     enzyme, res subunit, score 1.5e-09"
                     /inference="protein motif:HMMPfam:PF04851"
     misc_feature    46500..47012
                     /gene="priA"
                     /locus_tag="BCAL0041"
                     /note="HMMPfam hit to PF00270, DEAD/DEAH box helicase,
                     score 3.9e-18"
                     /inference="protein motif:HMMPfam:PF00270"
     misc_feature    46569..46592
                     /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
                     /inference="protein motif:Prosite:PS00017"
     misc_feature    46773..46814
                     /note="PS00036 bZIP transcription factors basic domain
                     signature."
                     /inference="protein motif:Prosite:PS00036"
     misc_feature    47433..47705
                     /gene="priA"
                     /locus_tag="BCAL0041"
                     /note="HMMPfam hit to PF00271, Helicase conserved
                     C-terminal domain, score 2.4e-06"
                     /inference="protein motif:HMMPfam:PF00271"
     CDS             48506..52438
                     /transl_table=11
                     /gene="putA"
                     /locus_tag="BCAL0042"
                     /product="bifunctional PutA protein [includes: proline
                     dehydrogenase; delta-1-pyrroline-5-carboxylate
                     dehydrogenase]"
                     /EC_number="1.5.99.8"
                     /db_xref="EnsemblGenomes-Gn:BCAL0042"
                     /db_xref="EnsemblGenomes-Tr:CAR50348"
                     /db_xref="GOA:B4EF02"
                     /db_xref="InterPro:IPR002872"
                     /db_xref="InterPro:IPR005933"
                     /db_xref="InterPro:IPR010985"
                     /db_xref="InterPro:IPR013321"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016160"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="InterPro:IPR024082"
                     /db_xref="InterPro:IPR024089"
                     /db_xref="InterPro:IPR025703"
                     /db_xref="InterPro:IPR029041"
                     /db_xref="InterPro:IPR041349"
                     /db_xref="UniProtKB/TrEMBL:B4EF02"
                     /protein_id="CAR50348.1"
                     /translation="MASTTLGVKVDDLLRSRLKDAAARLERTPHWLIKQAIFAYLERI
                     EHGQLPPELSGHSGVTELADGQAADGDDDNSPHPFLEFAQNVQPQSVLRAAITAAYRR
                     PEPECVPFLLGQARLPANLQADVQALATKLAEALREKSSGGGVEGLIHEFSLSSQEGV
                     ALMCLAEALLRIPDRATRDALIRDKISKGDWRSHVGHAPSLFVNAATWGLMITGKLVT
                     TNSEAGLSSALTRLIGRGGEPLIRKGVDMAMRLMGEQFVTGETISEALANSRKYEARG
                     FRYSYDMLGEAATTEEDAQRYYASYEQAIHAIGKAAGGRGIYEGPGISIKLSALHARY
                     SRSQQDRTMSELLPRVRALALLARRYDIGLNIDAEEADRLELSLDLLEALCFDPELAG
                     WNGIGFVVQGYQKRCPFVIDYLIDLARRSRHRLMIRLVKGAYWDTEIKRAQVDGLEGY
                     PVYTRKIYTDVSYLACAKKLLAAPDAVYPQFATHNAYTLAAIYQLAGQNYYPGQYEFQ
                     CLHGMGEPLYEEVTGRDKLNRPCRVYAPVGTHETLLAYLVRRLLENGANTSFVNRIAD
                     KTVSVKELVADPVDEASKVVPLGAPHAKIPLPRNLYGDERPNSMGLDLSNEHRLASLS
                     SALLASAHHPWRAAPMLADDALADAPARDVRNPADQRDVVGTVSEATSEHVSAALAHA
                     VAAAPIWQATPVDARADCLVRAADLLEAQMHTLMGLIVREAGKSLPNAIAEIREAVDF
                     LRYYAAQIRGEFSNDTHRPLGPVVCISPWNFPLAIFMGQVAAALAAGNTVLAKPAEQT
                     PLIAAQAVRLLREAGVPAGAVQLLPGTGETVGAALVADARTRAVMFTGSTEVARLINK
                     TLSARLDPDGKPIPLIAETGGQNAMIVDSSALAEQVVADVMQSSFDSAGQRCSALRVL
                     CLQDDVADRTLTMLKGAMHELALGNPDRLSTDVGPVIDAEAKQTIDTHIAAMKDKGHT
                     VTQLPMPDACAHGTFVPPTLIEIGSIDELKREVFGPVLHVVRYRRSQLDKLLEQIRAT
                     GYGLTLGIHTRIDETIAHVISNAHVGNIYVNRNVIGAVVGVQPFGGEGLSGTGPKAGG
                     ALYLQRLLATRPSGLPRALAQSLVADGATESDARGNPAAALTTLRDWLIEQREPALAA
                     RCDGYLAQVPAGATAVLTGPTGERNTYTLGPRGTVLCVAATPGGARAQFAAVLATGNR
                     ALFAGAAGEALVAALPASLKAHAAVRKQADAPFDAVLFEGDSDELQTLVKDVAQRPGP
                     IVSVQGVSAGAFENGGAEDYALERLLTERSVSVNTAAAGGNANLMTIG"
     misc_feature    49178..50209
                     /gene="putA"
                     /locus_tag="BCAL0042"
                     /note="HMMPfam hit to PF01619, Proline dehydrogenase,
                     score 6.9e-174"
                     /inference="protein motif:HMMPfam:PF01619"
     misc_feature    50441..51808
                     /gene="putA"
                     /locus_tag="BCAL0042"
                     /note="HMMPfam hit to PF00171, Aldehyde dehydrogenase
                     family, score 1.7e-109"
                     /inference="protein motif:HMMPfam:PF00171"
     misc_feature    50969..50986
                     /note="PS00343 Gram-positive cocci surface proteins
                     'anchoring' hexapeptide."
                     /inference="protein motif:Prosite:PS00343"
     misc_feature    51206..51241
                     /note="PS00070 Aldehyde dehydrogenases cysteine active
                     site."
                     /inference="protein motif:Prosite:PS00070"
     CDS             52523..53662
                     /transl_table=11
                     /locus_tag="BCAL0043"
                     /product="putative extracellular ligand-binding protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0043"
                     /db_xref="EnsemblGenomes-Tr:CAR50349"
                     /db_xref="GOA:B4EF03"
                     /db_xref="InterPro:IPR000709"
                     /db_xref="InterPro:IPR028081"
                     /db_xref="InterPro:IPR028082"
                     /db_xref="UniProtKB/TrEMBL:B4EF03"
                     /protein_id="CAR50349.1"
                     /translation="MQHTMKKVAGATFVAVMSLAGTAHADDVKIGYAGPMTGAQAHYG
                     KDMQNGIVLALEDFNATNPKIGGKPVKFVLSTQDDQADPRTGTTVAQKLVDDGIKGML
                     GHFNSGTTIPASRIYANAGIPEIAMATAPEYTQQGYKTTFRMMTSDTQQGSVAGTFAS
                     KDLGMKKIAIVDDRTAYGQGLADQFEKAAKAGGATIVDREFTNDKAVDFKAILTKLKA
                     AKPDLVYYGGADSQAAPMVKQMKALGFNAPLMSGEMVKTPTFLKIAGNAADGTIASLA
                     GLPLEEMPGGKTYADKYKKRFGEDVQTYSPYAYDGAMAMLNAMKKADSTDPAKYLPVL
                     AKTDMAGVTSTHVAYDAKGDLKNGGITMYKVEKGEWKPLKSIGGK"
     sig_peptide     52523..52597
                     /locus_tag="BCAL0043"
                     /note="Signal peptide predicted for BCAL0043 by SignalP
                     2.0 HMM (Signal peptide probability 1.000) with cleavage
                     site probability 0.999 between residues 25 and 26"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    52658..53626
                     /locus_tag="BCAL0043"
                     /note="HMMPfam hit to PF01094, Receptor family ligand
                     binding region, score 2.9e-48"
                     /inference="protein motif:HMMPfam:PF01094"
     repeat_region   53748..53750
                     /note="duplicated insertion sequence target"
     mobile_element  53751..55189
                     /mobile_element_type="insertion sequence:ISBcen9"
                     /note="putative IS element - ISBcen9"
     repeat_region   53751..53775
                     /note="IS element imperfect inverted repeat region"
     CDS             53796..54320
                     /transl_table=11
                     /locus_tag="BCAL0044"
                     /product="putative transposase"
                     /db_xref="EnsemblGenomes-Gn:BCAL0044"
                     /db_xref="EnsemblGenomes-Tr:CAR50350"
                     /db_xref="GOA:B4E6E7"
                     /db_xref="InterPro:IPR002514"
                     /db_xref="InterPro:IPR010921"
                     /db_xref="UniProtKB/TrEMBL:B4E6E7"
                     /protein_id="CAR50350.1"
                     /translation="MARYTEQFKLSVVKRCIGGEAIRAVARTHGLSHSTVSQWYATYQ
                     AHGKDGVRRKYNSYDVAFRLKVVQHMREHGVSSKEAAARFNIRNPSAVLEWARRYDDG
                     GLTALAPRPKGRRPTAMPKTPPAQPLNPTDGTDTRTREDLLQELNYLRMENAYLKKLR
                     ALVQAQAVPRKKRK"
     misc_feature    53853..53918
                     /note="Predicted helix-turn-helix motif with score
                     1703.000, SD 4.99 at aa 20-41, sequence
                     EAIRAVARTHGLSHSTVSQWYA"
                     /inference="protein motif:helixturnhelix:EMBOSS"
     CDS             54320..55156
                     /transl_table=11
                     /locus_tag="BCAL0045"
                     /product="putative transposase"
                     /db_xref="EnsemblGenomes-Gn:BCAL0045"
                     /db_xref="EnsemblGenomes-Tr:CAR50351"
                     /db_xref="GOA:B4E6E8"
                     /db_xref="InterPro:IPR001584"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR025948"
                     /db_xref="InterPro:IPR036397"
                     /db_xref="InterPro:IPR038965"
                     /db_xref="UniProtKB/TrEMBL:B4E6E8"
                     /protein_id="CAR50351.1"
                     /translation="MLELRQQFPLAGLLRVAGLARSTFYYQCKALAAPDRHASVKAKI
                     RALFEQHKGRYGYRRITLALRRLGQMINHKTVARLMRKMQLKSCVRVKKYRAYRGNTC
                     KTAPHLLQRQFHAARPNEKWVTDITEFSVGGQKLYLSPVLDLYNGEIIAYQTHTRPAF
                     QMVTDMLRKALRRLQPDERPMLHSDQGWHYQMPGWRLMLEQRSLAQSMSRKGNCLDNA
                     AMESFFGTLKSEFFYLNHFSSIEQLRIGLKRYIRYYNHERIKLKLKGLSPVQYRTQPH
                     PA"
     misc_feature    54659..55138
                     /locus_tag="BCAL0045"
                     /note="HMMPfam hit to PF00665, Integrase core domain,
                     score 5.1e-42"
                     /inference="protein motif:HMMPfam:PF00665"
     repeat_region   complement(55165..55189)
                     /note="IS element imperfect inverted repeat region"
     repeat_region   55190..55192
                     /note="duplicated insertion sequence target"
     CDS             complement(55228..56736)
                     /transl_table=11
                     /locus_tag="BCAL0046"
                     /product="putative fatty-acid CoA ligase"
                     /db_xref="EnsemblGenomes-Gn:BCAL0046"
                     /db_xref="EnsemblGenomes-Tr:CAR50352"
                     /db_xref="GOA:B4EEZ5"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR020845"
                     /db_xref="InterPro:IPR025110"
                     /db_xref="InterPro:IPR042099"
                     /db_xref="UniProtKB/TrEMBL:B4EEZ5"
                     /protein_id="CAR50352.1"
                     /translation="MNLVAALDRVARATPDKPFLVSESATITYAAARARSHRAAAVLS
                     ALGVAAGDRVAAMCFNTPAFVDLMFGAWRLGAAFVPINHKLQAPEVDYVLEHSGSTAL
                     LFDVALAPVVERLVHPARRLVTEGELDGVPNFDTMCATMDGLAGIEPADDDIAQILYT
                     SGTTGRPKGCVHSHRTVTLAAMQAALAIGIGRNERTLMAMPIWHSSPLNNWFGGTLVA
                     GGTVVLLREYHPLRFLQTVERERVTLYFGAPVSYTLPLDTIDGFAAFDLSSVRAWLYG
                     GGPIGAAQAERLAQAYRSHAFFQVYGMTETGPAGTTLYPDEQIAKAGSIGRQGGPGVD
                     LRVVRMDGVDARPGETGEIWLKADSMMLGYLDDAAATRAAFAPDGWYRTDDVARIDQE
                     GYLFIVDRLKDMIVTGGENVYSKEVEDVLGAHPDIAEAAVVGVPHPDWGETVVAHVVM
                     RANAVRDADALRTFCGERLAAYKIPREFTFAQALPRTPTGKLQKFLLRVRGN"
     misc_feature    complement(55441..56655)
                     /locus_tag="BCAL0046"
                     /note="HMMPfam hit to PF00501, AMP-binding enzyme, score
                     3.9e-114"
                     /inference="protein motif:HMMPfam:PF00501"
     misc_feature    complement(56233..56268)
                     /note="PS00455 Putative AMP-binding domain signature."
                     /inference="protein motif:Prosite:PS00455"
     CDS             complement(56788..58440)
                     /transl_table=11
                     /locus_tag="BCAL0047"
                     /product="putative acyl-CoA dehydrogenase"
                     /db_xref="EnsemblGenomes-Gn:BCAL0047"
                     /db_xref="EnsemblGenomes-Tr:CAR50353"
                     /db_xref="GOA:B4EEZ6"
                     /db_xref="InterPro:IPR006089"
                     /db_xref="InterPro:IPR006091"
                     /db_xref="InterPro:IPR009075"
                     /db_xref="InterPro:IPR009100"
                     /db_xref="InterPro:IPR036250"
                     /db_xref="InterPro:IPR041504"
                     /db_xref="UniProtKB/TrEMBL:B4EEZ6"
                     /protein_id="CAR50353.1"
                     /translation="MTDSTHAVTNQFDELVDYNLFATDLALRDALARAGADWAVPQLD
                     AYAARLGSADTARLADEANRHTPELNTFDRRGRRIDRVDFHPAWHALLGQYRHEGFVS
                     LAFRDARRGRWAATAAGFYLHGQIEAGTLCPATMTQAAIPVLQKEPALWDLLRDKLYS
                     DDYDPRDVPVADKRAIWFGMGMTEKQGGSDVRANTTLATPVGAGGRGGEYRLRGHKWF
                     FSAPMCDAHLVVARTEAGSPSCFYVPRWRPDGTKNAVEIQRLKNKVGNRSNSSSEIEL
                     NDAWGIMLGDEGRGIPTIIEMATYTRLNCVLGSAAMLRQGVVQAIAYTRQRHAFGRAL
                     AEQPLMRTVLADLALESEAALSLAMRLADAFERDDSPRERAWKRIVTPAAKFWVCKRA
                     VELTGEVMEVFGGNGYVDDGPIARLFREAPVNSIWEGSGNVMCLDVLRAVSREPDAAA
                     ALFDELADLGAGEPRIRAALDGLRAMLAAPADTLEASGRVFAQRLALVAQACLLRRDA
                     PAAVADAFVATRLAAPDWGRIAGGFDPHAIDVAALLQRAYPA"
     misc_feature    complement(57112..57579)
                     /locus_tag="BCAL0047"
                     /note="HMMPfam hit to PF00441, Acyl-CoA dehydrogenase,
                     C-terminal doma, score 1.5e-44"
                     /inference="protein motif:HMMPfam:PF00441"
     misc_feature    complement(57145..57528)
                     /locus_tag="BCAL0047"
                     /note="HMMPfam hit to PF08028, Acyl-CoA dehydrogenase,
                     C-terminal doma, score 8.6e-06"
                     /inference="protein motif:HMMPfam:PF08028"
     misc_feature    complement(57181..57240)
                     /note="PS00073 Acyl-CoA dehydrogenases signature 2."
                     /inference="protein motif:Prosite:PS00073"
     misc_feature    complement(57739..57906)
                     /locus_tag="BCAL0047"
                     /note="HMMPfam hit to PF02770, Acyl-CoA dehydrogenase,
                     middle domain, score 1.6e-16"
                     /inference="protein motif:HMMPfam:PF02770"
     misc_feature    complement(57862..57900)
                     /note="PS00072 Acyl-CoA dehydrogenases signature 1."
                     /inference="protein motif:Prosite:PS00072"
     CDS             58561..59229
                     /transl_table=11
                     /locus_tag="BCAL0048A"
                     /product="TetR family regulatory protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0048A"
                     /db_xref="EnsemblGenomes-Tr:CAR50354"
                     /db_xref="GOA:B4EEZ7"
                     /db_xref="InterPro:IPR001647"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR023772"
                     /db_xref="UniProtKB/TrEMBL:B4EEZ7"
                     /protein_id="CAR50354.1"
                     /translation="MPPRHVQVPAPPGSPAAQPAPALRRRPRQSRAQASSDALQQAFV
                     QLLLERGYAKATIREIAAVAGVSIGTFYEYFGDKQSLAALCIHRRVLALADRLRDAVQ
                     RLRGAPRAELAAALVDLQVETIAADAALWGALFVLERQVSPLAAYRRHYDAYVALWRD
                     ALAHAADPPPAARLDGLARMAHTICYGGLSQALLTLGPALDFAAQRRELRAVLLAYLA
                     AAHA"
     misc_feature    58675..58815
                     /locus_tag="BCAL0048A"
                     /note="HMMPfam hit to PF00440, Bacterial regulatory
                     proteins, tetR family, score 1.6e-12"
                     /inference="protein motif:HMMPfam:PF00440"
     misc_feature    58711..58803
                     /note="PS01081 Bacterial regulatory proteins, tetR family
                     signature."
                     /inference="protein motif:Prosite:PS01081"
     misc_feature    58723..58788
                     /note="Predicted helix-turn-helix motif with score
                     1231.000, SD 3.38 at aa 55-76, sequence
                     ATIREIAAVAGVSIGTFYEYFG"
                     /inference="protein motif:helixturnhelix:EMBOSS"
     CDS             59441..60595
                     /transl_table=11
                     /locus_tag="BCAL0049"
                     /product="putative aminotransferase"
                     /db_xref="EnsemblGenomes-Gn:BCAL0049"
                     /db_xref="EnsemblGenomes-Tr:CAR50355"
                     /db_xref="GOA:B4EEZ8"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:B4EEZ8"
                     /protein_id="CAR50355.1"
                     /translation="MRSATAPRSKLPDVGTTIFTVIGQLAAQHNALNLSQGAPNFAPD
                     PALVEGVARAMRDGHNQYAPMAGVIALRERLAEKTEALYGARYDPATEITVIASASEG
                     LYAAISALVHPGDEVIYFEPSFDSYAPIVRLQGATPVAIKLSPEHFRVDWDEVAAAIT
                     PRTRMIIVNTPHNPTATVFSADDLERLARLTRDTGIVVLSDEVYEHVVFDGAQHQSVA
                     RHRELAERSVIVSSFGKSFHVTGWRVGHCLAPAELMDEIRKVHQFMVFSADTPMQVAF
                     AEILARPDSYLGLSAFYQAKRDLLARELADSRFELLPSEGSFFMLARFRHFSDESDGD
                     FVLRLIRDARVATIPLSAFYTDGTDAGVIRLSFSKDDATLVEGARRLRSL"
     misc_feature    59525..60583
                     /locus_tag="BCAL0049"
                     /note="HMMPfam hit to PF00155, Aminotransferase class I
                     and II, score 2.3e-59"
                     /inference="protein motif:HMMPfam:PF00155"
     repeat_region   60637
                     /note="duplicated insertion sequence target"
     mobile_element  60638..62062
                     /mobile_element_type="insertion sequence:ISBcen5"
                     /note="putative IS element - ISBcen5"
     repeat_region   60645..60657
                     /note="IS element inverted repeat region"
     CDS             60764..61783
                     /transl_table=11
                     /locus_tag="BCAL0050"
                     /product="putative transposase"
                     /db_xref="EnsemblGenomes-Gn:BCAL0050"
                     /db_xref="EnsemblGenomes-Tr:CAR50356"
                     /db_xref="GOA:B4EDC6"
                     /db_xref="InterPro:IPR002525"
                     /db_xref="InterPro:IPR003346"
                     /db_xref="UniProtKB/TrEMBL:B4EDC6"
                     /protein_id="CAR50356.1"
                     /translation="MNSMAVGVDVAKQVFQVHYVDRETGGIVNKAIKRAKFLEFFANR
                     AACLIGMEACGGAHHWARQLTQMGHEVRLMPAEFVKAFNIRNKNDAADARAIWLAVQQ
                     PGKPVAVKTEMQQAMVALHRMREQLVKFRTMQVNGLRGLLTEYGEVMSKGRAKLDKEI
                     PVVLGRIAERLPAALIDTLREQWNGLAKLDEQIAEIERRMREWKKEDKAVKAISEIPG
                     VGLLTATAAVAMMGDPKAFSSGREFAAWAGLVPKQTGSGGKVNLHGISKRGDMYLRTL
                     LIHGARSVLTHAKEPGEWIEQMKKRRPPNVVIVALANKMARTIWAVLAHDRPYQKGYV
                     SVKPA"
     misc_feature    61319..61645
                     /locus_tag="BCAL0050"
                     /note="HMMPfam hit to PF02371, Transposase
                     IS116/IS110/IS902 family, score 2e-31"
                     /inference="protein motif:HMMPfam:PF02371"
     repeat_region   complement(62047..62059)
                     /note="IS element inverted repeat region"
     repeat_region   62063
                     /note="duplicated insertion sequence target"
     CDS             62070..62858
                     /transl_table=11
                     /locus_tag="BCAL0051"
                     /product="periplasmic solute-binding protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0051"
                     /db_xref="EnsemblGenomes-Tr:CAR50357"
                     /db_xref="InterPro:IPR001638"
                     /db_xref="InterPro:IPR018313"
                     /db_xref="UniProtKB/TrEMBL:B4EF00"
                     /protein_id="CAR50357.1"
                     /translation="MKHTATLKLAFALACAIGSGAALADAPTLRFGLEAQYPPFESKA
                     PNGDLQGFDIDVGNAVCQTAKLSCKWVETSFDGLIPALKGRKFDAINSAMNATEQRRQ
                     AIDFTTIIYRVPTQLIARTGSGLLPTPESLKGKRVGVLQASIQETFAKAHWEPAGVAI
                     VAYQDQNQAYADLVAGRLDATLVLAPSGQRGFLSRPDGKGFSFVGQPVHDDKILGSGI
                     AFGLRKGDDALKAKLDAAIDKLKADGTVKSLGLKYFGDIDISTK"
     sig_peptide     62088..62141
                     /locus_tag="BCAL0051"
                     /note="Signal peptide predicted for BCAL0051 by SignalP
                     2.0 HMM (Signal peptide probability 1.000) with cleavage
                     site probability 0.999 between residues 18 and 19"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    62154..62837
                     /locus_tag="BCAL0051"
                     /note="HMMPfam hit to PF00497, Bacterial extracellular
                     solute-binding prot, score 6.3e-75"
                     /inference="protein motif:HMMPfam:PF00497"
     misc_feature    62220..62261
                     /note="PS01039 Bacterial extracellular solute-binding
                     proteins, family 3 signature."
                     /inference="protein motif:Prosite:PS01039"
     CDS             62874..64304
                     /transl_table=11
                     /locus_tag="BCAL0052"
                     /product="putative oxidoreductase"
                     /db_xref="EnsemblGenomes-Gn:BCAL0052"
                     /db_xref="EnsemblGenomes-Tr:CAR50358"
                     /db_xref="GOA:B4EF01"
                     /db_xref="InterPro:IPR004113"
                     /db_xref="InterPro:IPR006094"
                     /db_xref="InterPro:IPR016164"
                     /db_xref="InterPro:IPR016166"
                     /db_xref="InterPro:IPR016167"
                     /db_xref="InterPro:IPR016169"
                     /db_xref="InterPro:IPR016171"
                     /db_xref="InterPro:IPR036318"
                     /db_xref="UniProtKB/TrEMBL:B4EF01"
                     /protein_id="CAR50358.1"
                     /translation="MPTPNPTVAGRAPDGRPLPDDAVDAVLAAELGDALVTRAADIDP
                     RYFTAYNEPAGVRPRALVRPRSVDDVSRALALCMRLGQPVVPQGGLTGLARGAVALGG
                     EVVLSMERFAGIEALDAAAGTITVRAGTPLQTVQDAAEAAGFTFGVDLGARGSCQIGG
                     MLATNAGGTRAIRYGMMREQVLGLEAVLADGTVVSSMNRMLKNNAGYDLKQLFIGSEG
                     TLGVVTRAVLRLHPLLAAPATALCRVRDYDAVVALWNRVRTLPEVVSFEAMWPAFYDY
                     VARHTPGVSAPFVGDGGFVVLIECATSAPGGDAHHALETALAAGFDAALVDDAVLATS
                     ERQARDLWTLREGLAIDALPHLVNFDVSLPTGELGAFAERCEAVLRTRWPALTCLFFG
                     HVGDGNVHIGVSLAAMTDADADALDHCVYAVVRDMGGSVSAEHGIGVLKRPYLAHTRS
                     DAEIGLMRRLKAALDPRGILNPGKVL"
     misc_feature    63045..63464
                     /locus_tag="BCAL0052"
                     /note="HMMPfam hit to PF01565, FAD binding domain, score
                     3.6e-47"
                     /inference="protein motif:HMMPfam:PF01565"
     misc_feature    63186..63215
                     /note="PS00339 Aminoacyl-transfer RNA synthetases class-II
                     signature 2."
                     /inference="protein motif:Prosite:PS00339"
     misc_feature    63570..64298
                     /locus_tag="BCAL0052"
                     /note="HMMPfam hit to PF02913, FAD linked oxidases,
                     C-terminal domain, score 2e-48"
                     /inference="protein motif:HMMPfam:PF02913"
     CDS             complement(64350..64922)
                     /transl_table=11
                     /locus_tag="BCAL0053"
                     /product="PadR family regulatory protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0053"
                     /db_xref="EnsemblGenomes-Tr:CAR50359"
                     /db_xref="InterPro:IPR005149"
                     /db_xref="InterPro:IPR036388"
                     /db_xref="InterPro:IPR036390"
                     /db_xref="UniProtKB/TrEMBL:B4EF06"
                     /protein_id="CAR50359.1"
                     /translation="MSTSRPSPLALAVLATLTETPMHPYGMLQQLKARGYDEVVNVRQ
                     RTSLYQTIDRLLRDGLIAVHDTERDGAFPERTLYALTEAGHTAGQAWLHALLAEPARE
                     FPAFGAGLAFLPLLDAEDARHQLELRIARLDAERERLEALRATAQADQVPRLFLLQNE
                     HALVLLNAELDWARSVVEHLKIGALRWVDG"
     misc_feature    complement(64650..64916)
                     /locus_tag="BCAL0053"
                     /note="HMMPfam hit to PF03551, Transcriptional regulator
                     PadR-like family, score 6.4e-09"
                     /inference="protein motif:HMMPfam:PF03551"
     CDS             complement(64991..65422)
                     /transl_table=11
                     /locus_tag="BCAL0054"
                     /product="MerR family regulatory protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0054"
                     /db_xref="EnsemblGenomes-Tr:CAR50360"
                     /db_xref="GOA:B4EF07"
                     /db_xref="InterPro:IPR000551"
                     /db_xref="InterPro:IPR009061"
                     /db_xref="InterPro:IPR011791"
                     /db_xref="InterPro:IPR015358"
                     /db_xref="UniProtKB/TrEMBL:B4EF07"
                     /protein_id="CAR50360.1"
                     /translation="MKIGELAKAARCTPETIRFYEKEGLMPDAERTDSNYRNYTDVHV
                     ERLRFIRNCRALDMAHDEIRALLRLTDTPADRCDSINSLLDDHIGHVDARLAELTQLR
                     DQLTELRRQCVGEHSVEDCGIVHGLATMETVAPAAKRSHLG"
     misc_feature    complement(65306..65419)
                     /locus_tag="BCAL0054"
                     /note="HMMPfam hit to PF00376, MerR family regulatory
                     protein, score 4.3e-12"
                     /inference="protein motif:HMMPfam:PF00376"
     misc_feature    complement(65345..65413)
                     /note="PS00552 Bacterial regulatory proteins, merR family
                     signature."
                     /inference="protein motif:Prosite:PS00552"
     misc_feature    complement(65357..65422)
                     /note="Predicted helix-turn-helix motif with score
                     1631.000, SD 4.74 at aa 1-22, sequence
                     MKIGELAKAARCTPETIRFYEK"
                     /inference="protein motif:helixturnhelix:EMBOSS"
     CDS             65504..68044
                     /transl_table=11
                     /locus_tag="BCAL0055"
                     /product="putative heavy metal resistance membrane ATPase"
                     /db_xref="EnsemblGenomes-Gn:BCAL0055"
                     /db_xref="EnsemblGenomes-Tr:CAR50361"
                     /db_xref="GOA:B4EF08"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR006121"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023298"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="InterPro:IPR027256"
                     /db_xref="InterPro:IPR036163"
                     /db_xref="InterPro:IPR036412"
                     /db_xref="UniProtKB/TrEMBL:B4EF08"
                     /protein_id="CAR50361.1"
                     /translation="MTDAKRPHDPRHRHTGGADACCAEARDTQTATVADAAPAAGERA
                     HGHDHDHGHDHAAHGKAGHDHDHGHAGDDQHVHGATCSHDHAAHDHAGHDHDHDHDHD
                     HDHDHDHAAGDCCAPAALTLAPLPVARATASGHVRSAFRIMQMDCPTEETLIRKKLGG
                     MSEVSALEFNLMQRMLTVEHAPGAQPAIESAIRTLGMTPEAATAGAPAARVADAPAKP
                     WWPLALAGVAAIASEGATWAGLPVWLSAALALAAVLACGLTTYKKGWIAIRNGNLNIN
                     ALMSIAVTGAMAIGQWPEAAMVMVLFTIAELIEAKSLDRARNAIQGLMQLAPDTATVQ
                     QADGAWRTIEAAQVALGAVVRVKPGERIGLDGEVVAGRSTVNQAPITGESLPVEKASG
                     DAVYAGTINESGSFDYRVTAVAANSTLARIIHAVEEAQGAKAPTQRFVDQFARVYTPI
                     VFAVALLVAVVPPLVMGGAWHDWIYRALVLLVIACPCALVISTPVTIVSGLAAAARRG
                     ILVKGGVYLEEGRKLAWLALDKTGTITHGKPVQTDFDVHADDADAARVRHLGASLAAR
                     SDHPVSQAIAAAARDAGTTAFADVQDFEAIVGRGVRGTIDGTRYWLGNHRLVEELERC
                     STALEAKLDALERQGKSVVVLVDETRVLGLFAVADTIKDTSRDAIADLHALGIRTAML
                     TGDNPHTAQAIAQQAGIDDARGNQLPEDKLAAVEELSAGGAGAVGMVGDGINDAPALA
                     RADIGFAMGAMGTDTAIETADVALMDDDLRKIPAFVRLSRATHRVLVQNIGFALGVKV
                     VFLGLTVAGLGTMWMAVFADAGASLIVVANGLRLLSSSGAFGGARAQR"
     misc_feature    join(66218..66286,66344..66412,66830..66898,66941..67009,
                     67856..67924,67937..68005)
                     /locus_tag="BCAL0055"
                     /note="6 probable transmembrane helices predicted for
                     BCAL0055 by TMHMM2.0 at aa 104-126, 146-168, 308-330,
                     345-367, 650-672 and 677-699"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    66392..67060
                     /locus_tag="BCAL0055"
                     /note="HMMPfam hit to PF00122, E1-E2 ATPase, score
                     6.2e-91"
                     /inference="protein motif:HMMPfam:PF00122"
     misc_feature    67070..67759
                     /locus_tag="BCAL0055"
                     /note="HMMPfam hit to PF00702, haloacid dehalogenase-like
                     hydrolase, score 1.1e-33"
                     /inference="protein motif:HMMPfam:PF00702"
     misc_feature    67088..67108
                     /note="PS00154 E1-E2 ATPases phosphorylation site."
                     /inference="protein motif:Prosite:PS00154"
     misc_feature    67403..67426
                     /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
                     /inference="protein motif:Prosite:PS00017"
     CDS             complement(68591..69472)
                     /transl_table=11
                     /locus_tag="BCAL0056"
                     /product="AraC family regulatory protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0056"
                     /db_xref="EnsemblGenomes-Tr:CAR50362"
                     /db_xref="GOA:B4EF09"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR010499"
                     /db_xref="InterPro:IPR011256"
                     /db_xref="InterPro:IPR018060"
                     /db_xref="InterPro:IPR018062"
                     /db_xref="InterPro:IPR020449"
                     /db_xref="InterPro:IPR029442"
                     /db_xref="UniProtKB/TrEMBL:B4EF09"
                     /protein_id="CAR50362.1"
                     /translation="MPPTETNPEPPAWARYAASVARVHAYISTHLDGPLDLNRLAEVA
                     CLSPYHWQRVYRALYGESIVLTVRRMRIVRASEDLVCTTRPLDEIARRAGYGSTHAFA
                     RAFRDAYGVLPAQHRRTGSHRPIYPLQRGEEDMFKHEVEIRRLPALRGYAVAHTGAYM
                     KVGDAFGRIGAWAGQHGLIGPGAKMIGIFYDDPDTTPEAQLRAKACLMPADGAPDVAP
                     VPPVERATIAGGEYAVLLHTGPYADLKTAYQWLYGDWLRHSGREAADAPPFELYLNTP
                     MDTAPADLRTEIHLPLR"
     misc_feature    complement(68594..69061)
                     /locus_tag="BCAL0056"
                     /note="HMMPfam hit to PF06445, Bacterial transcription
                     activator, effect, score 6.3e-41"
                     /inference="protein motif:HMMPfam:PF06445"
     misc_feature    complement(69119..69253)
                     /locus_tag="BCAL0056"
                     /note="HMMPfam hit to PF00165, Bacterial regulatory
                     helix-turn-helix pro, score 6.4e-05"
                     /inference="protein motif:HMMPfam:PF00165"
     misc_feature    complement(69134..69262)
                     /note="PS00041 Bacterial regulatory proteins, araC family
                     signature."
                     /inference="protein motif:Prosite:PS00041"
     CDS             69748..71211
                     /transl_table=11
                     /locus_tag="BCAL0057"
                     /product="putative membrane protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0057"
                     /db_xref="EnsemblGenomes-Tr:CAR50363"
                     /db_xref="GOA:B4EF10"
                     /db_xref="InterPro:IPR008910"
                     /db_xref="UniProtKB/TrEMBL:B4EF10"
                     /protein_id="CAR50363.1"
                     /translation="MDASSFITSLQTTLGGYLPKIAGAIGILVIGWLIAVAVRAGALR
                     LLNALKVDQRITDSTGQGACVERIIAGGLFWLVLLVTAVGIFNVLNLYAVSNPFSLLV
                     THIVTYLPNLIGGAALTLIAWLIASLLRSLANRALKASKVDATLSESAGMQPMSGYLG
                     DVLFWLVILMFLPAILASFALSGLLSPVQGMVDKLLAIVPNIFAAAVIGFVGWVVARV
                     LRGLVTNLLVAAGADRLTQGIDSPTPVRVSSLVGTIVYVFVFVPTLISALDALKIDAI
                     SIPATNMLNQFLGAVPDIVAAIVIVLVTFYFARFVASLAQKLLEAAGVDGLPAVLGVE
                     RVFSGILQPSVLVARLIVFFAMLFASVEAANRLGFSQVRDVVTLFIEFGGHVLMGGVI
                     LVIGVWLAGLARRVIEQADREHSVLFARIVQFAILGLVFAMGLRAMGIANEIVQLAFG
                     LVLGAIAVAVALSFGLGGREAAGKLLDRWFNQRGGGQ"
     misc_feature    69757..69915
                     /locus_tag="BCAL0057"
                     /note="HMMPfam hit to PF05552, Conserved TM helix, score
                     5.2e-13"
                     /inference="protein motif:HMMPfam:PF05552"
     misc_feature    join(69808..69876,69937..70005,70063..70131,70231..70299,
                     70327..70395,70492..70560,70603..70671,70780..70839,
                     70897..70956,70993..71052,71080..71148)
                     /locus_tag="BCAL0057"
                     /note="11 probable transmembrane helices predicted for
                     BCAL0057 by TMHMM2.0 at aa 34-56, 77-99, 119-141, 175-197,
                     207-229, 262-284, 299-321, 358-377, 397-416, 429-448 and
                     458-480"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    70030..70188
                     /locus_tag="BCAL0057"
                     /note="HMMPfam hit to PF05552, Conserved TM helix, score
                     1.3e-11"
                     /inference="protein motif:HMMPfam:PF05552"
     misc_feature    70300..70458
                     /locus_tag="BCAL0057"
                     /note="HMMPfam hit to PF05552, Conserved TM helix, score
                     2.7e-16"
                     /inference="protein motif:HMMPfam:PF05552"
     misc_feature    70576..70734
                     /locus_tag="BCAL0057"
                     /note="HMMPfam hit to PF05552, Conserved TM helix, score
                     1.2e-11"
                     /inference="protein motif:HMMPfam:PF05552"
     CDS             71401..72813
                     /transl_table=11
                     /locus_tag="BCAL0058"
                     /product="putative ethanolamine permease"
                     /db_xref="EnsemblGenomes-Gn:BCAL0058"
                     /db_xref="EnsemblGenomes-Tr:CAR50364"
                     /db_xref="GOA:B4EF11"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004757"
                     /db_xref="UniProtKB/TrEMBL:B4EF11"
                     /protein_id="CAR50364.1"
                     /translation="MKAESNGRPAAGAKLSGQPALQQTLGTCQLWGIAVGLVISGEYF
                     GWSYGWASAGTLGFVITALFVAAMYTTFIFSFTELTTSIPHAGGPFAYARRAFGPTGG
                     YLAGAATLVEFVFAPPAIALAIGAYLHVQFPGLEPKHAAMGAYLVFMALNIVGVQIAA
                     TFELVVTLLAIFELLVFMGVVSPGFAWSNFTKGGWSGADHFSLGAFHGMFAAIPFAIW
                     FFLAIEGVAMAAEEAKNPKRSIPIAYVAGILTLVALAIGVMVFAGGAGDWTKLANIND
                     PLPQAMKYIVGANSGWMHMLVWLGLFGLVASFHGIILGYSRQIFALAREGYLPEWLAK
                     VHPRFKTPYRAILAGGVVGIAAIYSDELIQFGGQTLTANIVTMSVFGAIVMYIVSMAA
                     LFKLRRSQPNLERPFRAPLYPIFPAFAILAALVCLGTMVYFNGLVALVFVGFLAVGYA
                     YFLATRAQRASAPGDALLEE"
     misc_feature    join(71482..71550,71560..71628,71704..71772,71815..71883,
                     71902..71970,72013..72081,72118..72186,72274..72342,
                     72424..72477,72520..72588,72625..72693,72706..72759)
                     /locus_tag="BCAL0058"
                     /note="12 probable transmembrane helices predicted for
                     BCAL0058 by TMHMM2.0 at aa 28-50, 54-76, 102-124, 139-161,
                     168-190, 205-227, 240-262, 292-314, 342-359, 374-396,
                     409-431 and 436-453"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    71485..72801
                     /locus_tag="BCAL0058"
                     /note="HMMPfam hit to PF00324, Amino acid permease, score
                     1.1e-07"
                     /inference="protein motif:HMMPfam:PF00324"
     CDS             72953..74350
                     /transl_table=11
                     /gene="eutB"
                     /locus_tag="BCAL0059"
                     /product="ethanolamine ammonia-lyase heavy chain"
                     /EC_number="4.3.1.7"
                     /db_xref="EnsemblGenomes-Gn:BCAL0059"
                     /db_xref="EnsemblGenomes-Tr:CAR50365"
                     /db_xref="GOA:B4EF12"
                     /db_xref="InterPro:IPR010628"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:B4EF12"
                     /protein_id="CAR50365.1"
                     /translation="MSYTETIGPRTYRFADLKTLLAKASPLRSGDQLAGVAAASEEER
                     VAAKIALAGVPLKAFLNEAVIPYEDDEVTRLIIDDHDAQAFADISHLTVGDFRNWLLS
                     PAADGAALERIAPGLTPEMVAAVSKLMRNQDLIAAARKRRVVTRFRNTVGLAGRMSVR
                     LQPNHPTDDVKGIAASMLDGLMYGCGDAMIGINPATDSLAAIVKLLAMIDGFRERYGV
                     PTQSCVLTHVTNTIAAIEKGAPVDLVFQSIAGTEKANASFGISLALLGEAREAALALK
                     RGTVGNNLMYFETGQGSALSANAHFGVDQQTCEVRAYAVARKFEPFLVNTVVGFIGPE
                     YLYDGKQIIRAGLEDHFCGKLLGVPMGCDICYTNHAEADQDDMDTLLTLLGAAGINFI
                     MGIPGADDVMLNYQSTSFHDQLYVREVLGLRRAPEFEEWLETMEIADAHGALRAATAR
                     VPLLAGANDWMGVSA"
     misc_feature    72983..74314
                     /gene="eutB"
                     /locus_tag="BCAL0059"
                     /note="HMMPfam hit to PF06751, Ethanolamine ammonia lyase
                     large subunit (Eu, score 0"
                     /inference="protein motif:HMMPfam:PF06751"
     CDS             74347..75144
                     /transl_table=11
                     /gene="eutC"
                     /locus_tag="BCAL0060"
                     /product="ethanolamine ammonia-lyase light chain"
                     /EC_number="4.3.1.7"
                     /db_xref="EnsemblGenomes-Gn:BCAL0060"
                     /db_xref="EnsemblGenomes-Tr:CAR50366"
                     /db_xref="GOA:B4EF13"
                     /db_xref="InterPro:IPR009246"
                     /db_xref="InterPro:IPR042251"
                     /db_xref="InterPro:IPR042255"
                     /db_xref="UniProtKB/TrEMBL:B4EF13"
                     /protein_id="CAR50366.1"
                     /translation="MSDAVEKNPWAQLKSFTNARIALGRAGNSLPTAPLLAFNLSHAQ
                     ARDAVHQPLDADALRREIEAAGMLPTLRVQSAAPDRDHYLRRPDLGRKLSDDSRGLLA
                     GYGAALDEAPDVAFVVGDGLSAFAAAKQALPLLQAVRPRLDADGWRIGPVVVATQARV
                     ALGDEIGELLRAKVVAMLIGERPGLSSPDSLGVYLTWAPKVGCHDALRNCISNVRPEG
                     LPHAAAAHKLHYLMTHARRLGLTGVGLKDDSDALLPAAEAERIGVTT"
     misc_feature    74353..75084
                     /gene="eutC"
                     /locus_tag="BCAL0060"
                     /note="HMMPfam hit to PF05985, Ethanolamine ammonia-lyase
                     light chain (EutC, score 7.7e-112"
                     /inference="protein motif:HMMPfam:PF05985"
     CDS             complement(75137..76021)
                     /transl_table=11
                     /locus_tag="BCAL0061"
                     /product="LysR family regulatory protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0061"
                     /db_xref="EnsemblGenomes-Tr:CAR50367"
                     /db_xref="GOA:B4EF14"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="InterPro:IPR036388"
                     /db_xref="InterPro:IPR036390"
                     /db_xref="UniProtKB/TrEMBL:B4EF14"
                     /protein_id="CAR50367.1"
                     /translation="MENLTGIVAFVRAAEALSFVAAGRALGISASAVGKTIAKLEQSL
                     GVRLFNRTTRRVTLTEEGRHFYERCQRILEDFRDAEATVTASAQRPRGKLRVSLPVIG
                     YRFLLPVLPEFRQRYPDVELDLDFNDRMVDVVEGGFDAVIRSGPLSDSSLMSRRLGPF
                     AFVLCATPAYLAQAGTPRTPRELEAHDCVRYCFPTTGKLQDWALAADDGTPLKLRTAM
                     TCNNMEALRGAVLAGLGIGYMPDFLARDALEHGALVTVLDDYRIAPGQFSIVWPSSRQ
                     LSPKLRVFVDFLCERLFR"
     misc_feature    complement(75152..75763)
                     /locus_tag="BCAL0061"
                     /note="HMMPfam hit to PF03466, LysR substrate binding
                     domain, score 1.2e-58"
                     /inference="protein motif:HMMPfam:PF03466"
     misc_feature    complement(75833..76012)
                     /locus_tag="BCAL0061"
                     /note="HMMPfam hit to PF00126, Bacterial regulatory
                     helix-turn-helix, score 9.8e-16"
                     /inference="protein motif:HMMPfam:PF00126"
     misc_feature    complement(75878..75970)
                     /note="PS00044 Bacterial regulatory proteins, lysR family
                     signature."
                     /inference="protein motif:Prosite:PS00044"
     misc_feature    complement(75908..75973)
                     /note="Predicted helix-turn-helix motif with score
                     1053.000, SD 2.77 at aa 17-38, sequence
                     LSFVAAGRALGISASAVGKTIA"
                     /inference="protein motif:helixturnhelix:EMBOSS"
     CDS             76174..77799
                     /transl_table=11
                     /locus_tag="BCAL0062"
                     /product="Major Facilitator Superfamily protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0062"
                     /db_xref="EnsemblGenomes-Tr:CAR50368"
                     /db_xref="GOA:B4EF15"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="InterPro:IPR036259"
                     /db_xref="UniProtKB/TrEMBL:B4EF15"
                     /protein_id="CAR50368.1"
                     /translation="MMDHPVSAVSALAARRRAWVLAAVCMAAVALPLSFSGGAVATPA
                     IGRDLHGSPVAMNWITNAFMLAFGSFLMASGALADQFGRKRLFAIGVGGFTLMSVALA
                     FAPSMLAVDLLRAAQGLAAAAALAGGTAALAQEFDGAARTRAFSLLGTTFGIGLAFGP
                     VLAGGLIGHYGWRAIFVTSAVAGLLSLAFGLPRMHESRDPHATGLDWPGTAAFTTALT
                     LFTFGVIEAPARGWSSPLVIALLAGAALGACTFVTIETRVARPMLDLSLFRIARFVGV
                     QVLPVSTCCCYIVLLVVLPLRFIGIDGFSEIDAGWLMLAISAPMLVVPLVAATLTRWL
                     SAGVISGLGLLVAAAGLVWLGIALRGGAGPAAIAPMLAIGVGAGMPWGLMDGLSVSVV
                     PKERAGMATGIFSTTRVAGEGIALAIVGAVLAALAQAGLAHAAGAAGAADAPDATLRA
                     AARLATGDLAGAAAALPGVGRAALIASYTHAFDRLLMGLAVVTVLCAVVVFGFLGRRP
                     AADETGDDADGRAPADASARSRIEPACAETHGR"
     sig_peptide     76174..76296
                     /locus_tag="BCAL0062"
                     /note="Signal peptide predicted for BCAL0062 by SignalP
                     2.0 HMM (Signal peptide probability 0.994) with cleavage
                     site probability 0.962 between residues 41 and 42"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    join(76228..76296,76339..76407,76432..76500,76510..76569,
                     76606..76674,76687..76746,76780..76848,76876..76935,
                     76993..77061,77104..77157,77170..77238,77281..77349,
                     77410..77478,77626..77685)
                     /locus_tag="BCAL0062"
                     /note="14 probable transmembrane helices predicted for
                     BCAL0062 by TMHMM2.0 at aa 19-41, 56-78, 87-109, 113-132,
                     145-167, 172-191, 203-225, 235-254, 274-296, 311-328,
                     333-355, 370-392, 413-435 and 485-504"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    76243..77445
                     /locus_tag="BCAL0062"
                     /note="HMMPfam hit to PF07690, Major Facilitator
                     Superfamily, score 5.9e-48"
                     /inference="protein motif:HMMPfam:PF07690"
     misc_feature    76393..76443
                     /note="PS00216 Sugar transport proteins signature 1."
                     /inference="protein motif:Prosite:PS00216"
     misc_feature    76888..76920
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
                     /inference="protein motif:Prosite:PS00013"
     CDS             complement(77942..78475)
                     /transl_table=11
                     /locus_tag="BCAL0063"
                     /product="putative FMN flavoprotein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0063"
                     /db_xref="EnsemblGenomes-Tr:CAR50369"
                     /db_xref="GOA:B4EF16"
                     /db_xref="InterPro:IPR011576"
                     /db_xref="InterPro:IPR012349"
                     /db_xref="UniProtKB/TrEMBL:B4EF16"
                     /protein_id="CAR50369.1"
                     /translation="MRAGALPVEARRRVWHVACVRITDPHATAHAPTDTMNDRGPLTD
                     DAIAFIREQAFLIVATADAAGNGDCSYRGRQPRADGSFTPLVDIPDRRTLVLPDFAGN
                     NLLNTIGNLLVNPAIALLFVDFVRQTTWLVQGRATLDEDAQARAHLWPDALRYLVIDV
                     ERAQARADAALPPLVLA"
     misc_feature    complement(78047..78352)
                     /locus_tag="BCAL0063"
                     /note="HMMPfam hit to PF01243, Pyridoxamine 5'-phosphate
                     oxidase, score 1.2e-10"
                     /inference="protein motif:HMMPfam:PF01243"
     CDS             78692..80218
                     /transl_table=11
                     /gene="acoD"
                     /locus_tag="BCAL0064"
                     /product="acetaldehyde dehydrogenase"
                     /EC_number="1.2.1.3"
                     /db_xref="EnsemblGenomes-Gn:BCAL0064"
                     /db_xref="EnsemblGenomes-Tr:CAR50370"
                     /db_xref="GOA:B4EF17"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016160"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="InterPro:IPR029510"
                     /db_xref="UniProtKB/TrEMBL:B4EF17"
                     /protein_id="CAR50370.1"
                     /translation="MNPFDLKQLGLDVEYPYRQQYDNYIGGKWVAPVKGEYFENVSPI
                     NGQPFCRIPRSGADDIELALDAAHAARRKWGKTSVAERANLLLAAADRMEKNLKLLAV
                     AETIDNGKPLRETMAADLPLAIDHFRYFAGCIRAQEGGISEIDDNTVAYHFHEPLGVV
                     GQIIPWNFPLLMAAWKLAPALAAGCCVVMKPAEQTPASVLVLMELIGDLFPAGTINIV
                     NGFGKEAGEALATSKRIAKIAFTGSTPVGKHILRAAADSLIPSTVELGGKSPNIFFAD
                     VLDQDDAFLDKALEGLAMFALNQGEVCTCPSRILIQESIYERFIEKAVARVERIKSGH
                     PLDLQTMIGAQASQQQLDKILSYIDIGRGEGAQCLTGGERAAPAADLGTGYYVKPTML
                     LGNNKMRVFQEEIFGPVASVMTFKDEQEAIELANDTFYGLGAGVWTRNGTRAYRMGRE
                     VEAGRVWTNCYHLYPAHAAFGGYKQSGIGRETHKMALSNYQQTKCLLVSYQAEALGFF
                     "
     misc_feature    78776..80179
                     /gene="acoD"
                     /locus_tag="BCAL0064"
                     /note="HMMPfam hit to PF00171, Aldehyde dehydrogenase
                     family, score 1.7e-224"
                     /inference="protein motif:HMMPfam:PF00171"
     misc_feature    78899..78922
                     /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
                     /inference="protein motif:Prosite:PS00017"
     misc_feature    79478..79501
                     /note="PS00687 Aldehyde dehydrogenases glutamic acid
                     active site."
                     /inference="protein motif:Prosite:PS00687"
     misc_feature    79577..79612
                     /note="PS00070 Aldehyde dehydrogenases cysteine active
                     site."
                     /inference="protein motif:Prosite:PS00070"
     CDS             80395..80943
                     /transl_table=11
                     /locus_tag="BCAL0065"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0065"
                     /db_xref="EnsemblGenomes-Tr:CAR50371"
                     /db_xref="GOA:B4EF18"
                     /db_xref="InterPro:IPR012349"
                     /db_xref="UniProtKB/TrEMBL:B4EF18"
                     /protein_id="CAR50371.1"
                     /translation="MAEPPRSFPRHPVFHPGELDAQHRFGVADEAERMSDAVTTRLSL
                     GVRQFVESQPFMFVGMASGAGASMTCDIVQSRRDANGDLLPVVRVIDTKTLRFALPAA
                     HGGDGGRIDAAACDGRGVGLLFVDFVRGLRYRINGRATLRADLPEADAAPWAAGSAIV
                     ELAIAHAYGNCGTRVVRLKPAR"
     CDS             81149..82165
                     /transl_table=11
                     /locus_tag="BCAL0066"
                     /product="AraC family regulatory protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0066"
                     /db_xref="EnsemblGenomes-Tr:CAR50372"
                     /db_xref="GOA:B4EF19"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR018060"
                     /db_xref="UniProtKB/TrEMBL:B4EF19"
                     /protein_id="CAR50372.1"
                     /translation="MDQHVVSTEEPTAEDTRRSAQGDDAFAGQAVVSVAHDADEQARN
                     LIGWRQTYDQLAAGRFVGTLTELPLDTMKLFRESTSHLLRQACEVRGDAYWFGIPLVC
                     DGSARVDACRIGPGALAFRPGNVEFELVTPAQFSIYGVVVRGDVLRRYAEDVERRALD
                     ERLFTQRVMQVGDARLARLCALLGRRLDGAVAMAGPLPDAQRDDLQAEVLAALFDACA
                     QPADDGSGGAPSTRRWLVDQARDYVLAHRTRPVGVPELCEQLHVSRRTLQYCFQDVLG
                     MAPATYLRTLRLNGARRDLCGRAAGSVQDVAEAWGFWHLSQFATDYRRLFGKRPSETL
                     RDRA"
     misc_feature    81860..82000
                     /locus_tag="BCAL0066"
                     /note="HMMPfam hit to PF00165, Bacterial regulatory
                     helix-turn-helix protei, score 0.00013"
                     /inference="protein motif:HMMPfam:PF00165"
     misc_feature    81899..81964
                     /note="Predicted helix-turn-helix motif with score
                     1472.000, SD 4.20 at aa 256-277, sequence
                     VGVPELCEQLHVSRRTLQYCFQ"
                     /inference="protein motif:helixturnhelix:EMBOSS"
     misc_feature    82016..82153
                     /locus_tag="BCAL0066"
                     /note="HMMPfam hit to PF00165, Bacterial regulatory
                     helix-turn-helix protei, score 0.00029"
                     /inference="protein motif:HMMPfam:PF00165"
     CDS             complement(82260..83342)
                     /transl_table=11
                     /locus_tag="BCAL0067"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0067"
                     /db_xref="EnsemblGenomes-Tr:CAR50373"
                     /db_xref="UniProtKB/TrEMBL:B4EF20"
                     /protein_id="CAR50373.1"
                     /translation="MHATPPVAALSHDDALTCPGTLLAPDGTLVAPYDLEQGDARAEG
                     HVAAAPALGLRHAASRPFRLDYGAARHVHVINGMGVTLGDSVIGMTALAALRDAHPGL
                     RFTLYRPARAPRYVDALYALAADVVAPSRALPYPAEALATETHCIDVGNHLYWPAFAR
                     LPMIDFFLDALGVDPAAVPAAAKRNRWLARLPLPALPAEWQRPYVLFCPSASTAVRSV
                     PPALRVAFVDRLAQRYGLPVVGFGPLAHPAYVDVSSDAADTARFIAWIKGASLLFAPD
                     TAALHLADGFDVPTLACFTTIGPALRVRDYPHCVPVTLDVPAALHGLHRSERPDDLAA
                     VEAAYRAIDWDALAWPAPRDVTAQAI"
     CDS             complement(83354..85057)
                     /transl_table=11
                     /gene="ilvG"
                     /locus_tag="BCAL0068"
                     /product="acetolactate synthase, large subunit"
                     /EC_number="2.2.1.6"
                     /db_xref="EnsemblGenomes-Gn:BCAL0068"
                     /db_xref="EnsemblGenomes-Tr:CAR50374"
                     /db_xref="GOA:B4EF21"
                     /db_xref="InterPro:IPR000399"
                     /db_xref="InterPro:IPR011766"
                     /db_xref="InterPro:IPR012000"
                     /db_xref="InterPro:IPR012001"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:B4EF21"
                     /protein_id="CAR50374.1"
                     /translation="MSHSKDLEPRTTTGARLLVDALLANHVERVFCVPGESFLAVLDA
                     LADDTARIQTVVCRHEAAAANMAEAVGKLTGRPGIAFVTRGPGATHASIGVHTAFQDS
                     TPMILFVGQCAREHLDREAFQEIDYRRMFGQMAKWVAQIDDPRRIPEYLSHAFHVATS
                     GRPGPVVLALPEDVLSDACAPQPVAPAAKRIAAAPSAAQLDELRERLARAERPFAIVG
                     GSGWTPDACANLRTFVERWQLPVACAFRFQDTIDNAHPNYAGDVGLGINPALAKRIRD
                     ADLLLVIGPRLGEATTGGYTLLDIPKTRQTLIHVHQGADELGRVYAADLPIVSGMPEI
                     AAPLAALEPPERPAWAGAAADAHRAYREWHAPLPMPGDVQLGDVMVQLRERLPHDAIL
                     TNGAGNYAIWLHRHFAYRHYRSQLAPTSGAMGYGLPAALAAKSLYPQRAVVALAGDGC
                     FMMAGNELATAMQYGLNIVAIVVNNGHFGTIRMHQERNYPGRVHGTGLTNPDFAAYAR
                     AFGAHGETVERTADFAPALERALTCGLPAVIEIRIPQDASTPAATLEQIREQGRRARG
                     A"
     misc_feature    complement(83435..83875)
                     /gene="ilvG"
                     /locus_tag="BCAL0068"
                     /note="HMMPfam hit to PF02775, Thiamine pyrophosphate
                     enzyme, C-termina, score 7.2e-55"
                     /inference="protein motif:HMMPfam:PF02775"
     misc_feature    complement(83708..83767)
                     /note="PS00187 Thiamine pyrophosphate enzymes signature."
                     /inference="protein motif:Prosite:PS00187"
     misc_feature    complement(83984..84463)
                     /gene="ilvG"
                     /locus_tag="BCAL0068"
                     /note="HMMPfam hit to PF00205, Thiamine pyrophosphate
                     enzyme, central d, score 4.3e-07"
                     /inference="protein motif:HMMPfam:PF00205"
     misc_feature    complement(84509..85024)
                     /gene="ilvG"
                     /locus_tag="BCAL0068"
                     /note="HMMPfam hit to PF02776, Thiamine pyrophosphate
                     enzyme, N-termina, score 3.3e-49"
                     /inference="protein motif:HMMPfam:PF02776"
     CDS             85336..85797
                     /transl_table=11
                     /locus_tag="BCAL0069"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0069"
                     /db_xref="EnsemblGenomes-Tr:CAR50375"
                     /db_xref="UniProtKB/TrEMBL:B4EF22"
                     /protein_id="CAR50375.1"
                     /translation="MTTETIDQKTLTELVEAGAVRAARVVGCGNGWALSARCGAHERF
                     LSAKRGDVRVFRRFETLVGFLRDIGISRFDVDASAFDPDAAGRATRPDRAVALKAAHE
                     AAAHDRWFREQVQQALDDPRASIPDAEVSADFASRRAALRDRLAGRRGDVS"
     CDS             85794..86078
                     /transl_table=11
                     /locus_tag="BCAL0070"
                     /product="plasmid stabilisation system protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0070"
                     /db_xref="EnsemblGenomes-Tr:CAR50376"
                     /db_xref="InterPro:IPR007712"
                     /db_xref="InterPro:IPR035093"
                     /db_xref="UniProtKB/TrEMBL:B4EF23"
                     /protein_id="CAR50376.1"
                     /translation="MTLALHWNPKALEDRAAIMDYIAEDDPLAAVELDERLEERAVAL
                     PAHAELYRQGRVAGTRELVIAPNYVLVYRIRPADGIVEILRVLHARRQWP"
     misc_feature    85806..86072
                     /locus_tag="BCAL0070"
                     /note="HMMPfam hit to PF05016, Plasmid stabilisation
                     system protein, score 1.3e-21"
                     /inference="protein motif:HMMPfam:PF05016"
     CDS             complement(86236..87624)
                     /transl_table=11
                     /gene="sdaA"
                     /locus_tag="BCAL0071"
                     /product="L-serine dehydratase I"
                     /EC_number="4.3.1.17"
                     /db_xref="EnsemblGenomes-Gn:BCAL0071"
                     /db_xref="EnsemblGenomes-Tr:CAR50377"
                     /db_xref="GOA:B4EF24"
                     /db_xref="InterPro:IPR004644"
                     /db_xref="InterPro:IPR005130"
                     /db_xref="InterPro:IPR005131"
                     /db_xref="InterPro:IPR029009"
                     /db_xref="UniProtKB/TrEMBL:B4EF24"
                     /protein_id="CAR50377.1"
                     /translation="MAVSVFDLFKIGIGPSSSHTVGPMRAALMFVQGLERDGLLDATA
                     HVKVELYGSLGATGKGHGTDRGVMLGLLGDAPDTVDPDTIDARLEDVRKTKQLALLGT
                     HPVPFVLKDNIAFYRQALPEHPNGMKLRASDANGAVLVERTYLSVGGGFVVTAGAPNT
                     KVLSAAEQMTHPFRTGAELLALTASTGKSIAQLMWENERAWHTEEETRDGLLKIWAVM
                     QSCVSRGCGIGNPDADGNLPGPFQVKRRAPQLYRTLTGSPERALQDPLSMIDWINLYA
                     IAVNEENAAGGRVVTAPTNGAAGIIPAVLHYYTRFTPGANEQGVIDFLLTAAAIGILY
                     KLNASISGAEVGCQGEVGVACSMAAGALAAVLGGTPQQVENAAEIGMEHNLGLTCDPV
                     GGMVQIPCIERNAMASVKAVNAARMALRGDGSHYVSLDSVIKTMRETGADMKTKYKET
                     SRGGLAVNIVEC"
     misc_feature    complement(86251..87105)
                     /gene="sdaA"
                     /locus_tag="BCAL0071"
                     /note="HMMPfam hit to PF03313, Serine dehydratase alpha
                     chain, score 5.4e-170"
                     /inference="protein motif:HMMPfam:PF03313"
     misc_feature    complement(87154..87615)
                     /gene="sdaA"
                     /locus_tag="BCAL0071"
                     /note="HMMPfam hit to PF03315, Serine dehydratase beta
                     chain, score 4.9e-71"
                     /inference="protein motif:HMMPfam:PF03315"
     CDS             complement(87655..88797)
                     /transl_table=11
                     /locus_tag="BCAL0072"
                     /product="putative membrane protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0072"
                     /db_xref="EnsemblGenomes-Tr:CAR50378"
                     /db_xref="GOA:B4EF25"
                     /db_xref="InterPro:IPR008397"
                     /db_xref="InterPro:IPR008929"
                     /db_xref="UniProtKB/TrEMBL:B4EF25"
                     /protein_id="CAR50378.1"
                     /translation="MVRPMFPGHGATERRPRIRAGRYVPMLVASLSLAAAGLGVAGSA
                     RAAMNFCAAPALQTSETTQAEPGVQALIRSVDARIGEQPKAMARVHTEGTLPHEGIYD
                     QSAAALRDMDLMRDAALAWRVTNAPRYLQLVDRFLSAWVSTYQPSFNPIDETRFESLI
                     VAYDMTASALPVKTRNATAAFIAKLGAGYVAQVDAQKRPLTGTWRNNWQSHRIKLIAL
                     SAFTLGDRKMMNAAQRLFVEHLADNIGPDGKTWDFEERDALHYAVYDLQPLVTAALAA
                     RRFNRNWLRERGANGATLAAALDWLVPYALGEKTHEEFVNSPVPFDAKRREAGLPGYT
                     GQWDPKNATELFHLAARLDGRYARVAQQLSPTPPAWLAACLPLQAR"
     misc_feature    complement(87676..87708)
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
                     /inference="protein motif:Prosite:PS00013"
     sig_peptide     complement(88660..88797)
                     /locus_tag="BCAL0072"
                     /note="Signal peptide predicted for BCAL0072 by SignalP
                     2.0 HMM (Signal peptide probability 0.934) with cleavage
                     site probability 0.711 between residues 46 and 47"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    complement(88672..88740)
                     /locus_tag="BCAL0072"
                     /note="1 probable transmembrane helix predicted for
                     BCAL0072 by TMHMM2.0 at aa 20-42"
                     /inference="protein motif:TMHMM:2.0"
     CDS             complement(88949..91876)
                     /transl_table=11
                     /gene="gcvP"
                     /locus_tag="BCAL0073"
                     /product="glycine dehydrogenase [decarboxylating]"
                     /EC_number="1.4.4.2"
                     /db_xref="EnsemblGenomes-Gn:BCAL0073"
                     /db_xref="EnsemblGenomes-Tr:CAR50379"
                     /db_xref="GOA:B4EF26"
                     /db_xref="InterPro:IPR003437"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="InterPro:IPR020581"
                     /db_xref="UniProtKB/Swiss-Prot:B4EF26"
                     /protein_id="CAR50379.1"
                     /translation="MKLEHPDRLMNRTPLSLAALETHDAFAERHIGPDAASQQAMLDT
                     LGFASRAALIDAVIPASIRRAETLPLGPFAQPKSEAEALAALRALADKNQVFRSYIGQ
                     GYHDTHTPAVILRNVLENPAWYTAYTPYQPEISQGRLEALLNFQQMVADLTGLAISNA
                     SLLDEATAAAEAMTLLQRTGKPKSNVFYVADDVLPQTLEVIRTRALPIGIEVKTGPAA
                     DAAQANAFGVLLQYPGVNGDVRDYRALTEAIHAAGGHVVVAADLLALTVLTPPGEWGA
                     DVAVGNTQRFGVPMGFGGPHAAYMAVRDEFKRQMPGRLVGVTVDAQGKPALRLALQTR
                     EQHIRREKATSNVCTAQALLAIMASMYAVYHGPHGLKTIALRVNRIAALFAAGVKQLG
                     FATVNDTFFDTLTIDTGARTAQVHEFAKAKRINLRRVSATQVGVSVDETTTRDDLADL
                     LDVFAQAAGGTAPAVDALDAGLAGVAALPAGLERTSAYLTHHVFNRHHSETEMLRYLR
                     SLSDKDLALDRSMIPLGSCTMKLNATSEMLPVTWPEFGRIHPFAPAEQTVGYREMIDQ
                     LEQMLVAATGYAAVSLQPNAGSQGEYAGLLIIHAYHASRGEGHRDVCLIPASAHGTNP
                     ASAHMAGMKVVVVACDAQGNVDIADLKAKAEQHSKDLAAIMITYPSTHGVFEQNVREI
                     CEIVHAHGGQVYVDGANMNAMVGLTAPGQFGGDVSHLNLHKTFCIPHGGGGPGVGPVA
                     VGAHLAKFLPNQRSTGYARTEDGIGAVSAAPYGSASILPISWMYIAMMGAKNLTAATE
                     TAILNANYIAKRLAPHYPVLYSGPGGLVAHECILDLRPIKETSGISVDDVAKRLMDYG
                     FHAPTMSFPVPGTLMVEPTESESQEELDRFIAAMIAIREEIRAVEEGRADREDNPLRH
                     APHTAAVVTANEWPHAYSREQAAYPVASLGTNKYWPPVGRADNAYGDRNLFCSCVPMS
                     DYA"
     misc_feature    complement(89366..90211)
                     /gene="gcvP"
                     /locus_tag="BCAL0073"
                     /note="HMMPfam hit to PF01212, Beta-eliminating lyase,
                     score 0.0039"
                     /inference="protein motif:HMMPfam:PF01212"
     misc_feature    complement(90515..91795)
                     /gene="gcvP"
                     /locus_tag="BCAL0073"
                     /note="HMMPfam hit to PF02347, Glycine cleavage system
                     P-protein, score 1.9e-247"
                     /inference="protein motif:HMMPfam:PF02347"
     CDS             complement(91935..92315)
                     /transl_table=11
                     /gene="gcvH"
                     /locus_tag="BCAL0074"
                     /product="glycine cleavage system H protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0074"
                     /db_xref="EnsemblGenomes-Tr:CAR50380"
                     /db_xref="GOA:B4EF27"
                     /db_xref="InterPro:IPR000089"
                     /db_xref="InterPro:IPR002930"
                     /db_xref="InterPro:IPR003016"
                     /db_xref="InterPro:IPR011053"
                     /db_xref="InterPro:IPR017453"
                     /db_xref="InterPro:IPR033753"
                     /db_xref="UniProtKB/Swiss-Prot:B4EF27"
                     /protein_id="CAR50380.1"
                     /translation="MSNVPAELKYTDEHEWIRTEADGTLTVGITDHAQSTLGDIVFLE
                     LPEVGKSVNAGDAVGVVESVKAASDIYSPVSGEIVAINEAATDAPEEVNGDAYGVWLF
                     KIKLAAGASTDKLIDADAYSKLID"
     misc_feature    complement(91938..92294)
                     /gene="gcvH"
                     /locus_tag="BCAL0074"
                     /note="HMMPfam hit to PF01597, Glycine cleavage H-protein,
                     score 8.5e-54"
                     /inference="protein motif:HMMPfam:PF01597"
     misc_feature    complement(92082..92171)
                     /note="PS00189 2-oxo acid dehydrogenases acyltransferase
                     component lipoyl binding site."
                     /inference="protein motif:Prosite:PS00189"
     CDS             complement(92442..93560)
                     /transl_table=11
                     /gene="gcvT"
                     /locus_tag="BCAL0075"
                     /product="aminomethyltransferase"
                     /EC_number="2.1.2.10"
                     /db_xref="EnsemblGenomes-Gn:BCAL0075"
                     /db_xref="EnsemblGenomes-Tr:CAR50381"
                     /db_xref="GOA:B4EF28"
                     /db_xref="InterPro:IPR006222"
                     /db_xref="InterPro:IPR006223"
                     /db_xref="InterPro:IPR013977"
                     /db_xref="InterPro:IPR022903"
                     /db_xref="InterPro:IPR027266"
                     /db_xref="InterPro:IPR028896"
                     /db_xref="InterPro:IPR029043"
                     /db_xref="UniProtKB/Swiss-Prot:B4EF28"
                     /protein_id="CAR50381.1"
                     /translation="MTALNHTPLNAAHRALNARMVDFGGWDMPVNYGSQIEEHAAVRT
                     DAGMFDVSHMCVVDFTGSRVRAFFEHAIANNVGKLKTPGKALYSCLLNPQGGVIDDLI
                     VYYFTEEFFRVVVNAGTADKDIAWFNQLNEQGGYGLTIAPRRDFAIVAVQGPNAREKV
                     WATVPSARAATSELKPFNAAQVAGTPFGDLTIARTGYTGEDGFEVIVPAVHVEVLWNA
                     LQQHGVRPCGLGARDTLRLEAGMNLYGQDMDDTVSPLDAGLAWTVDLAAPRDFVGRAA
                     LEANGTRAAFVGLILQKENGKAGGVLRAHQKVVTPHGEGEITSGTFSPSMQESIAFAR
                     VPAAVQIGDTVQVQIRDKNLPARVVKLPFVRNGKVLAA"
     misc_feature    complement(92463..93419)
                     /gene="gcvT"
                     /locus_tag="BCAL0075"
                     /note="HMMPfam hit to PF01571, Glycine cleavage T-protein
                     (aminomethyl tran, score 3.3e-109"
                     /inference="protein motif:HMMPfam:PF01571"
     misc_RNA        complement(93644..93777)
                     /locus_tag="BCALr0075A"
                     /note="gcvT element (RF00504) as predicted by Rfam,
                     score=48.63"
     misc_RNA        complement(93811..93914)
                     /locus_tag="BCALr0075B"
                     /note="gcvT element (RF00504) as predicted by Rfam,
                     score=45.20"
     CDS             complement(94028..94390)
                     /transl_table=11
                     /locus_tag="BCAL0076"
                     /product="putative lipoprotein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0076"
                     /db_xref="EnsemblGenomes-Tr:CAR50382"
                     /db_xref="UniProtKB/TrEMBL:B4EF29"
                     /protein_id="CAR50382.1"
                     /translation="MQRLIRAAACCVLVSSLAACIVQPQRPARQAPPPRPNPQVVAND
                     RMQEVQGRIDNLHRRIDARVNGGYYPPPYGAQLHHRLDVIRQEANDMSAQHNGGLSGD
                     EQRVLNQELDTAARAIGE"
     misc_feature    complement(94331..94363)
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
                     /inference="protein motif:Prosite:PS00013"
     sig_peptide     complement(94334..94390)
                     /locus_tag="BCAL0076"
                     /note="Signal peptide predicted for BCAL0076 by SignalP
                     2.0 HMM (Signal peptide probability 0.991) with cleavage
                     site probability 0.327 between residues 19 and 20"
                     /inference="protein motif:SignalP:2.0"
     CDS             complement(94594..95646)
                     /transl_table=11
                     /locus_tag="BCAL0077"
                     /product="putative oxidoreductase"
                     /db_xref="EnsemblGenomes-Gn:BCAL0077"
                     /db_xref="EnsemblGenomes-Tr:CAR50383"
                     /db_xref="GOA:B4EF30"
                     /db_xref="InterPro:IPR000683"
                     /db_xref="InterPro:IPR004104"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="UniProtKB/TrEMBL:B4EF30"
                     /protein_id="CAR50383.1"
                     /translation="MSSLLRIGLMGFGFAGATFHAPVIATSGRTEVAAIATGQGERAQ
                     AAYPGARIVPDLDTLLGLDDIECVVIATPNDTHFALARQVLEAGRHVVVDKPVTLTAD
                     EALALARLANARSRLFAPFHNRRWDGDFLTVRRIVESGELGRLTYFASHFDRFRPTPR
                     TRWREEPARGGGLLLDLGPHLIDQALALFGTPETVSATVKTRRDHGTAPDFVHLLLGY
                     PDKDVALHASALSAIEPARFTLHGTRGSYQKFGLDTQEDQLKAGLTADDVEFGGGNPP
                     GLLRVLDGDVEVERPVPTLDGQYAEFYRALAASIRDGAPFPVTAQDAVDVMTIIELAA
                     QSEHDGRRVPFVRRPV"
     misc_feature    complement(94924..95247)
                     /locus_tag="BCAL0077"
                     /note="HMMPfam hit to PF02894, Oxidoreductase family,
                     C-terminal alph, score 6.2e-17"
                     /inference="protein motif:HMMPfam:PF02894"
     misc_feature    complement(95281..95634)
                     /locus_tag="BCAL0077"
                     /note="HMMPfam hit to PF01408, Oxidoreductase family,
                     NAD-binding Ros, score 1.9e-30"
                     /inference="protein motif:HMMPfam:PF01408"
     sig_peptide     complement(95572..95646)
                     /locus_tag="BCAL0077"
                     /note="Signal peptide predicted for BCAL0077 by SignalP
                     2.0 HMM (Signal peptide probability 0.942) with cleavage
                     site probability 0.801 between residues 25 and 26"
                     /inference="protein motif:SignalP:2.0"
     CDS             complement(95948..96655)
                     /transl_table=11
                     /locus_tag="BCAL0078"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0078"
                     /db_xref="EnsemblGenomes-Tr:CAR50384"
                     /db_xref="InterPro:IPR013830"
                     /db_xref="InterPro:IPR036514"
                     /db_xref="UniProtKB/TrEMBL:B4EF31"
                     /protein_id="CAR50384.1"
                     /translation="MGYPFATAALGPLLFAQGRYVRRVTPRLPEAAGPRDGSVGDGPP
                     LRVLVVGDSAAAGVGVATQHDALAGQLASALAATHRVRWKLLARTGLTTRELVDWLAA
                     EPAEPFDVAVTSLGVNDVTGGVPPARWLAQQTELVRLLAARFQVGHAILSAVPPMERF
                     PALPQPLAWYLGRRAKRLNTALAGWAGAQPHCTFLRVDLPLERHLMAADGFHPGAAAC
                     AVWAAQVAAAVRQRMDG"
     CDS             96966..99053
                     /transl_table=11
                     /gene="rep"
                     /locus_tag="BCAL0079"
                     /product="ATP-dependent DNA helicase Rep"
                     /EC_number="3.6.1.-"
                     /db_xref="EnsemblGenomes-Gn:BCAL0079"
                     /db_xref="EnsemblGenomes-Tr:CAR50385"
                     /db_xref="GOA:B4EF32"
                     /db_xref="InterPro:IPR000212"
                     /db_xref="InterPro:IPR005752"
                     /db_xref="InterPro:IPR013986"
                     /db_xref="InterPro:IPR014016"
                     /db_xref="InterPro:IPR014017"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR034739"
                     /db_xref="UniProtKB/TrEMBL:B4EF32"
                     /protein_id="CAR50385.1"
                     /translation="MSAGLNPAQNEAVRYLDGPCLVLAGAGSGKTRVITQKIAHLIEA
                     KGFEPRHIAAVTFTNKAAAEMRERVSKLLEGKTLTTPGKEGRKVPVNQLTVCTFHSLG
                     VQILRQEAEHVGLKPQFSIMDSDDCFGMIQEQLGTTDKGLIRKIQSIISLWKNGLIMP
                     DEAMAIAANEDEHQAALVYRNYVATLHAYQAVDFDDLIRLPAELFAKNEQVRDRWQNK
                     LRYLLIDEYQDTNACQYELLKQLAGPRAAFTAVGDDDQAIYGWRGATLENLAQLGKDF
                     PKLHVIKLEQNYRSTVRILTAANNVIANNPKLFEKKLWSEHGMGDSITVTACNDEEHE
                     AESVVFRLSAYKFERRAQFRDYAILYRGNFQARIFEQVLRRERIPYVLSGGQSFFDKA
                     EIKDLCAYLRLIANADDDPAFIRAVTTPRRGIGNTTLEALGSFAGQAKVSLFEAVYMG
                     GIEARLSARQVEPLRMFCDFIQRLTERADKEPATVVLDDMMEAIHYEAYLYDAFDERQ
                     AQSKWQNVLEFLEWLKRKGTKPETEAVDGEADGFHNADGLADTGKNLLGLIQTVALMS
                     MLEGKDEDPDAVRLSTVHASKGLEYPHVFLVGVEEGIMPHRGGSEDDGPIDNERIEEE
                     RRLMYVAITRAQRSLHLNWCKKRKRARETVVCEPSRFIPEMGLDEAPPPTPEEAPMSP
                     KDRLASLKALLQK"
     misc_feature    96978..98453
                     /gene="rep"
                     /locus_tag="BCAL0079"
                     /note="HMMPfam hit to PF00580, UvrD/REP helicase, score
                     2.2e-185"
                     /inference="protein motif:HMMPfam:PF00580"
     misc_feature    97035..97058
                     /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
                     /inference="protein motif:Prosite:PS00017"
     CDS             complement(99160..100047)
                     /transl_table=11
                     /locus_tag="BCAL0080"
                     /product="putative cytochrome"
                     /db_xref="EnsemblGenomes-Gn:BCAL0080"
                     /db_xref="EnsemblGenomes-Tr:CAR50386"
                     /db_xref="GOA:B4EF33"
                     /db_xref="InterPro:IPR002323"
                     /db_xref="InterPro:IPR009056"
                     /db_xref="InterPro:IPR036909"
                     /db_xref="UniProtKB/TrEMBL:B4EF33"
                     /protein_id="CAR50386.1"
                     /translation="MSEAPHESPVKTPGQLIAVIIASFAIPIILIVLFANYANHAFRS
                     GAGTDALSDEQVAARIAPIAKVDVKDANAPRTYKTGEEVYKAVCVTCHGTGAAGAPKF
                     GNKDDWAPRISQGFDTLLKTALAGKGAMPARGGTSPDDVSDYEIARAIVYMANNDGAN
                     FPEPAAPAANAAQPASGAPASGADASNAQAAAAMAAIAAIPKAGEKPAAAPAGADAAT
                     AGKALYASTCQACHAAGVLGAPKFGSKEDWAPRLKDSMDTVYNYALHGKGAMPPKGGS
                     NASDADVKAAVDYMVNAAK"
     misc_feature    complement(99166..99399)
                     /locus_tag="BCAL0080"
                     /note="HMMPfam hit to PF00034, Cytochrome c, score 0.0011"
                     /inference="protein motif:HMMPfam:PF00034"
     misc_feature    complement(99349..99366)
                     /note="PS00190 Cytochrome c family heme-binding site
                     signature."
                     /inference="protein motif:Prosite:PS00190"
     misc_feature    complement(99577..99819)
                     /locus_tag="BCAL0080"
                     /note="HMMPfam hit to PF00034, Cytochrome c, score
                     0.00049"
                     /inference="protein motif:HMMPfam:PF00034"
     misc_feature    complement(99769..99786)
                     /note="PS00190 Cytochrome c family heme-binding site
                     signature."
                     /inference="protein motif:Prosite:PS00190"
     misc_feature    complement(99937..100005)
                     /locus_tag="BCAL0080"
                     /note="1 probable transmembrane helix predicted for
                     BCAL0080 by TMHMM2.0 at aa 15-37"
                     /inference="protein motif:TMHMM:2.0"
     tRNA            100299..100374
                     /gene="BCALr0080"
                     /note="tRNA Arg anticodon CCG, Cove score 82.41"
     repeat_region   100330..100360
                     /note="Perfect repeat flanking prophage"
     misc_feature    100361..125265
                     /note="BcenGI1"
     CDS             complement(100429..101505)
                     /transl_table=11
                     /locus_tag="BCAL0081"
                     /product="prophage integrase"
                     /db_xref="EnsemblGenomes-Gn:BCAL0081"
                     /db_xref="EnsemblGenomes-Tr:CAR50387"
                     /db_xref="GOA:B4EF47"
                     /db_xref="InterPro:IPR002104"
                     /db_xref="InterPro:IPR010998"
                     /db_xref="InterPro:IPR011010"
                     /db_xref="InterPro:IPR013762"
                     /db_xref="UniProtKB/TrEMBL:B4EF47"
                     /protein_id="CAR50387.1"
                     /translation="MSLYKRKTSPNWQYKLYPPGGGTPVQGSTGTRDKAQAQEFHDRL
                     KVDLWNQARLGTQPRHSWNDAVVRYVGERAGLASLETSKIHLRWLDRHLSGVALADID
                     RSRIDAIALAKRREPRTVRTRHGVVATDRPVSDATVRRVIGVLKAVLNAAVEWEWLAR
                     APVTKRAKVVSKRIRWLTPAEAERLLAELPAHLADMARFSLETGLRRANVTGLQWSQV
                     DLARRVAWIHPDQAKARKAITVPLSDTAIAVLQRQRANPRAPACADSVFVYRGKPVYQ
                     TATAAWAKALRRAGLHDFRWHDLRHTWASWHVQRGTPLQVLKELGGWETMEMVQRYAH
                     LSAAHLAQWVAPLTAEPAPIPAAI"
     misc_feature    complement(100480..101001)
                     /locus_tag="BCAL0081"
                     /note="HMMPfam hit to PF00589, Phage integrase family,
                     score 1.5e-34"
                     /inference="protein motif:HMMPfam:PF00589"
     CDS             complement(101373..101693)
                     /transl_table=11
                     /locus_tag="BCAL0082"
                     /product="hypothetical phage protein"
                     /note="CDS is possibly extended at the C-terminus, lacking
                     an appropriate translational stop"
                     /db_xref="EnsemblGenomes-Gn:BCAL0082"
                     /db_xref="EnsemblGenomes-Tr:CAR50388"
                     /db_xref="UniProtKB/TrEMBL:B4EF48"
                     /protein_id="CAR50388.1"
                     /translation="MSGAAALLGAHPETVRLKARAGMLPGRKVGKRWIFSIMALQRYL
                     AGDWLPRAAQADQHEETHPCRSTNEKPARTGNTSCTPLAAERRYREALAPATKRRPRN
                     STTG"
     CDS             complement(102200..104992)
                     /transl_table=11
                     /locus_tag="BCAL0083"
                     /product="hypothetical phage protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0083"
                     /db_xref="EnsemblGenomes-Tr:CAR50389"
                     /db_xref="GOA:B4EF49"
                     /db_xref="InterPro:IPR006171"
                     /db_xref="InterPro:IPR034154"
                     /db_xref="InterPro:IPR036977"
                     /db_xref="UniProtKB/TrEMBL:B4EF49"
                     /protein_id="CAR50389.1"
                     /translation="MASIDELKRHIDLHDLASRLGLKRGRGGDRALYHSPQHADRSPS
                     LSIYANHPKYGTGWRDHSADAGGSCIDLVIHARGGTVADAVRYLHDAYGLPSERPAPL
                     ERREKSTVEYIADRCVAERERVRDYLGGRGIAAAAIDAALAARTLGFNTWTSPKVAAG
                     EVGHGGPAAAFVVRAPGDARVVAVDMRYVDPALNGGVKTQTQGDKAGYAWTADARRLE
                     RAKRVVIVESAINALSIDTCALPGTAALALRGLANVERIDFAFLRGKQVTICLDNDEP
                     FADGHPRAGQRPGPEAAWALYERLTALDISAVLVDQSDWFADLADGDTARKPINDVND
                     YLQLRGPADLARALDQLEPWLVAGLPGDASRRGRPRLFLPPHDFAQYWRFRVRPDFTS
                     YITRMDRNEESGVDTPVMTDLCGFRIAGISRVAVASATSTMTGDADQAPTVYFAVSVQ
                     APRHGAQLIRRVMLDDQLHNVDQWGKFGPIWAPAPFKRMVNILERGADLGARRAANFV
                     GLAWRDGRLIVNEGPDCYFTEADKQCPYHNLTFPGGPVSDARRVIAAYQTTFRQNAAT
                     IPLVWALGGHLKALLGFWPHLTIQANKGAGKSTLIKRLERSLAFTMFSGQSLQTEFRL
                     LTSISHTSHPVGWEELSARRQDVIDKAVGLLQENYQYTVTRRGTDMTEYLLCAPVMLA
                     GEDVPVRSLLGKVVRTTLTGKRGPLLPDDLPRFPVRQWLEFLTGLDRRTALDQYATLR
                     DQALAGCRASGEDDGARRMAANYAALGLAWRYLCEFAGMDPGEGEFPRDLLAEMNGHV
                     AETSADREPWVWIMETVLSEIDGGNYKHPYTFDTVDGEFCLLLRTGHVMDHLAHTSAL
                     RDKWNGLPVKSDRVFKAQLKHAGVVVGEKEVERRIYMRRVPYLTPVSLERLATFGLHV
                     SVREDLATDALHGGRA"
     misc_feature    complement(103199..103222)
                     /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
                     /inference="protein motif:Prosite:PS00017"
     CDS             complement(104998..105255)
                     /transl_table=11
                     /locus_tag="BCAL0083a"
                     /product="hypothetical phage protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0083a"
                     /db_xref="EnsemblGenomes-Tr:CAR50390"
                     /db_xref="UniProtKB/TrEMBL:B4EF60"
                     /protein_id="CAR50390.1"
                     /translation="MNRYAEPAPHDVALRAAIAAAADTLRGDPASGSAARQPALGPFV
                     SALADRLALGFPQSAAALHALVAPPACAGDPARHAQPEPQQ"
     CDS             complement(105383..105631)
                     /transl_table=11
                     /locus_tag="BCAL0084"
                     /product="putative phage transcriptional activator
                     protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0084"
                     /db_xref="EnsemblGenomes-Tr:CAR50391"
                     /db_xref="InterPro:IPR007684"
                     /db_xref="UniProtKB/TrEMBL:B4EF61"
                     /protein_id="CAR50391.1"
                     /translation="MRILNRCPHCRTRATARSSREMSLTFREITFQCSNPECGHTYVV
                     NMEFARTLSPSAIPNLSLQLPLSPHVRERLAAQLELPV"
     misc_feature    complement(105476..105616)
                     /locus_tag="BCAL0084"
                     /note="HMMPfam hit to PF04606, Ogr/Delta-like zinc finger,
                     score 6.2e-22"
                     /inference="protein motif:HMMPfam:PF04606"
     CDS             complement(105619..105798)
                     /transl_table=11
                     /locus_tag="BCAL0084a"
                     /product="hypothetical phage protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0084a"
                     /db_xref="EnsemblGenomes-Tr:CAR50392"
                     /db_xref="UniProtKB/TrEMBL:B4EF62"
                     /protein_id="CAR50392.1"
                     /translation="MSAAFERTRPSGPAASIVSRVCARNHSPIGQGCTLATGATRDWP
                     GHRQSFVRSEPSCAS"
     CDS             complement(105813..106028)
                     /transl_table=11
                     /locus_tag="BCAL0085"
                     /product="hypothetical phage protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0085"
                     /db_xref="EnsemblGenomes-Tr:CAR50393"
                     /db_xref="UniProtKB/TrEMBL:B4EF63"
                     /protein_id="CAR50393.1"
                     /translation="MTTPKGPRRSPRGTMSDKPVYVGLTPVERGELEQLAAQRNRSIS
                     SMARELIRLGASHLRAIAAPRSRSARP"
     CDS             106119..106610
                     /transl_table=11
                     /locus_tag="BCAL0086"
                     /product="hypothetical phage protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0086"
                     /db_xref="EnsemblGenomes-Tr:CAR50394"
                     /db_xref="GOA:B4EF64"
                     /db_xref="InterPro:IPR001387"
                     /db_xref="InterPro:IPR010982"
                     /db_xref="UniProtKB/TrEMBL:B4EF64"
                     /protein_id="CAR50394.1"
                     /translation="MTQIGSRLRDERLRIGLSQDEFATVGGVARRSQSAYESDERAPD
                     AAYLLAVREIGVDIGYVLTGKRFAAGEAAPEAGARDADEAEVLAMYRQLNDTGKASLH
                     AFLASCISTGAMVQTATPRRAKRVPEKRRAALDQRTAENVDRAMAEIERLKAERAAKQ
                     PKK"
     misc_feature    106806..106809
                     /note="IBS2?"
     misc_feature    106813..106818
                     /note="IBS1?"
     intron          106819..108733
                     /note="putative Group II intron - Bacterial Class E"
     misc_feature    106976..106979
                     /note="Group II intron - EBS2"
     misc_feature    107002..107007
                     /note="Group II intron - EBS1?"
     CDS             107182..108714
                     /transl_table=11
                     /locus_tag="BCAL0087"
                     /product="putative reverse transcriptase-group II intron"
                     /db_xref="EnsemblGenomes-Gn:BCAL0087"
                     /db_xref="EnsemblGenomes-Tr:CAR50395"
                     /db_xref="GOA:B4EF50"
                     /db_xref="InterPro:IPR000477"
                     /db_xref="InterPro:IPR030931"
                     /db_xref="UniProtKB/TrEMBL:B4EF50"
                     /protein_id="CAR50395.1"
                     /translation="MTNGWEKSDSPIVAKKLANKPGQPDAESVERRGGAKGNTEWSRT
                     RRTQSRISVSQRLDRVRQAARQRKKEKFTALYHLIDLDLLATAFFWLKRKAAAGVDGV
                     TWHDYEQDLDRNLEDLHGRLRRQAYRALPSRRRYIPKADGKQRPLGIAALEDKIVQRA
                     LVAVLNAVYEMDFLGFSYGFRPQRSQHDALDALATGIARTSVSWILDADISRFFDTVD
                     HDWLIRFVEHRIGDQRVIRLIRKWLKAGAMEDGVIEPTDEGTPQGSVISPLLANIYLH
                     YVFDLWANQWRKRHAEGNVVIVRYADDVVVGFDKPHDAKRFRRAMQQRLEQFGLSVHP
                     EKTRLIEFGRFAARNRASRGLGKPETFNFLGFTHISGRAKDGRFMLMRKTRSDRLRTA
                     LKGIKDELRHRWHQSIPEQGDWLRRVVQGYFNYHAVPTNFAALRAFRARVIDLWRLAL
                     RRRSQKDDTTWAKMHRLAKQWIPKARILHPWPVVRFDANHPRQEPGARIAHAGICAGG
                     AQ"
     misc_feature    107563..108285
                     /locus_tag="BCAL0087"
                     /note="HMMPfam hit to PF00078, Reverse transcriptase
                     (RNA-dependent DNA pol, score 1.5e-62"
                     /inference="protein motif:HMMPfam:PF00078"
     misc_RNA        108659..108733
                     /locus_tag="BCALr0087"
                     /note="Group II catalytic intron (RF00029) as predicted by
                     Rfam, score 37.78"
     CDS             108758..109138
                     /transl_table=11
                     /locus_tag="BCAL0088"
                     /product="hypothetical phage protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0088"
                     /db_xref="EnsemblGenomes-Tr:CAR50396"
                     /db_xref="UniProtKB/TrEMBL:B4EF51"
                     /protein_id="CAR50396.1"
                     /translation="MSWRRGVPRRPVVSGGPRLMTEFAETGKMDTNRKHDNGTIGASA
                     HADHRADARGATMGPPRYRSDLTDDERADAHAAIDNAMLSVGQVLEAALQAMANLRDA
                     RATLQQCGDARDLRMTLGGRQQSS"
     CDS             complement(109326..110396)
                     /transl_table=11
                     /locus_tag="BCAL0089"
                     /product="phage late control gene D protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0089"
                     /db_xref="EnsemblGenomes-Tr:CAR50397"
                     /db_xref="InterPro:IPR040471"
                     /db_xref="UniProtKB/TrEMBL:B4EF52"
                     /protein_id="CAR50397.1"
                     /translation="MSTQERTPADAPARAGRVQPQADYRITLDGRDLSRLIAPNLISL
                     SLSESRADEADMLDLVLDDAQGTFAIPKRGASIKLSIGWVGEPLVDKGTFTVDEVEHS
                     GAPDVITIRARSASMTNDMHERREKSWHRQTIGAIVRTIAARYGLTAAVDATLAATRI
                     DHVDQTQESDMSFLTRLAKRYDAVMTVKDKHLLFTPIGSGKTVSGKPLDVLAITRASG
                     DQHRYHVAQRDSYTSVRAHYHSNGSARRLPVVVGDAKGKNVKVLPEDYATEAEARAAA
                     QAEYARTQRGESTLSYTLALGRPELFPEMPVTVTGFKPDIDDTPWLVKKATHTIGDGG
                     FTTALELEVRDAPKKTRRTGQR"
     misc_feature    complement(109359..110339)
                     /locus_tag="BCAL0089"
                     /note="HMMPfam hit to PF05954, Phage late control gene D
                     protein (GPD), score 1.2e-151"
                     /inference="protein motif:HMMPfam:PF05954"
     CDS             complement(110393..110824)
                     /transl_table=11
                     /locus_tag="BCAL0090"
                     /product="putative phage tail assembly protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0090"
                     /db_xref="EnsemblGenomes-Tr:CAR50398"
                     /db_xref="InterPro:IPR009734"
                     /db_xref="InterPro:IPR016912"
                     /db_xref="UniProtKB/TrEMBL:B4EF53"
                     /protein_id="CAR50398.1"
                     /translation="MMMSLDQFVFSLATTPYQELQRQRNWKHRTSSRIGVRDASQFTG
                     AGDDTITLTGIVAPENGIGEIASIEALARMGDAGDAYVLVDGNGNVYGAYVIDSLNET
                     ATYHTKEGMARKIAFTLTLKRVDDGVLAEVQQDDDSGAAEQ"
     misc_feature    complement(110444..110809)
                     /locus_tag="BCAL0090"
                     /note="HMMPfam hit to PF06995, Phage P2 GpU, score 1e-51"
                     /inference="protein motif:HMMPfam:PF06995"
     CDS             complement(110847..113417)
                     /transl_table=11
                     /locus_tag="BCAL0091"
                     /product="putative phage membrane protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0091"
                     /db_xref="EnsemblGenomes-Tr:CAR50399"
                     /db_xref="GOA:B4EF54"
                     /db_xref="UniProtKB/TrEMBL:B4EF54"
                     /protein_id="CAR50399.1"
                     /translation="MDNTLKLRVMVDMIDNMTKPLQMMLTGNKGLADSLRATRRELDD
                     MAKTQKRIGEFRDLRSGVAKTATELKSAKLRAGELRVALRASGPPSRQMVEDLAKLER
                     TATDLTAAQGRQVARIRELRTQLVGAGIDTRRLDLHEFALATNSARRQAKMTADVRAF
                     DDARRKRAEARRAKIDALGGVGRQWAERGKTIAGAGKSMFGMLSEPLDVAKQAESETL
                     RLRAQGASADAVTFARAQQVGGQSVVDNLALMRESLAALGGDEQRARVVMPMLANMKS
                     ANEALFGKDDAKANVDKFMAMLKVIDLRGGTKNEAAFGAEANIVQKMQTATGGKVSGD
                     EWNSFAESGGGAARKLRTDAFYYQMQPLIEKLGGKAAGEGLAALSGSLFGGKVTAPAA
                     RQLTALGLVDPKRVLHARNGAIRGLGPGALAGSDMLQASPLEWLEKVLLPKLAAKGIT
                     QPDNVKAALAKLFPDKAAGTLLTTMYEQREQIHDTERQSAAADSVTGMRAKAADSTAG
                     RELAVLAQLRDLKLEIGEKITPVYNAALDVTARMLEKIVRFVREHGTATRILVTTFAA
                     LGGALAVAGTLASVFGGLLGSVNVLRFATSMVGAFRLVGQALLMLGRLAMANPLLAVI
                     GLIAMAAVYVWQNWDTLGPKFIALWETIKGAFGAASDWITAKWDATVEWVKTSLGGIG
                     DWFGDIGTRFQEIGASIVSGLVDGITNRLGALKDTAGNLGSSTLGWLKEKLGMQASPT
                     PDNGPGGATTGTPTRMTRTAAALTSAAALVGPPAFAASPAIAAAAPLERYNLSLDYRP
                     PLTAPAAVASAAPAAGPVTINIAPPPGADAAEIARMVRAELERAERAKASRTASRLSD
                     "
     misc_feature    complement(join(111510..111578,111639..111707))
                     /locus_tag="BCAL0091"
                     /note="2 probable transmembrane helices predicted for
                     BCAL0091 by TMHMM2.0 at aa 571-593 and 614-636"
                     /inference="protein motif:TMHMM:2.0"
     CDS             complement(113433..113546)
                     /transl_table=11
                     /locus_tag="BCAL0092"
                     /product="putative phage tail-associated protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0092"
                     /db_xref="EnsemblGenomes-Tr:CAR50400"
                     /db_xref="InterPro:IPR009493"
                     /db_xref="UniProtKB/TrEMBL:B4EF55"
                     /protein_id="CAR50400.1"
                     /translation="MADIATVFGWTPPVMDAFSLAELMDWRERARVRAGAQ"
     misc_feature    complement(113436..113546)
                     /locus_tag="BCAL0092"
                     /note="HMMPfam hit to PF06528, Phage P2 GpE, score
                     4.5e-15"
                     /inference="protein motif:HMMPfam:PF06528"
     CDS             complement(113555..113926)
                     /transl_table=11
                     /locus_tag="BCAL0093"
                     /product="putative phage tail protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0093"
                     /db_xref="EnsemblGenomes-Tr:CAR50401"
                     /db_xref="InterPro:IPR019289"
                     /db_xref="UniProtKB/TrEMBL:B4EF56"
                     /protein_id="CAR50401.1"
                     /translation="MNPIQSDAAAPDLQADAAAIATPAQDDPATHTLDTPLVRGTQTI
                     TSITLRKPKSGELRGVSLSDLVSLDVVALSKVLPRISSPMLTEADVASIDPADLVQLG
                     GIFAGFLMPKAVKSRLASQTA"
     misc_feature    complement(113585..113842)
                     /locus_tag="BCAL0093"
                     /note="HMMPfam hit to PF06158, Phage tail protein E, score
                     7.1e-40"
                     /inference="protein motif:HMMPfam:PF06158"
     CDS             complement(114003..114512)
                     /transl_table=11
                     /locus_tag="BCAL0094"
                     /product="phage major tail tube protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0094"
                     /db_xref="EnsemblGenomes-Tr:CAR50402"
                     /db_xref="InterPro:IPR006498"
                     /db_xref="UniProtKB/TrEMBL:B4EF57"
                     /protein_id="CAR50402.1"
                     /translation="MGMPRKLKGFNLFQNGENFVGQVVEVTLPKLTRKMEDYQGGGMS
                     GPIKVDFGQEGIQLEWTCGGFMRSVLGQYAITKHDGVLLRFAGGYQAEDSTNVDAIEI
                     VIRGRHSEIDPGTAKSKEDTAFKVTTVASYYKLSVNGQDVIEIDFVNMIEKVNGNDLF
                     AALRNAIGL"
     misc_feature    complement(114006..114509)
                     /locus_tag="BCAL0094"
                     /note="HMMPfam hit to PF04985, Phage tail tube protein
                     FII, score 4.1e-82"
                     /inference="protein motif:HMMPfam:PF04985"
     CDS             complement(114541..115713)
                     /transl_table=11
                     /locus_tag="BCAL0095"
                     /product="putative phage major tail sheath protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0095"
                     /db_xref="EnsemblGenomes-Tr:CAR50403"
                     /db_xref="InterPro:IPR020287"
                     /db_xref="InterPro:IPR035089"
                     /db_xref="UniProtKB/TrEMBL:B4EF58"
                     /protein_id="CAR50403.1"
                     /translation="MPQDYHHGVRVIEINEGSRPIRTVSTAVVGIVCTASDADATAFP
                     LDTPVLLTNVVAALGKAGTKGTLRRTLDAIGRQTKPVTIVVRVAEGKDAGETATNVIG
                     SVTADGKYTGMKALLGAQARFGVKPRILATPGLDTQPVAAALASIAQSLRAFAYVSAN
                     GCKTKEEAVAYRKQFSQRELMVVWPDFLAWDDTTNTTVVVPATAYAAGLRAKIDNDTG
                     WHKTLSNVGVNGVTGISADVSWDLQDPATDAGFLNEQDVTTLVNRNGFRFWGSRTCSD
                     DPLFAFENYTRTAQVIADSIAEAQMAIIDGPLNPSLPRDIIETINAKFREWISQGYLI
                     GGSAWYDPEPNTTDVLKSGKAYLDYEYTPVPPLENLMLRQRITDRYLADFAARVSA"
     misc_feature    complement(114565..115707)
                     /locus_tag="BCAL0095"
                     /note="HMMPfam hit to PF04984, Phage tail sheath protein,
                     score 4.9e-164"
                     /inference="protein motif:HMMPfam:PF04984"
     CDS             complement(115768..116502)
                     /transl_table=11
                     /locus_tag="BCAL0096"
                     /product="hypothetical phage protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0096"
                     /db_xref="EnsemblGenomes-Tr:CAR50404"
                     /db_xref="InterPro:IPR003458"
                     /db_xref="UniProtKB/TrEMBL:B4EF59"
                     /protein_id="CAR50404.1"
                     /translation="MLIHHYSPSTGEYLSSSQPDADPRNPERWLIPASATLDAPPART
                     PTTWPFYRNDVWTLLPDFRGRICYRTDTGEPVEIATAGKTPDELGLTTEPRPSPRHAW
                     LDGAWTVPPELLEREKRDAAMAEFEQRLETARKANAGKADAYAAGLLDDEGVYYFKAW
                     SAYQMALVRVIQADTFPDAIAWPATPAPYVPPPPTPVPPAPSEPSEPSEPSEPIEPIE
                     PPAPTEPSSPPADPATPAVPVADSAA"
     CDS             complement(116518..119169)
                     /transl_table=11
                     /locus_tag="BCAL0097"
                     /product="putative phage tail protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0097"
                     /db_xref="EnsemblGenomes-Tr:CAR50405"
                     /db_xref="InterPro:IPR011083"
                     /db_xref="InterPro:IPR037053"
                     /db_xref="UniProtKB/TrEMBL:B4EF34"
                     /protein_id="CAR50405.1"
                     /translation="MATQIIITDAGRAALVAAGNGGTNAHQVVEIGLANAPFVADKGL
                     TKLPNELKRIKSFGGANVAPDTIHTTLKDDSTDQYSLYGFGLYLDNGVLLAAYGQATP
                     IMEKSPAALLLLSSDMQFATIDATQLVFGDASFLNPPATTERQGVVELATQGEVDAGS
                     DDTRAITPKTAASRYAALTGAKFTGPVVTEFDAGPDTAHVSIRPPSGKNGREGRVRLH
                     GTFGGGNPDTGSRLVATIRSGFDNGAWGREYVDLWLNRTANDVQSDSYQARALRIGYG
                     GRVLVGDVKNDDGNSRLRVGGDTVAEGTSYSRAASIDGGAGNFSTLFFTDGGKIRWSM
                     FKRDGAASGGNGGNDFGVNAFADDGVTQFPAFRVSRGTQAFSIAKRLLVGDIGDDGRN
                     AIQAAGNATFNGGLTSRAMDVNGAHFRAIFGGYGAFLRNDGTNVYLLSTNKGDPEGQW
                     NDFRPVTWNLETGRVTIDDRGSGTAIGGNTTVRGELSVGTGQAQGSIRVGPVDGFLYS
                     NGDGYGWWTPTKGAFQYYIADRTFRIDGNPVWHSGNLSPLDRTKGGTMSGDLWFDPGK
                     RIYLSEGSAQAPSLTFTNDGAPDTGLYHTGDGMFGVTCNSVSQVSFTPGGTTFQTPVQ
                     GQTPPAGDRSTRLATTEWVVAAIASAAIGTVVFEPRTTARAGFLKLNGALLKRADYPA
                     LWAYAQASGALSTETDWAAGWSGTFSTGDGTTTFRIPELRGEFVRCWDDTRGVDPNRG
                     LGASQNFANAWHAHGASAAASGDHVHSAWTDVQGWHGHHGWTASVGDHQHVAPYSESG
                     IAPFGTHSTNQVGSHGGVDNDNPWAFTSGAGGHNHEFNTEGAGNHGHNVGIGAAGNHS
                     HAITVNGDGANESRPRNVALLAMIRAY"
     misc_feature    complement(116992..117213)
                     /locus_tag="BCAL0097"
                     /note="HMMPfam hit to PF07484, Phage Tail Collar Domain,
                     score 5.3e-07"
                     /inference="protein motif:HMMPfam:PF07484"
     CDS             complement(119176..119643)
                     /transl_table=11
                     /locus_tag="BCAL0098"
                     /product="putative phage tail protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0098"
                     /db_xref="EnsemblGenomes-Tr:CAR50406"
                     /db_xref="InterPro:IPR006521"
                     /db_xref="UniProtKB/TrEMBL:B4EF35"
                     /protein_id="CAR50406.1"
                     /translation="MPTPLATLTNPDTIRSDLLPWLAWHLGVDAWKDYWPEYVKRARV
                     GQAIPIARRKGTAASVREVVAAFGGNIVLREWFEQQPPGAPGTFDLVMTVSGQEGEPP
                     TAEYVADILAEIDRTKPVRAHYTFTQGFEMRGRQPIGAAARVAAYRRVNFTDY"
     CDS             complement(119711..120625)
                     /transl_table=11
                     /locus_tag="BCAL0099"
                     /product="putative phage baseplate assembly protein J"
                     /db_xref="EnsemblGenomes-Gn:BCAL0099"
                     /db_xref="EnsemblGenomes-Tr:CAR50407"
                     /db_xref="InterPro:IPR006949"
                     /db_xref="InterPro:IPR014507"
                     /db_xref="InterPro:IPR040471"
                     /db_xref="UniProtKB/TrEMBL:B4EF36"
                     /protein_id="CAR50407.1"
                     /translation="MSVTPIDLSQLPSPDIVETLDYETLLAARKARLVSLYPAAEQAE
                     IAATLALESEPLVKLLQENAYREIVLRQRVNDAARAVMLAYAVGTDLDHLAALFGIRR
                     LTISPADPAHDLAAVMESDADLRARTQLAPQSFSVAGPEGAYVSHARNADGRVLDASA
                     VSPAPCEVLVTVLARDGDGTAAPALIDAVAAALQADDVRPLTDKVTVRGAEILRYQVR
                     ARLVFFAGPDRAVALAQANRAMKQYTDSMHRLGMEVTLDGIYAAARAAGVQKVILESP
                     LAGLPATKQQAPYCTGIELIDGGVYSNE"
     misc_feature    complement(119840..120463)
                     /locus_tag="BCAL0099"
                     /note="HMMPfam hit to PF04865, Baseplate J-like protein,
                     score 3.9e-81"
                     /inference="protein motif:HMMPfam:PF04865"
     CDS             complement(120622..120984)
                     /transl_table=11
                     /locus_tag="BCAL0100"
                     /product="putative phage baseplate assembly protein W"
                     /db_xref="EnsemblGenomes-Gn:BCAL0100"
                     /db_xref="EnsemblGenomes-Tr:CAR50408"
                     /db_xref="InterPro:IPR007048"
                     /db_xref="InterPro:IPR040471"
                     /db_xref="UniProtKB/TrEMBL:B4EF37"
                     /protein_id="CAR50408.1"
                     /translation="MKGMNANTGRSISGLDHFYQSIGKIVTTPLASCVKRRTFGSELP
                     DLIDAPGNGTVRTRLYAAVATALMRWEPRLTLTRVVLTADDANAAAGSLYLDIEGWTG
                     ENGTAVSTRVPVANGSPA"
     misc_feature    complement(120643..120942)
                     /locus_tag="BCAL0100"
                     /note="HMMPfam hit to PF04965, GPW / gp25 family, score
                     1.1e-26"
                     /inference="protein motif:HMMPfam:PF04965"
     CDS             complement(120981..121790)
                     /transl_table=11
                     /locus_tag="BCAL0101"
                     /product="phage baseplate assembly protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0101"
                     /db_xref="EnsemblGenomes-Tr:CAR50409"
                     /db_xref="InterPro:IPR006531"
                     /db_xref="InterPro:IPR013046"
                     /db_xref="InterPro:IPR037026"
                     /db_xref="InterPro:IPR040471"
                     /db_xref="InterPro:IPR040629"
                     /db_xref="UniProtKB/TrEMBL:B4EF38"
                     /protein_id="CAR50409.1"
                     /translation="MRTGAAIVDARLDAGIRRALSPPRRHRPSLAPRAPRRHHGCMDA
                     NEIQRQARNAVRKGTILAVDHAAALCRVSVGDADSDGSGLQTNWIPWVAGTAGATRDW
                     LPPTPGEQVVLLCPMGDPAQGVALRGVYSNAAPAPASSPDTHARVYPDGARITYDHAA
                     HALTVELPAGATVRVVAPGSVVVQTRDATVQAERITLDAPQTTCTGAMTVKGPFAFEA
                     GMTGTGGAGGGATMQIDGAATFTREVTSRGISLPHHTHREQGDGQLVSEPQ"
     misc_feature    complement(121296..121619)
                     /locus_tag="BCAL0101"
                     /note="HMMPfam hit to PF04717, Phage-related baseplate
                     assembly protein, score 2.5e-39"
                     /inference="protein motif:HMMPfam:PF04717"
     CDS             complement(122176..122625)
                     /transl_table=11
                     /locus_tag="BCAL0102"
                     /product="putative phage tail completion protein R"
                     /db_xref="EnsemblGenomes-Gn:BCAL0102"
                     /db_xref="EnsemblGenomes-Tr:CAR50410"
                     /db_xref="InterPro:IPR009678"
                     /db_xref="UniProtKB/TrEMBL:B4EF39"
                     /protein_id="CAR50410.1"
                     /translation="MIKPDSLRRALAAAIPSIDDEPGALTVLVEQGSIATTGTLTPSF
                     EYRYTAHVLATHFSGDTDPVFVALIEWVRANQPDLVTNPAARASGITFEVGIRDQAAV
                     DLSIRLALTESVVVTTGPDGRPVITHVDDTRVDPADTLTWVALPQIR"
     misc_feature    complement(122230..122622)
                     /locus_tag="BCAL0102"
                     /note="HMMPfam hit to PF06891, P2 phage tail completion
                     protein R (GpR), score 5.9e-39"
                     /inference="protein motif:HMMPfam:PF06891"
     CDS             complement(122742..123182)
                     /transl_table=11
                     /locus_tag="BCAL0103"
                     /product="putative phage-encoded lipoprotein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0103"
                     /db_xref="EnsemblGenomes-Tr:CAR50411"
                     /db_xref="InterPro:IPR020000"
                     /db_xref="UniProtKB/TrEMBL:B4EF40"
                     /protein_id="CAR50411.1"
                     /translation="MNGLAAKIIAWIVALATCAVVALYVHGLRAERATAQRQRVEAQQ
                     ALAARDGIIARLRQDAAERAQQQARLDHAQTAIASKLDAIRFENRRLTDENAALRAWA
                     DTRLPDDVVRLQASPALTGAGDYVEHVPDGETVHAAEARAADQR"
     sig_peptide     complement(123102..123182)
                     /locus_tag="BCAL0103"
                     /note="Signal peptide predicted for BCAL0103 by SignalP
                     2.0 HMM (Signal peptide probability 0.791) with cleavage
                     site probability 0.455 between residues 27 and 28"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    complement(123102..123170)
                     /locus_tag="BCAL0103"
                     /note="1 probable transmembrane helix predicted for
                     BCAL0103 by TMHMM2.0 at aa 5-27"
                     /inference="protein motif:TMHMM:2.0"
     CDS             complement(123179..124030)
                     /transl_table=11
                     /locus_tag="BCAL0104"
                     /product="putative phage-encoded peptidoglycan binding
                     protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0104"
                     /db_xref="EnsemblGenomes-Tr:CAR50412"
                     /db_xref="InterPro:IPR002477"
                     /db_xref="InterPro:IPR024408"
                     /db_xref="InterPro:IPR036365"
                     /db_xref="InterPro:IPR036366"
                     /db_xref="UniProtKB/TrEMBL:B4EF41"
                     /protein_id="CAR50412.1"
                     /translation="MKTRRLGDHGDDVGLLQRRLIRAGYAVQITHLYDAATEAAVIAL
                     QRKTGLVDDGIAGPKTYAALATGLRDPKHLGLADLERAARTLDVPLACIRAVNEVESR
                     GAGFLPDGRPVILFERHVFWKRLQARGIDPAPFAARQPDIVSRTRGGYRGSAAEYVRL
                     ATAESIDAGAAWESASWGAFQVMGYHWERLGYAGIDAFVSCMEDGEAQHLDAFMRYIA
                     ADNTLRRALGARQWAAFARAYNGPDYAANLYDVKLARAFDRYASQAAAATQAASGSPD
                     ATVASRA"
     misc_feature    complement(123827..124006)
                     /locus_tag="BCAL0104"
                     /note="HMMPfam hit to PF01471, Putative peptidoglycan
                     binding domain, score 1.7e-17"
                     /inference="protein motif:HMMPfam:PF01471"
     CDS             complement(124033..124299)
                     /transl_table=11
                     /locus_tag="BCAL0105"
                     /product="putative phage membrane protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0105"
                     /db_xref="EnsemblGenomes-Tr:CAR50413"
                     /db_xref="GOA:B4EF42"
                     /db_xref="InterPro:IPR008473"
                     /db_xref="UniProtKB/TrEMBL:B4EF42"
                     /protein_id="CAR50413.1"
                     /translation="MAFPFALIALAAHLAVLVRVLTYRRNGARHRRHASWFAWMLVAV
                     TGGASIEWLLHTGAVGFFDAATAVFLAMFVCGTRGNVARLLRSE"
     misc_feature    complement(124036..124284)
                     /locus_tag="BCAL0105"
                     /note="HMMPfam hit to PF05449, Protein of unknown function
                     (DUF754), score 1.4e-17"
                     /inference="protein motif:HMMPfam:PF05449"
     misc_feature    complement(join(124057..124125,124138..124197,
                     124231..124290))
                     /locus_tag="BCAL0105"
                     /note="3 probable transmembrane helices predicted for
                     BCAL0105 by TMHMM2.0 at aa 4-23, 35-54 and 59-81"
                     /inference="protein motif:TMHMM:2.0"
     CDS             complement(124301..124645)
                     /transl_table=11
                     /locus_tag="BCAL0106"
                     /product="putative phage membrane protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0106"
                     /db_xref="EnsemblGenomes-Tr:CAR50414"
                     /db_xref="GOA:B4EF43"
                     /db_xref="InterPro:IPR032637"
                     /db_xref="UniProtKB/TrEMBL:B4EF43"
                     /protein_id="CAR50414.1"
                     /translation="MAEPNLTTAAMLSTAIGVAGLAPGIDGNALIGAFTGAALVVVTS
                     KEIGVARRAAYLLISLVMGYLAAPEIVGATPIHSTGVAAFFAAALVIAVTLQLIERIK
                     TLDLLALFRKGG"
     misc_feature    complement(join(124352..124405,124418..124486,
                     124520..124588))
                     /locus_tag="BCAL0106"
                     /note="3 probable transmembrane helices predicted for
                     BCAL0106 by TMHMM2.0 at aa 20-42, 54-76 and 81-98"
                     /inference="protein motif:TMHMM:2.0"
     CDS             complement(124662..124868)
                     /transl_table=11
                     /locus_tag="BCAL0107"
                     /product="phage tail protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0107"
                     /db_xref="EnsemblGenomes-Tr:CAR50415"
                     /db_xref="InterPro:IPR008861"
                     /db_xref="InterPro:IPR036779"
                     /db_xref="UniProtKB/TrEMBL:B4EF44"
                     /protein_id="CAR50415.1"
                     /translation="MIARTLQGDTVDTLCWRHYGRTDGTVETVLEANTGLASLGVVLP
                     AGTPVYLPPFDTVTSARPLLQLFD"
     misc_feature    complement(124689..124868)
                     /locus_tag="BCAL0107"
                     /note="HMMPfam hit to PF05489, Phage Tail Protein X, score
                     1.2e-25"
                     /inference="protein motif:HMMPfam:PF05489"
     repeat_region   125266..125296
                     /note="Perfect repeat flanking prophage, 3-prime fragement
                     of tRNA Arg"
     CDS             125430..127049
                     /transl_table=11
                     /locus_tag="BCAL0108"
                     /product="putative membrane protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0108"
                     /db_xref="EnsemblGenomes-Tr:CAR50416"
                     /db_xref="GOA:B4EF45"
                     /db_xref="InterPro:IPR026467"
                     /db_xref="UniProtKB/TrEMBL:B4EF45"
                     /protein_id="CAR50416.1"
                     /translation="MAAIPSTSTAVAACPLTDAQQALLARLHAYSPDDPDAPLPYSRR
                     LADAEGWSHDHALAVIDEYKRFAFLAQVAGHPVTPSVAVDAAWHFHLQYTLEYWDVFC
                     AGVLRARLHHMPGTGAPDEAAVYAQRYRDTLDSYRRLFGCEPPASIWPRPVDRAVEGG
                     AEVETQQPERMVAVAPRRAWRDRLPKLVWPAAAASVAATCASAQDLDVLDYTGPQFLA
                     FYVPACVVALSLIVALHAIEFRIRRWGRRTRKASSGLSADEVAYLTGGEARVAQVVTM
                     SLAHAGAVDLWSVHLQGSYVKIADLERAGRYDDYCAWLNEQPSGTVRYGVFRERLARY
                     AQEVVDGMRAQGWFWAPGELRASRMAARAIALLVFGTGAVKLAVGLSRGRPVLLLCIC
                     MAVFAIAYRIVAGRLTGFRRGGPTAAGRAALLERRNAHDPRAARDARHVRSAQGASGI
                     RDAERDDPDPLLWTAALFGAGALAGTVWSAYAGPVLAASRMPSVAAAKAGGGTSFDSS
                     DGGGASSSCSSSSSCSSSSCSSSSCGGCSSS"
     misc_feature    125439..125471
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
                     /inference="protein motif:Prosite:PS00013"
     misc_feature    join(126078..126146,126516..126569,126582..126641,
                     126807..126875)
                     /locus_tag="BCAL0108"
                     /note="4 probable transmembrane helices predicted for
                     BCAL0108 by TMHMM2.0 at aa 217-239, 363-380, 385-404 and
                     460-482"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    126966..126998
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
                     /inference="protein motif:Prosite:PS00013"
     CDS             127259..129232
                     /transl_table=11
                     /locus_tag="BCAL0109"
                     /product="putative TPR repeat protein"
                     /note="C-terminus is similar to Geobacter sulfurreducens
                     TPR domain protein gsu1547 SWALL:AAR34921 (EMBL:AE017212)
                     (473 aa) fasta scores: E(): 3.1e-69, 47.16% id in 441 aa"
                     /db_xref="EnsemblGenomes-Gn:BCAL0109"
                     /db_xref="EnsemblGenomes-Tr:CAR50417"
                     /db_xref="GOA:B4EF46"
                     /db_xref="InterPro:IPR002201"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:B4EF46"
                     /protein_id="CAR50417.1"
                     /translation="MTVRRFAQPSMTTPASDVSACVRHAATLCQNGQFADALSLVAPQ
                     LDASAVDVAVLHVAAVCALGLNHLADAEASWRRAIDAMPAFEPPYDGLHALLMSQGRL
                     PDAEVILRRQLACVAPLRASHHHRLGKVLEALGRLDEAEQAFGQALSIEPRSPDVLTD
                     FGNLLRVLARPAEAELAYRLAIAVRADHVLAHANLGAILVDMRRLPEAEAASRQTIAL
                     CPDHPEAHYNLGVALQNLDRLSEAEAAYRDAIRCRPGLPQAHNNLGCVLRAQGRHDEA
                     AVAFTDALALAPQMAEVHYNLGTTLAHAGQLDEAERAYRRALELRADYDDARFGLATL
                     LLSRGRFEEGWRRYESRYEQSTFVHRRTREVLRCAQWQGEPLAGKTLLVWQEDGLGDM
                     LQFSRYFAEFRARQAARVVFACQPALHRLMETVDGVDAVLDHEAATAQAAQFDYWTSL
                     LSAPMHAGTTLDTIPPPVRFVPDPARVAHWGARLDALPPGPRVGLVWKGNPKHHNDAH
                     RSLPSLALLTPLWSVPGVNFVSLQKGQGEDEARQPPGGLPLLHLGSELDDFADTAAIV
                     AQLDLVVCVDTSTAHLAASLGKPCWVLLPNQDVDWRWMHDREDSPWYPGTVRLFRRGR
                     GDSWIKMAERLRGAFAAHFAVARVTADKTARSV"
     misc_feature    127619..127720
                     /locus_tag="BCAL0109"
                     /note="HMMPfam hit to PF00515, Tetratricopeptide repeat,
                     score 9.2e-06"
                     /inference="protein motif:HMMPfam:PF00515"
     misc_feature    127619..127696
                     /locus_tag="BCAL0109"
                     /note="HMMPfam hit to PF07721, Tetratricopeptide repeat,
                     score 0.019"
                     /inference="protein motif:HMMPfam:PF07721"
     misc_feature    127721..127822
                     /locus_tag="BCAL0109"
                     /note="HMMPfam hit to PF00515, Tetratricopeptide repeat,
                     score 0.4"
                     /inference="protein motif:HMMPfam:PF00515"
     misc_feature    127823..127924
                     /locus_tag="BCAL0109"
                     /note="HMMPfam hit to PF00515, Tetratricopeptide repeat,
                     score 0.0085"
                     /inference="protein motif:HMMPfam:PF00515"
     misc_feature    127925..128026
                     /locus_tag="BCAL0109"
                     /note="HMMPfam hit to PF07719, Tetratricopeptide repeat,
                     score 2.5e-06"
                     /inference="protein motif:HMMPfam:PF07719"
     misc_feature    127925..128002
                     /locus_tag="BCAL0109"
                     /note="HMMPfam hit to PF07721, Tetratricopeptide repeat,
                     score 0.023"
                     /inference="protein motif:HMMPfam:PF07721"
     misc_feature    128027..128128
                     /locus_tag="BCAL0109"
                     /note="HMMPfam hit to PF00515, Tetratricopeptide repeat,
                     score 1.7e-07"
                     /inference="protein motif:HMMPfam:PF00515"
     misc_feature    128129..128230
                     /locus_tag="BCAL0109"
                     /note="HMMPfam hit to PF00515, Tetratricopeptide repeat,
                     score 5.9e-09"
                     /inference="protein motif:HMMPfam:PF00515"
     misc_feature    128129..128206
                     /locus_tag="BCAL0109"
                     /note="HMMPfam hit to PF07721, Tetratricopeptide repeat,
                     score 9.6e-05"
                     /inference="protein motif:HMMPfam:PF07721"
     misc_feature    128375..128398
                     /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
                     /inference="protein motif:Prosite:PS00017"
     CDS             complement(129387..130529)
                     /transl_table=11
                     /locus_tag="BCAL0110"
                     /product="putative aminotransferase"
                     /db_xref="EnsemblGenomes-Gn:BCAL0110"
                     /db_xref="EnsemblGenomes-Tr:CAR50418"
                     /db_xref="GOA:B4EDI4"
                     /db_xref="InterPro:IPR000653"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:B4EDI4"
                     /protein_id="CAR50418.1"
                     /translation="MTASLPASSVAQLPRERIYVTQPHLPPLEEFLPYLEKIWESRTL
                     TNGGPFHQQFEQALCEYLGVPHLSLFANGTLALVTALQALRITGEVITTPYSFVATAH
                     SLLWNGIKPVFADVAPGTLNLDAARIEAAITPQTTAIMPVHCYGNPCDVDAIQKIADN
                     YNLRVIYDAAHAFGVQTAAGSVLAHGDLSVLSFHATKVFNTFEGGAIVCPDAKTKQRI
                     DHLKNFGFVDEVTVVAPGINGKMSEINAAFGMLQLQHIDGALARRRDIDTLYRALLLD
                     VRGIRCLPQGGQTVANHAYFPILVEDDYPLDRDALYRKLRDHDVYARRYFHPLISEFP
                     MYRGLPSANRDNLPVASEAARKVLCLPLYPALTDDTVHRIVKLIGR"
     misc_feature    complement(129393..130457)
                     /locus_tag="BCAL0110"
                     /note="HMMPfam hit to PF01041, DegT/DnrJ/EryC1/StrS
                     aminotransferase, score 1.3e-100"
                     /inference="protein motif:HMMPfam:PF01041"
     misc_feature    complement(129639..130403)
                     /locus_tag="BCAL0110"
                     /note="HMMPfam hit to PF01212, Beta-eliminating lyase,
                     score 0.00017"
                     /inference="protein motif:HMMPfam:PF01212"
     CDS             complement(130559..132901)
                     /transl_table=11
                     /locus_tag="BCAL0111"
                     /product="putative TPR repeat protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0111"
                     /db_xref="EnsemblGenomes-Tr:CAR50419"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="InterPro:IPR029489"
                     /db_xref="UniProtKB/TrEMBL:B4EDI5"
                     /protein_id="CAR50419.1"
                     /translation="MFSTELPATAALTPEQQLAQDIALVMENALERQRSGAFDDARAL
                     YEAILDAVPAHGDAHYNLAVLMVDTGQATDAVPHFEAAIGANPDNGYYWVSYIHALHR
                     TGQTAAAWIAVEIAQQRGVHGPALDGLIAQLASPEVVLATAAVAPSGIDAAIVLETAT
                     GHAGRSDSGKPVRRPNQTLLQKHAALFDKNKHAEATALARQLVADYPQDGACWRALSA
                     SLHREGRFAEMIEAGFRTIELLPDELLVRMLLADTLRVMNRLEEADEQCTRLIQLQPD
                     HPEAFRIRGLVLFALRRMDEAIAACRRAVELAPGAAAPCGTLGFVLLEQGATQEAMGW
                     LKRSIEINPTDSVTHSSMLFCITHISDFDPQALITEHRKFGERYGNHKRKRAAVFSNS
                     RDPARKLQVGFVSGDLFSHAVASYAVPVIEHLAADPGIAMHFYHNHFEEDHVSERFKA
                     HATTWRTVAGMSDTAFLERVRNDRIDIVIDLSGHTGRNRLVALAQRAAPVQASWIGYP
                     ATTGLAAMDYYLADRFLAPHGQFEDQFVERIVRLPAIASFMPPVNCPPVNVLPALHNG
                     YTTYGSFNRLNKLSSHVIAVWARVLHADPTARMALGAIGNEGDQQTLTEWFVAAGIDA
                     SRLSFHRRSNIPVYMQQHHGVDLCLDTFPYTGSTTTLNGLWMGVPTLTIPGSTMAGRG
                     SASWLQHVGCDAYIANDEDDFVAKALALSSDTTTLQALRAGLRARCSASAAFRPDVVA
                     AGLSSALRTMWVRWCANEPVTAFDTPLFDDTATAPAAAEA"
     misc_feature    complement(131867..131968)
                     /locus_tag="BCAL0111"
                     /note="HMMPfam hit to PF00515, Tetratricopeptide repeat,
                     score 0.028"
                     /inference="protein motif:HMMPfam:PF00515"
     misc_feature    complement(131969..132070)
                     /locus_tag="BCAL0111"
                     /note="HMMPfam hit to PF07719, Tetratricopeptide repeat,
                     score 3e-06"
                     /inference="protein motif:HMMPfam:PF07719"
     misc_feature    complement(132071..132172)
                     /locus_tag="BCAL0111"
                     /note="HMMPfam hit to PF00515, Tetratricopeptide repeat,
                     score 0.33"
                     /inference="protein motif:HMMPfam:PF00515"
     misc_feature    complement(132635..132736)
                     /locus_tag="BCAL0111"
                     /note="HMMPfam hit to PF07719, Tetratricopeptide repeat,
                     score 0.0049"
                     /inference="protein motif:HMMPfam:PF07719"
     CDS             complement(133158..133457)
                     /transl_table=11
                     /locus_tag="BCAL0112"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0112"
                     /db_xref="EnsemblGenomes-Tr:CAR50420"
                     /db_xref="InterPro:IPR008622"
                     /db_xref="UniProtKB/TrEMBL:B4EDI6"
                     /protein_id="CAR50420.1"
                     /translation="MEQTELIAQIDALTDGIEHAAAMADWAEAARLVDARWSLVALLS
                     TDQPPVGIAAIRRMQASNDRIFADAQRAQQELTDEYQAAMSRVQAVGQYQSIANR"
     CDS             complement(133483..134991)
                     /transl_table=11
                     /gene="fliD1"
                     /locus_tag="BCAL0113"
                     /product="B-type flagellar hook-associated protein 2
                     (HAP2)"
                     /db_xref="EnsemblGenomes-Gn:BCAL0113"
                     /db_xref="EnsemblGenomes-Tr:CAR50421"
                     /db_xref="GOA:B4EDI7"
                     /db_xref="InterPro:IPR003481"
                     /db_xref="InterPro:IPR010809"
                     /db_xref="InterPro:IPR040026"
                     /db_xref="UniProtKB/TrEMBL:B4EDI7"
                     /protein_id="CAR50421.1"
                     /translation="MSTINPAVTAANNSANSALQQAAQSIISGSTGNSSMDVNSLVTA
                     LVNAKTAGQAAALNAQQSSDNTQISAYGALSAALSALQASLTTLSNGSLQNTFTATAS
                     GTGLTATAGAGAVAGSYSVGVTQIATSQSLSSAAFGASTALGTGTMTLSLGSQSFTVD
                     VNGTNNTLSGIAAAINTATGNPGIVASVVNGSDGAHLVLSSTPTGAANTIGVALSNVA
                     GDNGLSSLGVTSTPSTTGGQSTITSANGSAAWKQSTAAQDAAFTINGIAGTSASNTVT
                     SAITGVTLNLTSAAVGATQPQTLTVATDTKSQAAAINNFATLYNTLVTTMGSLSSFTS
                     GASSQGPLLGDSTLNTIKNALASIVASGVNSNGSTVNLASIGVTLQADGTLKVDSTAL
                     NGALQNNPTGVASLFNSKNGIGEQLTTNITNYTKTNGLIAARTTALSNDLKNVAQQQT
                     TLSNYAAQLTSQYQAQFTALNTLMATMNSNSQYLTQLFGGANSAGAMSNNKG"
     misc_feature    complement(133555..134226)
                     /gene="fliD1"
                     /locus_tag="BCAL0113"
                     /note="HMMPfam hit to PF07195, Flagellar hook-associated
                     protein, score 1.6e-59"
                     /inference="protein motif:HMMPfam:PF07195"
     misc_feature    complement(134383..134553)
                     /gene="fliD1"
                     /locus_tag="BCAL0113"
                     /note="HMMPfam hit to PF07196, Flagellin hook IN motif,
                     score 2.7e-07"
                     /inference="protein motif:HMMPfam:PF07196"
     misc_feature    complement(134599..134895)
                     /gene="fliD1"
                     /locus_tag="BCAL0113"
                     /note="HMMPfam hit to PF02465, Flagellar hook-associated
                     protein, score 4.1e-18"
                     /inference="protein motif:HMMPfam:PF02465"
     CDS             complement(135124..136278)
                     /transl_table=11
                     /gene="fliC"
                     /locus_tag="BCAL0114"
                     /product="flagellin (type II)"
                     /db_xref="EnsemblGenomes-Gn:BCAL0114"
                     /db_xref="EnsemblGenomes-Tr:CAR50422"
                     /db_xref="GOA:B4EDI8"
                     /db_xref="InterPro:IPR001029"
                     /db_xref="InterPro:IPR001492"
                     /db_xref="InterPro:IPR022578"
                     /db_xref="InterPro:IPR042187"
                     /db_xref="UniProtKB/TrEMBL:B4EDI8"
                     /protein_id="CAR50422.1"
                     /translation="MLGINSNINSLVAQQNLNGSQNALSQAITRLSSGKRINSAADDA
                     AGLAISTRMQTQINGLNQGVSNANDGVSMIQTASSALSSLTNSLQRIRQLAVQASTGT
                     MSTTDQAALQQEVSQQIQEVNRIASQTTYNGTNILDGSAGIVSFQVGANVGQTISLDL
                     SQSMSAAKIGGGLVQKGQTVGTVTGLSLDNNGAYTGSGATITAINVLSDGKGGYTFTD
                     QNGGAISQTVAQSVFGANATTGTGTAVGNLTLQSGATGAGTSAAQQTAITNAIAQINA
                     VNKPATVSNLDISTVSGANVAMVSIDNALQTVNNVQAALGAAQNRFTAIATSQQAEST
                     DLSSAQSQITDANFAQETANMSKHQVLQQAGISVLAQANSLPQQVLKLLQ"
     misc_feature    complement(135193..135408)
                     /gene="fliC"
                     /locus_tag="BCAL0114"
                     /note="HMMPfam hit to PF00700, Bacterial flagellin
                     C-terminus, score 2.8e-15"
                     /inference="protein motif:HMMPfam:PF00700"
     misc_feature    complement(135787..136197)
                     /gene="fliC"
                     /locus_tag="BCAL0114"
                     /note="HMMPfam hit to PF00669, Bacterial flagellin
                     N-terminus, score 2.9e-63"
                     /inference="protein motif:HMMPfam:PF00669"
     CDS             136809..137021
                     /transl_table=11
                     /gene="rpsU1"
                     /locus_tag="BCAL0115"
                     /product="30S ribosomal protein S21 1"
                     /note="Similar to BCAM0915, 75.714% identity (75.714%
                     ungapped) in 70 aa overlap (1-70:1-70) and BCAS0245,
                     60.000% identity (60.000% ungapped) in 70 aa overlap
                     (1-70:1-70)"
                     /db_xref="EnsemblGenomes-Gn:BCAL0115"
                     /db_xref="EnsemblGenomes-Tr:CAR50423"
                     /db_xref="GOA:B4EDI9"
                     /db_xref="InterPro:IPR001911"
                     /db_xref="InterPro:IPR038380"
                     /db_xref="UniProtKB/TrEMBL:B4EDI9"
                     /protein_id="CAR50423.1"
                     /translation="MTTILLKENEPFEVAIRRFRRAIEKNGLIAELRERQSYEKPTAV
                     RKRKKAAAVKRLHKRLRSQMLPKKLH"
     misc_feature    136812..136973
                     /gene="rpsU1"
                     /locus_tag="BCAL0115"
                     /note="HMMPfam hit to PF01165, Ribosomal protein S21,
                     score 3.6e-31"
                     /inference="protein motif:HMMPfam:PF01165"
     CDS             complement(137188..139311)
                     /transl_table=11
                     /locus_tag="BCAL0116"
                     /product="putative TonB-dependent siderophore receptor"
                     /db_xref="EnsemblGenomes-Gn:BCAL0116"
                     /db_xref="EnsemblGenomes-Tr:CAR50424"
                     /db_xref="GOA:B4EDJ0"
                     /db_xref="InterPro:IPR000531"
                     /db_xref="InterPro:IPR010105"
                     /db_xref="InterPro:IPR010917"
                     /db_xref="InterPro:IPR012910"
                     /db_xref="InterPro:IPR036942"
                     /db_xref="InterPro:IPR037066"
                     /db_xref="InterPro:IPR039423"
                     /db_xref="UniProtKB/TrEMBL:B4EDJ0"
                     /protein_id="CAR50424.1"
                     /translation="MTVCLARPPVRPRRVAAALACLAASLAHADDSPGDAAVLPALNI
                     TAAHDSPQHLTDTISTGALGTRRQLDTPFSTTIVTSEELEARQPYKLGDVFANDASVS
                     DNSGAYSAWASYMTVRGMQLDWQNGYKIDGLPFVTYGITMPYEQLDRVELLKGLGGFL
                     YGFVTPGGVVNYVTKQPGAEPVRSVDIGYRSTNVWTEHVDLGQRFGPDHMFGARLNAT
                     HEEGKTYNDGNIRRDSVSLALQANLTRDLSVSFGALYQDRRTTGQTPSIFTGSYPGGA
                     LPATISGGSTNLGGKDQYLNTNLQLYTAGLQYQLALDWQLDVAYSYSKATRRRNESTL
                     YLQDAAGNYTDSRYVGMEDHRFSQWRAMVEGKVRTGPFSHQIVLGASWQKQANDYSAN
                     SVFVPLGAGNLYAPNPYRYESPHGFIQYRTSEIVQKSLFASDTVQLTERWSVLAGVRY
                     MNYAQRAFQASGAEDPGYRQNGVVTPTFAVMFKLAPTTTAYASYAESLEPGSRVNDVY
                     ANAGQVLKPLRSKQYELGIKSERARWSATAALFRIERSAEYANAANVYVQDGESIIQG
                     IEVGARAKFGAHWNAGVDAMLLDAWYANGIGNHGNRVAGAPRFVLAGDLGYAVPGVPG
                     LTLGVDAKFTGATPLRAAGGLDAPGFLVVNAGARYLTRVGRHDVTLRASIDNVLNRRY
                     WEYQYADYVKPGDPRTVSLSAKIDF"
     misc_feature    complement(137191..137889)
                     /locus_tag="BCAL0116"
                     /note="HMMPfam hit to PF00593, TonB dependent receptor,
                     score 4e-23"
                     /inference="protein motif:HMMPfam:PF00593"
     misc_feature    complement(137191..137244)
                     /note="PS01156 TonB-dependent receptor proteins signature
                     2."
                     /inference="protein motif:Prosite:PS01156"
     misc_feature    complement(138640..138663)
                     /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
                     /inference="protein motif:Prosite:PS00017"
     misc_feature    complement(138805..139113)
                     /locus_tag="BCAL0116"
                     /note="HMMPfam hit to PF07715, TonB-dependent Receptor
                     Plug Domain, score 8.6e-15"
                     /inference="protein motif:HMMPfam:PF07715"
     sig_peptide     complement(139225..139311)
                     /locus_tag="BCAL0116"
                     /note="Signal peptide predicted for BCAL0116 by SignalP
                     2.0 HMM (Signal peptide probability 1.000) with cleavage
                     site probability 1.000 between residues 29 and 30"
                     /inference="protein motif:SignalP:2.0"
     CDS             139541..140776
                     /transl_table=11
                     /locus_tag="BCAL0117"
                     /product="putative membrane protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0117"
                     /db_xref="EnsemblGenomes-Tr:CAR50425"
                     /db_xref="GOA:B4EDJ1"
                     /db_xref="InterPro:IPR005625"
                     /db_xref="UniProtKB/TrEMBL:B4EDJ1"
                     /protein_id="CAR50425.1"
                     /translation="MNAFLRPFLVRLHRWFGLAIALFLFVAGLTGALIAWDHELDAVL
                     NPDFYTARSGAAPLAPLELAARIEAADPRVQVTYLPLAIEPGHTLQAGVMPRTDPATG
                     QPYALGFSQIAVDPATGAVQGRREWGAPSLARLDLMPFIYRLHYSLFLPVYGGINFGF
                     WVMGVVGIVWAIDSLIALVLAFPNLKSWRKSFAFRVRRGGYPLVFDLHRSGGVWVWGL
                     LLVVAITSISMNLAVPVVRPLVSLVSPLAETPYTNPEHFPPVPPGSQILPRERIVEIA
                     RSAGRDAGIAAPPGALLFAPGMNAYAVGFFTLGNDHGDVGLGNAWLYWNAVTGKPVAA
                     QVPGRGSAGDLFMQAQFPLHSGRIAGVAGRVAVSVLGIVIAMLSVTGVCIWVKKRGAR
                     GRAARSARPAVPASSRAAR"
     misc_feature    139565..139645
                     /locus_tag="BCAL0117"
                     /note="HMMPfam hit to PF03929, PepSY-associated TM helix,
                     score 0.18"
                     /inference="protein motif:HMMPfam:PF03929"
     misc_feature    join(139580..139648,139988..140056,140174..140242,
                     140390..140458,140630..140698)
                     /locus_tag="BCAL0117"
                     /note="5 probable transmembrane helices predicted for
                     BCAL0117 by TMHMM2.0 at aa 25-47, 161-183, 223-245,
                     295-317 and 375-397"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    140150..140230
                     /locus_tag="BCAL0117"
                     /note="HMMPfam hit to PF03929, PepSY-associated TM helix,
                     score 0.1"
                     /inference="protein motif:HMMPfam:PF03929"
     misc_feature    140588..140695
                     /locus_tag="BCAL0117"
                     /note="HMMPfam hit to PF03929, PepSY-associated TM helix,
                     score 0.0053"
                     /inference="protein motif:HMMPfam:PF03929"
     CDS             complement(140861..141463)
                     /transl_table=11
                     /gene="tag"
                     /locus_tag="BCAL0118"
                     /product="DNA-3-methyladenine glycosylase I"
                     /EC_number="3.2.2.20"
                     /db_xref="EnsemblGenomes-Gn:BCAL0118"
                     /db_xref="EnsemblGenomes-Tr:CAR50426"
                     /db_xref="GOA:B4EDJ2"
                     /db_xref="InterPro:IPR005019"
                     /db_xref="InterPro:IPR011257"
                     /db_xref="UniProtKB/TrEMBL:B4EDJ2"
                     /protein_id="CAR50426.1"
                     /translation="MSQRCNWVKTEADAHYHDTEWGVPSHDDRHLFEMLILEGAQAGL
                     SWSTILNKRAGYREAFADFDVDAVARFTPTRIEKLLENPGIVRNRAKVESAVTNARAV
                     QRIREEHGSLAAFLWSFVGGTPVQNAWQSYRDAPASTEQSDALSKALKAYGCKFVGST
                     ICYALMQATGMVNDHEAGCPCHARCAALGGKQPARRRKAG"
     misc_feature    complement(140912..141445)
                     /gene="tag"
                     /locus_tag="BCAL0118"
                     /note="HMMPfam hit to PF03352, Methyladenine glycosylase,
                     score 6.7e-93"
                     /inference="protein motif:HMMPfam:PF03352"
     CDS             141605..142486
                     /transl_table=11
                     /locus_tag="BCAL0119"
                     /product="BadF/BadG/BcrA/BcrD ATPase family protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0119"
                     /db_xref="EnsemblGenomes-Tr:CAR50427"
                     /db_xref="InterPro:IPR002731"
                     /db_xref="UniProtKB/TrEMBL:B4EDJ3"
                     /protein_id="CAR50427.1"
                     /translation="MAALLFAIGIDGGGTGTRAVLADRDGRELAQGRGGPSGLGLGIE
                     RAWASISAACADAFTQAGLAFDWSQCALGCGLAGVNNAAWLAAFRAQAPLGALAIESD
                     AYTTVVGAHGGAPGLIVALGTGSIAAALDAAGACRIAGGFGFPSGDEASGAWLGVRAL
                     AYAQQALDGRVPRDAFATALLAETGARDRDALVQWSCDANQTIYARLAPIVFAHRTHP
                     VARALIAQAGDEIGKMIDALDPQHALPVALCGGLADALAPAVPARHAARLRAPLDDSA
                     HGALRLALQALRAAEGA"
     misc_feature    141626..142453
                     /locus_tag="BCAL0119"
                     /note="HMMPfam hit to PF01869, BadF/BadG/BcrA/BcrD ATPase
                     family, score 3.5e-26"
                     /inference="protein motif:HMMPfam:PF01869"
     CDS             142626..143450
                     /transl_table=11
                     /locus_tag="BCAL0120"
                     /product="haloacid dehalogenase-like hydrolase"
                     /db_xref="EnsemblGenomes-Gn:BCAL0120"
                     /db_xref="EnsemblGenomes-Tr:CAR50428"
                     /db_xref="GOA:B4EDJ4"
                     /db_xref="InterPro:IPR000150"
                     /db_xref="InterPro:IPR006379"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR036412"
                     /db_xref="UniProtKB/TrEMBL:B4EDJ4"
                     /protein_id="CAR50428.1"
                     /translation="MYKVIATDLDGTLLNSDHQLDPYTIDTVRRLDRDGVQFVIATGR
                     HYADVAGIRDVLGIRPYLITSNGARVHAPDDTKIHGQDIDAAIVRSLVQPEVVGAHGR
                     VIVNLFTNDGWLIDREAPHLLEFHQDSGFRYEVIDMAAHDGADIAKVLYIGEPADLAV
                     VAEQMRVQFGDTLYVTYSLPDCLEVMTANVSKGRALRTVLARLGVDTGHCIAFGDNMN
                     DIDLLETAGHAFMMNNANPDLIARLPHVPRIGNNFDAGVARHLRTLFSLEDDVVAS"
     misc_feature    142626..143414
                     /locus_tag="BCAL0120"
                     /note="HMMPfam hit to PF05116, Sucrose-6F-phosphate
                     phosphohydrolase, score 7.1e-06"
                     /inference="protein motif:HMMPfam:PF05116"
     misc_feature    142629..143333
                     /locus_tag="BCAL0120"
                     /note="HMMPfam hit to PF00702, haloacid dehalogenase-like
                     hydrolase, score 0.00014"
                     /inference="protein motif:HMMPfam:PF00702"
     misc_feature    142635..142670
                     /note="PS01228 Hypothetical cof family signature 1."
                     /inference="protein motif:Prosite:PS01228"
     misc_feature    142638..143408
                     /locus_tag="BCAL0120"
                     /note="HMMPfam hit to PF08282, haloacid dehalogenase-like
                     hydrolase, score 7.2e-65"
                     /inference="protein motif:HMMPfam:PF08282"
     CDS             complement(143590..144333)
                     /transl_table=11
                     /gene="aqpZ"
                     /locus_tag="BCAL0121"
                     /product="aquaporin Z"
                     /db_xref="EnsemblGenomes-Gn:BCAL0121"
                     /db_xref="EnsemblGenomes-Tr:CAR50429"
                     /db_xref="GOA:B4EDJ5"
                     /db_xref="InterPro:IPR000425"
                     /db_xref="InterPro:IPR022357"
                     /db_xref="InterPro:IPR023271"
                     /db_xref="InterPro:IPR023743"
                     /db_xref="InterPro:IPR034294"
                     /db_xref="UniProtKB/TrEMBL:B4EDJ5"
                     /protein_id="CAR50429.1"
                     /translation="MNLSQRLAAEVFGTFWLVLGGCGSAVLAAAFPGLGIGFAGVALA
                     FGLTVLTMAFAIGHISGCHLNPAVSVGLTVAGRFPARDLAPYIVAQVVGATLGAFVLY
                     LIATGKPGFDVVGSGFATNGFGDRSPGHYSLAASFICEVVMTGFFLFVILGATDKRGV
                     PAGFAPIAIGLCLTLIHLISIPVTNTSVNPARSTGPALFVGGDAIGQLWLFWVAPLIG
                     AVLAGIIYPLVAGRDDAVDLLPASARTSE"
     misc_feature    complement(join(143644..143712,143791..143859,
                     143878..143946,144019..144087,144166..144234,
                     144247..144315))
                     /gene="aqpZ"
                     /locus_tag="BCAL0121"
                     /note="6 probable transmembrane helices predicted for
                     BCAL0121 by TMHMM2.0 at aa 7-29, 34-56, 83-105, 130-152,
                     159-181 and 208-230"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    complement(143656..144333)
                     /gene="aqpZ"
                     /locus_tag="BCAL0121"
                     /note="HMMPfam hit to PF00230, Major intrinsic protein,
                     score 1.1e-41"
                     /inference="protein motif:HMMPfam:PF00230"
     misc_feature    complement(144121..144147)
                     /note="PS00221 MIP family signature."
                     /inference="protein motif:Prosite:PS00221"
     sig_peptide     complement(144250..144333)
                     /gene="aqpZ"
                     /locus_tag="BCAL0121"
                     /note="Signal peptide predicted for BCAL0121 by SignalP
                     2.0 HMM (Signal peptide probability 0.970) with cleavage
                     site probability 0.628 between residues 28 and 29"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    complement(144268..144300)
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
                     /inference="protein motif:Prosite:PS00013"
     CDS             144633..144929
                     /transl_table=11
                     /locus_tag="BCAL0122"
                     /product="histone-like nucleoid-structuring (H-NS)
                     protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0122"
                     /db_xref="EnsemblGenomes-Tr:CAR50430"
                     /db_xref="GOA:B4EDJ6"
                     /db_xref="InterPro:IPR001801"
                     /db_xref="InterPro:IPR027444"
                     /db_xref="InterPro:IPR037150"
                     /db_xref="UniProtKB/TrEMBL:B4EDJ6"
                     /protein_id="CAR50430.1"
                     /translation="MSQYAKLKAQIADLQAQADDVRRQEVAAVIADVQRMIAEYGLTA
                     QDLGFAERARRGRPPKKAPLPPKYRDPKSGATWSGRGKPPNWIVGKNRDRFLIE"
     misc_feature    144636..144923
                     /locus_tag="BCAL0122"
                     /note="HMMPfam hit to PF00816, H-NS histone family, score
                     1.5e-18"
                     /inference="protein motif:HMMPfam:PF00816"
     CDS             complement(145033..146097)
                     /transl_table=11
                     /locus_tag="BCAL0123"
                     /product="putative glycosyltransferase"
                     /db_xref="EnsemblGenomes-Gn:BCAL0123"
                     /db_xref="EnsemblGenomes-Tr:CAR50431"
                     /db_xref="GOA:B4EDJ7"
                     /db_xref="InterPro:IPR001296"
                     /db_xref="InterPro:IPR028098"
                     /db_xref="UniProtKB/TrEMBL:B4EDJ7"
                     /protein_id="CAR50431.1"
                     /translation="MRIAQIAPLYEAVPPKLYGGTERVVSYLTEALVELGHDVTLFAS
                     GDSVTSARLEAAWPRALRLDPSVRDSMAPHMRLLEQVARVAHEFDVLHFHLDYLPFPL
                     MSRLDTPYVTTLHGRLDLPELQPVFDAFPDSPVVSISNNQRKPLPQAAWAGTVYHGLP
                     DTLLTPQPDVKPEYLAFLGRICPEKRVDTAIRIAAQSGLPLKIAAKVDKADADYFKEV
                     IEPLLDQAHVEFIGEINEAQKPAFLSGAKALLFPIDWPEPFGLVMIEAMACGTPVVAF
                     NRGSVPEVIEDGVTGFIVEDVQGAVGALHRIDSLSRPAIRERFDTRFSSKAMARRYVE
                     TYESLCAATKQPALRRVAGA"
     misc_feature    complement(145120..145623)
                     /locus_tag="BCAL0123"
                     /note="HMMPfam hit to PF00534, Glycosyl transferases
                     group, score 4e-22"
                     /inference="protein motif:HMMPfam:PF00534"
     CDS             146762..147082
                     /transl_table=11
                     /gene="flhD"
                     /locus_tag="BCAL0124"
                     /product="flagellar regulon master regulator subunit FlhD"
                     /db_xref="EnsemblGenomes-Gn:BCAL0124"
                     /db_xref="EnsemblGenomes-Tr:CAR50432"
                     /db_xref="GOA:B4EDJ8"
                     /db_xref="InterPro:IPR023559"
                     /db_xref="InterPro:IPR036194"
                     /db_xref="UniProtKB/TrEMBL:B4EDJ8"
                     /protein_id="CAR50432.1"
                     /translation="MSATSEMLSEIKEVNLSYLLLAQRLLREDKAMGMFRMGISQELA
                     DVLANLTLAQTVKLAASNQMLCRFRFDDHALLSSLADKGRSDVVAHAHSAILMAGQQV
                     EGVR"
     misc_feature    146765..147076
                     /gene="flhD"
                     /locus_tag="BCAL0124"
                     /note="HMMPfam hit to PF05247, Flagellar transcriptional
                     activator (FlhD), score 4.9e-47"
                     /inference="protein motif:HMMPfam:PF05247"
     CDS             147175..147729
                     /transl_table=11
                     /gene="flhC"
                     /locus_tag="BCAL0125"
                     /product="flagellar regulon master regulator subunit FlhC"
                     /db_xref="EnsemblGenomes-Gn:BCAL0125"
                     /db_xref="EnsemblGenomes-Tr:CAR50433"
                     /db_xref="GOA:B4EDJ9"
                     /db_xref="InterPro:IPR007944"
                     /db_xref="UniProtKB/TrEMBL:B4EDJ9"
                     /protein_id="CAR50433.1"
                     /translation="MASKSVVIEVKEITLAIELIELGARLQLLEAETSLSRDRLIKLY
                     KELKGVSPPKGMLPFSTDWFMTWQPNIHSSLFYNIYRFMQDHGRCEPIQSIVKAYRLY
                     LEHVNLSGDEAALSLTRAWTLVRFFDSGMLQMTPCTRCGGHFVAHAHDPHQGFVCGLC
                     QPPSRAGKTRKAAAARAELAAAVA"
     misc_feature    147175..147726
                     /gene="flhC"
                     /locus_tag="BCAL0125"
                     /note="HMMPfam hit to PF05280, Flagellar transcriptional
                     activator (FlhC), score 7.2e-129"
                     /inference="protein motif:HMMPfam:PF05280"
     CDS             147910..148770
                     /transl_table=11
                     /gene="motA"
                     /locus_tag="BCAL0126"
                     /product="chemotaxis protein MotA"
                     /db_xref="EnsemblGenomes-Gn:BCAL0126"
                     /db_xref="EnsemblGenomes-Tr:CAR50434"
                     /db_xref="GOA:B4EDK0"
                     /db_xref="InterPro:IPR000540"
                     /db_xref="InterPro:IPR002898"
                     /db_xref="InterPro:IPR022522"
                     /db_xref="UniProtKB/TrEMBL:B4EDK0"
                     /protein_id="CAR50434.1"
                     /translation="MLIIVGTLVTLLSVFGGYALAGGHLGALIQPVEILMIAGAGVGA
                     FILGNGGKTIKATLRVLPTLFKGSKYTKDVYMELMALLYVLLAKARKEGTLTLEADID
                     DPQKSPIFTQYPKILADHHIVEFLTDYLRLMVGGNMNAFEIESLMDEEIETHHAEGEG
                     PAHALMRVGDAMPAFGIVAAVMGVVHTMASADKPPAVLGAMIAQALVGTFLGILLSYG
                     LIGPLASLAEQRVAESTKMFQCIKVTILATLNGYAPAIAVEFGRKVLFSTERPSFSEL
                     EEHVRRVKAK"
     sig_peptide     147910..147972
                     /gene="motA"
                     /locus_tag="BCAL0126"
                     /note="Signal peptide predicted for BCAL0126 by SignalP
                     2.0 HMM (Signal peptide probability 0.988) with cleavage
                     site probability 0.971 between residues 21 and 22"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    join(147913..147981,147994..148062,148420..148479,
                     148522..148590)
                     /gene="motA"
                     /locus_tag="BCAL0126"
                     /note="4 probable transmembrane helices predicted for
                     BCAL0126 by TMHMM2.0 at aa 2-24, 29-51, 171-190 and
                     205-227"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    148522..148575
                     /note="PS01307 Flagellar motor protein motA family
                     signature."
                     /inference="protein motif:Prosite:PS01307"
     CDS             148784..149803
                     /transl_table=11
                     /gene="motB"
                     /locus_tag="BCAL0127"
                     /product="chemotaxis protein MotB"
                     /db_xref="EnsemblGenomes-Gn:BCAL0127"
                     /db_xref="EnsemblGenomes-Tr:CAR50435"
                     /db_xref="GOA:B4EDK1"
                     /db_xref="InterPro:IPR006665"
                     /db_xref="InterPro:IPR025713"
                     /db_xref="InterPro:IPR036737"
                     /db_xref="UniProtKB/TrEMBL:B4EDK1"
                     /protein_id="CAR50435.1"
                     /translation="MSKSKDRAIVVKRVAPAKKGHHGGAWKLAYADFMTAMMAFFLLM
                     WLLSSVTPVQLKGIAEYFNMPLKAAILGSGDRSSQDSSIINGGGRDLSSVDAGTLRRT
                     DGTTSLAERLAKAGDENSRSQAQGAQDRLEQTRLHDLQIKLMAAIEANPTLRQFKQQI
                     RIDSTLMGLRIEIVDTQKRPMFAMSSDRVEPYMRDILREIGKTLNDVPNRIIVQGHTD
                     AVPYAGGEGGYSNWELSADRANASRRELISGGMDEAKVLRVLGLASTQNLNKADPLDP
                     ENRRISVIVLNRKSEEALMRDDATTTTLSADAAGSKLLAQQLGGPTPAVRPVVASAVA
                     VAPKP"
     misc_feature    148865..148924
                     /gene="motB"
                     /locus_tag="BCAL0127"
                     /note="1 probable transmembrane helix predicted for
                     BCAL0127 by TMHMM2.0 at aa 28-47"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    149324..149620
                     /gene="motB"
                     /locus_tag="BCAL0127"
                     /note="HMMPfam hit to PF00691, OmpA family, score 3.2e-26"
                     /inference="protein motif:HMMPfam:PF00691"
     CDS             149828..150205
                     /transl_table=11
                     /gene="cheY"
                     /locus_tag="BCAL0128"
                     /product="chemotaxis two-component response regulator
                     CheY"
                     /db_xref="EnsemblGenomes-Gn:BCAL0128"
                     /db_xref="EnsemblGenomes-Tr:CAR50436"
                     /db_xref="GOA:B4EDK2"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR011006"
                     /db_xref="UniProtKB/TrEMBL:B4EDK2"
                     /protein_id="CAR50436.1"
                     /translation="MIRTILAIDDSATMRALLQATLAQAGYDVTVAPDGEAGFDMAAT
                     APYDLVLTDQNMPRKNGLEVIAALRKLTAYADTPILVLTTEGSDAFKDAARDAGATGW
                     IEKPIDPGVLVELVATLSEPAAS"
     misc_feature    149834..150178
                     /gene="cheY"
                     /locus_tag="BCAL0128"
                     /note="HMMPfam hit to PF00072, Response regulator receiver
                     domain, score 1.7e-30"
                     /inference="protein motif:HMMPfam:PF00072"
     CDS             150239..152506
                     /transl_table=11
                     /gene="cheA"
                     /locus_tag="BCAL0129"
                     /product="chemotaxis two-component sensor kinase CheA"
                     /EC_number="2.7.3.-"
                     /db_xref="EnsemblGenomes-Gn:BCAL0129"
                     /db_xref="EnsemblGenomes-Tr:CAR50437"
                     /db_xref="GOA:B4EE54"
                     /db_xref="InterPro:IPR002545"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR004105"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="InterPro:IPR008207"
                     /db_xref="InterPro:IPR015162"
                     /db_xref="InterPro:IPR035891"
                     /db_xref="InterPro:IPR036061"
                     /db_xref="InterPro:IPR036097"
                     /db_xref="InterPro:IPR036641"
                     /db_xref="InterPro:IPR036890"
                     /db_xref="InterPro:IPR037006"
                     /db_xref="UniProtKB/TrEMBL:B4EE54"
                     /protein_id="CAR50437.1"
                     /translation="MTLDITQFYQTFFDEADELLAQMEQLLLNLDVDAPDPEDLAAIF
                     RAAHSIKGGAATFGFSALTDTTHILESLLDRARNHELTLTKDMVDVFLETKDVLSDQL
                     VDYRASAEPDAAAAAAICAKLERLKAESGAGAPAAAEAAPVAPVAAAAVAPAAEPAAA
                     GDRAPDHVVEQAVAAAHPAADAGAGGPHLKITLVGVDAKDQALLTEELGNLGRIVGRE
                     EAGADLSLWVESDVPSDDIVAVCCFVIDESQIRVAHGTAPAAQAAPAAAQDAAAAVAA
                     EPAAAPPPARVEVFAPQAAAAQPAASAPAEPAAAAAAQPQPPSPSQQHAQPQPAEHAA
                     PAAAHHDDKRARPAAAAAAGAEGSSIRVGVEKVDQLINLVGELVITQAMLAETASAFD
                     PALHDRLFNGMAQLERNARDLQEAVMSIRMMPMDYVFSRFPRLVRDLAGKLGKQVELV
                     TFGQATELDKSLIERIIDPLTHLVRNSLDHGIETVDKRVAAGKDAVGQLVLSAAHHGG
                     NIVIEVSDDGAGLNRERILAKAAKQGMQIAENISDDEVWQLIFAPGFSTAETVTDVSG
                     RGVGMDVVKRNIQSMGGHVEITSLAGRGTTTRIVLPLTLAILDGMSVKVGSEIFILPL
                     NFVMESLQPSNDDIYTVGNGERVVRVRGEYLPLVALHEVFSVEDARTDPTQGIVTIME
                     TEGRRFAMLIDELVGQQQVVVKNLETNYRKVHGISAATILGDGSVALIVDVAALNRET
                     RATHGARAGAELAVF"
     misc_feature    150257..150562
                     /gene="cheA"
                     /locus_tag="BCAL0129"
                     /note="HMMPfam hit to PF01627, Hpt domain, score 4.6e-17"
                     /inference="protein motif:HMMPfam:PF01627"
     misc_feature    150272..150298
                     /note="PS00039 DEAD-box subfamily ATP-dependent helicases
                     signature."
                     /inference="protein motif:Prosite:PS00039"
     misc_feature    151307..151498
                     /gene="cheA"
                     /locus_tag="BCAL0129"
                     /note="HMMPfam hit to PF02895, Signal transducing
                     histidine kinase, hom, score 2.7e-24"
                     /inference="protein motif:HMMPfam:PF02895"
     misc_feature    151631..152050
                     /gene="cheA"
                     /locus_tag="BCAL0129"
                     /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
                     gyrase B-, and HS, score 2.6e-26"
                     /inference="protein motif:HMMPfam:PF02518"
     misc_feature    152063..152449
                     /gene="cheA"
                     /locus_tag="BCAL0129"
                     /note="HMMPfam hit to PF01584, CheW-like domain, score
                     1.8e-24"
                     /inference="protein motif:HMMPfam:PF01584"
     CDS             152554..153069
                     /transl_table=11
                     /gene="cheW"
                     /locus_tag="BCAL0130"
                     /product="chemotaxis protein CheW"
                     /db_xref="EnsemblGenomes-Gn:BCAL0130"
                     /db_xref="EnsemblGenomes-Tr:CAR50438"
                     /db_xref="GOA:B4EE55"
                     /db_xref="InterPro:IPR002545"
                     /db_xref="InterPro:IPR036061"
                     /db_xref="InterPro:IPR039315"
                     /db_xref="UniProtKB/TrEMBL:B4EE55"
                     /protein_id="CAR50438.1"
                     /translation="MINPAAANAATSRRDAEQGDATGQEFLVFTLGDEEYGIDILKVQ
                     EIRGYDSVTRIANAPEFIKGVINLRGIIVPIVDMRIKFHLGRVEYDHQTVVIILNVSN
                     RVVGMVVDGVSDVLTLQTDQIMPAPEFGATLTTEYLTGLGTVDGRMLILMDIEKLMSS
                     REMALIETLGG"
     misc_feature    152626..153039
                     /gene="cheW"
                     /locus_tag="BCAL0130"
                     /note="HMMPfam hit to PF01584, CheW-like domain, score
                     5.9e-35"
                     /inference="protein motif:HMMPfam:PF01584"
     CDS             153107..155065
                     /transl_table=11
                     /gene="tar"
                     /locus_tag="BCAL0131"
                     /product="methyl-accepting chemotaxis protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0131"
                     /db_xref="EnsemblGenomes-Tr:CAR50439"
                     /db_xref="GOA:B4EE56"
                     /db_xref="InterPro:IPR003122"
                     /db_xref="InterPro:IPR003660"
                     /db_xref="InterPro:IPR004089"
                     /db_xref="InterPro:IPR004090"
                     /db_xref="InterPro:IPR035440"
                     /db_xref="UniProtKB/TrEMBL:B4EE56"
                     /protein_id="CAR50439.1"
                     /translation="MLHNWSIRTTLTAVGLILVCLAAAVGGLGLYALNHASRSLDEIA
                     HVDLPAIHTLDDTAAYLLRSRVALDRFRTLTEAGNAADAAKVLDRAQELYAKSNQNWQ
                     TFQSTPKLGVEQALVDELTARYTTIMKEGVEPEFAAARAGDMAAYHAIADAKISPMFV
                     AFDQTAAAVIAALQKRAEERQAATQSQISMMIALIAAGIAIAFVVVIAIRFALRGLIV
                     KPLEDAIAHFERIAGGDLTQPVNVFSTNEIGRLFGGIKRMQDAVTTMVQAVHRGTESI
                     DVGAREIATGNIDLSQRTEEQAASLQETASSMEQLTGTVRQNAENARQASQLAVNASD
                     IATQGGDVVGQVVSTMQDIAVSSGKVVDIIGTIEGIAFQTNILALNAAVEAARAGEQG
                     RGFAVVAGEVRSLAQRSASAAKEIKQLIGDSAEKVDSGSALVARAGATMEEIVQAVRR
                     VTDIMGEISAASDEQSTGIEQVNRAVGQMDAVTQQNAALVEQAAAAAASLEEQTRQMK
                     AIVSGWRVAGGIVLAPARSVARPVAHEPAALPSDARHDAPVAALPAPQAAAQPAARRA
                     APASRAAAASADHEPKRAADATARTQKDAPASRGGAAAGGYGPRLAKTAAATDKPAAK
                     PALVRPALNGEKPALAAAGTSDDDWETF"
     sig_peptide     153107..153178
                     /gene="tar"
                     /locus_tag="BCAL0131"
                     /note="Signal peptide predicted for BCAL0131 by SignalP
                     2.0 HMM (Signal peptide probability 0.997) with cleavage
                     site probability 0.300 between residues 24 and 25"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    join(153134..153202,153674..153742)
                     /gene="tar"
                     /locus_tag="BCAL0131"
                     /note="2 probable transmembrane helices predicted for
                     BCAL0131 by TMHMM2.0 at aa 10-32 and 190-212"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    153689..153898
                     /gene="tar"
                     /locus_tag="BCAL0131"
                     /note="HMMPfam hit to PF00672, HAMP domain, score 6.7e-13"
                     /inference="protein motif:HMMPfam:PF00672"
     misc_feature    153989..154657
                     /gene="tar"
                     /locus_tag="BCAL0131"
                     /note="HMMPfam hit to PF00015, Methyl-accepting chemotaxis
                     protein (MCP) s, score 3.8e-99"
                     /inference="protein motif:HMMPfam:PF00015"
     CDS             155069..156061
                     /transl_table=11
                     /gene="cheR"
                     /locus_tag="BCAL0132"
                     /product="chemotaxis protein methyltransferase"
                     /EC_number="2.1.1.80"
                     /db_xref="EnsemblGenomes-Gn:BCAL0132"
                     /db_xref="EnsemblGenomes-Tr:CAR50440"
                     /db_xref="GOA:B4EE57"
                     /db_xref="InterPro:IPR000780"
                     /db_xref="InterPro:IPR022641"
                     /db_xref="InterPro:IPR022642"
                     /db_xref="InterPro:IPR026024"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="InterPro:IPR036804"
                     /db_xref="UniProtKB/TrEMBL:B4EE57"
                     /protein_id="CAR50440.1"
                     /translation="MQHARAPFRPDAPDASPRAGEPGRDFAFTGADFARIRALIHQRA
                     GISLSEHKRDMAYSRLARRLRARGLDTFRDYLDLLEQEDDPLEWEAFTNALTTNLTAF
                     FRESHHFPILSEFVKGRPAPVSVWCSAASTGEEPYSIAITLIEALGETAARSASILAT
                     DLDTQVLAKAEAGIYTYDQVKHLSPERLKRFFLKGTGAQAGRVKVRPELRAMIRFEQL
                     NLTDADYGIGKPFDAIFCRNVMIYFDKPTQGQVLSRFEPLVKPGGLLFAGHSENFTYV
                     TQAFRLRGQTVYELTRDAAQGARSRGAQASAAAAMSSPVRARAAGGAPAYGERG"
     misc_feature    155360..155938
                     /gene="cheR"
                     /locus_tag="BCAL0132"
                     /note="HMMPfam hit to PF01739, CheR methyltransferase, SAM
                     binding domain, score 1.8e-72"
                     /inference="protein motif:HMMPfam:PF01739"
     CDS             156058..156816
                     /transl_table=11
                     /gene="cheD"
                     /locus_tag="BCAL0133"
                     /product="putative chemoreceptor glutamine deamidase cheD"
                     /db_xref="EnsemblGenomes-Gn:BCAL0133"
                     /db_xref="EnsemblGenomes-Tr:CAR50441"
                     /db_xref="GOA:B4EE58"
                     /db_xref="InterPro:IPR005659"
                     /db_xref="InterPro:IPR011324"
                     /db_xref="InterPro:IPR038592"
                     /db_xref="UniProtKB/TrEMBL:B4EE58"
                     /protein_id="CAR50441.1"
                     /translation="MSALPIATNRYFDNHFERPGVKLLPNEFYTTSEDMVLMTVLGSC
                     VAACLHDPYAGIGGMNHFMLPDDGADPGAAASESMRYGAYAMEVLINELIKAGGRRER
                     FEAKVFGGAAVLAGMTTINIGDRNADFVRRYLALERIRITAEDLQGVHPRKVAFMPHS
                     GRAMVKKLRLQVPGVTEREAALAREADRLRTARTRAHVELFAAKRPAAPQPARPRIEL
                     FGARGAAPAGSGGARTAGPQGSPYAANLSRKQEA"
     misc_feature    156244..156582
                     /gene="cheD"
                     /locus_tag="BCAL0133"
                     /note="HMMPfam hit to PF03975, CheD, score 9.6e-40"
                     /inference="protein motif:HMMPfam:PF03975"
     CDS             156813..157904
                     /transl_table=11
                     /gene="cheB1"
                     /locus_tag="BCAL0134"
                     /product="chemotaxis response regulator protein-glutamate
                     methylesterase 1"
                     /EC_number="3.1.1.61"
                     /db_xref="EnsemblGenomes-Gn:BCAL0134"
                     /db_xref="EnsemblGenomes-Tr:CAR50442"
                     /db_xref="GOA:B4EE59"
                     /db_xref="InterPro:IPR000673"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR008248"
                     /db_xref="InterPro:IPR011006"
                     /db_xref="InterPro:IPR035909"
                     /db_xref="UniProtKB/TrEMBL:B4EE59"
                     /protein_id="CAR50442.1"
                     /translation="MTAVQKIKVLCVDDSALIRSLMTEIINSQPDMTVVATAPDPLVA
                     RELIKQHNPDVLTLDVEMPRMDGLDFLEKLMRLRPMPVVMVSSLTERGSEITLRALEL
                     GAVDFVTKPRVGIRDGMLDYAEKLADKIRAASRARVRQAPQPQAAARTADSAAAAPMI
                     NNPLVSTEKLIIIGASTGGTEAIREVLTPLPPDAPAVLIAQHMPPGFTKSFAQRLNGL
                     CRIAVKEAEHGERVLPGHAYIAPGHAHLLLARSGANYIAQLSDEPPVNRHRPSVDVLF
                     RSAATHAGKNAIGVILTGMGRDGAAGLLEMKRAGAHTFAQDEASCIVFGMPREAIALG
                     GADEIAPLADMSRRVMARLATMGDRVQRV"
     misc_feature    156831..157160
                     /gene="cheB1"
                     /locus_tag="BCAL0134"
                     /note="HMMPfam hit to PF00072, Response regulator receiver
                     domain, score 3.9e-30"
                     /inference="protein motif:HMMPfam:PF00072"
     misc_feature    157320..157868
                     /gene="cheB1"
                     /locus_tag="BCAL0134"
                     /note="HMMPfam hit to PF01339, CheB methylesterase, score
                     5.1e-107"
                     /inference="protein motif:HMMPfam:PF01339"
     CDS             157972..158367
                     /transl_table=11
                     /gene="cheY"
                     /locus_tag="BCAL0135"
                     /product="chemotaxis protein CheY"
                     /db_xref="EnsemblGenomes-Gn:BCAL0135"
                     /db_xref="EnsemblGenomes-Tr:CAR50443"
                     /db_xref="GOA:B4EE60"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR011006"
                     /db_xref="UniProtKB/TrEMBL:B4EE60"
                     /protein_id="CAR50443.1"
                     /translation="MDKSMKILVVDDFPTMRRIVRNLLKELGYSNVDEAEDGLAGLAR
                     LRGGGYDFVISDWNMPNLDGLAMLKEIRADATLTHLPVLMVTAESKKENIIAAAQAGA
                     SGYVVKPFTAATLDEKLNKIIDKMAKAGS"
     misc_feature    157984..158331
                     /gene="cheY"
                     /locus_tag="BCAL0135"
                     /note="HMMPfam hit to PF00072, Response regulator receiver
                     domain, score 2.1e-43"
                     /inference="protein motif:HMMPfam:PF00072"
     CDS             158370..159101
                     /transl_table=11
                     /gene="cheZ"
                     /locus_tag="BCAL0136"
                     /product="chemotaxis protein CheZ"
                     /db_xref="EnsemblGenomes-Gn:BCAL0136"
                     /db_xref="EnsemblGenomes-Tr:CAR50444"
                     /db_xref="GOA:B4EE61"
                     /db_xref="InterPro:IPR007439"
                     /db_xref="UniProtKB/TrEMBL:B4EE61"
                     /protein_id="CAR50444.1"
                     /translation="MNEPIHAALAGAAINADGHAEGADYASDRILARIGHVTRTLRDS
                     MRELGLDKHVERAAEAVPDARDRLRYVATMTEQAAVRVLNAIEIAKPMQERIQNEAEA
                     LDARWAQWYAAPIEHADVRELMDDTRTFLRTLPESTSATRAQLLEIMLAQDFQDLTGQ
                     VIKKIMDMVYLIEQQLLTVLVENIAPERREQFAATAAAFAAEQMSATGSPESLLNGPQ
                     IAPEGKSDVVQDQGQVDDLLASLGF"
     misc_feature    158430..159098
                     /gene="cheZ"
                     /locus_tag="BCAL0136"
                     /note="HMMPfam hit to PF04344, Chemotaxis phosphatase,
                     CheZ, score 3.2e-69"
                     /inference="protein motif:HMMPfam:PF04344"
     CDS             159361..159864
                     /transl_table=11
                     /locus_tag="BCAL0137"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0137"
                     /db_xref="EnsemblGenomes-Tr:CAR50445"
                     /db_xref="InterPro:IPR021267"
                     /db_xref="UniProtKB/TrEMBL:B4EE62"
                     /protein_id="CAR50445.1"
                     /translation="MKLKRLGWTVAHATAAMSVLWAVHAHAELGGAPMSPPADDQAAT
                     VRALQRAMRSADGVQTSTAAYTVREITLGSGTVIHEYTSAAGSVFGLAWRGPTMPDLA
                     SLLGSYFPQYTAGVQAAHQARGWRAPVAVETSGLVIRTGGHMGAFSGQAWLPSALPAG
                     VAGTDIQ"
     CDS             join(159881..160021,160025..161119)
                     /pseudo
                     /transl_table=11
                     /locus_tag="BCAL0138"
                     /product="Gly/Ala/Ser-rich lipoprotein (pseudogene)"
                     /note="CDS contains a nonsense mutation (amber) after
                     codon 47. Similar to Burkholderia pseudomallei
                     Gly/Ala/Ser-rich lipoprotein UniProt:Q63PS6
                     (EMBL:BX571965) (434 aa) fasta scores: E()=2.6e-79,
                     55.909% id in 440 aa"
                     /db_xref="PSEUDO:CAR50446.1"
     CDS             161283..161780
                     /transl_table=11
                     /locus_tag="BCAL0139"
                     /product="putative 3-demethylubiquinone-9
                     3-methyltransferase"
                     /db_xref="EnsemblGenomes-Gn:BCAL0139"
                     /db_xref="EnsemblGenomes-Tr:CAR50447"
                     /db_xref="GOA:B4EE64"
                     /db_xref="InterPro:IPR009725"
                     /db_xref="InterPro:IPR028973"
                     /db_xref="InterPro:IPR029068"
                     /db_xref="UniProtKB/TrEMBL:B4EE64"
                     /protein_id="CAR50447.1"
                     /translation="MTQRIQRITPFLWFDRDAEAAAAFYVSVFDNARIVHVARYGKAG
                     AHASGNAEGAVMTVAFELDGQAFVALNGGPVFQMTPAVSFVVNCRDQDEIDRYWARLS
                     EGGDERAQQCGWLRDRFGVSWQVVPVQMAELMTGDPARAERVMAQVMTMKKLDLDALQ
                     RAAAG"
     misc_feature    161298..161660
                     /locus_tag="BCAL0139"
                     /note="HMMPfam hit to PF06983, 3-demethylubiquinone-9
                     3-methyltransfera, score 2e-71"
                     /inference="protein motif:HMMPfam:PF06983"
     CDS             162210..163409
                     /transl_table=11
                     /gene="flhB"
                     /locus_tag="BCAL0140"
                     /product="flagellar biosynthetic protein FlhB"
                     /db_xref="EnsemblGenomes-Gn:BCAL0140"
                     /db_xref="EnsemblGenomes-Tr:CAR50448"
                     /db_xref="GOA:B4EE65"
                     /db_xref="InterPro:IPR006135"
                     /db_xref="InterPro:IPR006136"
                     /db_xref="InterPro:IPR029025"
                     /db_xref="UniProtKB/TrEMBL:B4EE65"
                     /protein_id="CAR50448.1"
                     /translation="MADESDLDKTEAATPRRREKAREEGQVARSRELASFALLAAGFY
                     GAWLLAGPSGAHLQAMLRGAFTFDRATAFDTHRMLSAAGSASLEGFAALLPLLALTGV
                     AALLAPMALGGWLISQKTFELKFDRLNPISGLGRIFSIQGPIQLGMSIAKTLVVGGIG
                     GIAIWRSKDELLGLATQPLGAALPDALHLVAVCCGTTVAGMLVVAGLDVPYQLWQYNK
                     KLRMTKEEVKREHRENEGDPHVKGRIRQQQRAIARRRMMAAVPKADVVVTNPTHFAVA
                     LQYTDGEMRAPKVVAKGVNLVAARIRELAAEHNVPLLEAPPLARALYHNVELEREIPG
                     SLYSAVAEVLAWVYQLKRFRSEGGAFPAVPVDLDVPAELDKGTSVAADDEREEAEDTL
                     GKRGTAA"
     misc_feature    162225..163253
                     /gene="flhB"
                     /locus_tag="BCAL0140"
                     /note="HMMPfam hit to PF01312, FlhB HrpN YscU SpaS Family,
                     score 2.9e-140"
                     /inference="protein motif:HMMPfam:PF01312"
     misc_feature    join(162306..162374,162489..162557,162645..162704,
                     162762..162830)
                     /gene="flhB"
                     /locus_tag="BCAL0140"
                     /note="4 probable transmembrane helices predicted for
                     BCAL0140 by TMHMM2.0 at aa 33-55, 94-116, 146-165 and
                     185-207"
                     /inference="protein motif:TMHMM:2.0"
     CDS             163406..165508
                     /transl_table=11
                     /gene="flhA"
                     /locus_tag="BCAL0141"
                     /product="flagellar biosynthesis protein FlhA"
                     /db_xref="EnsemblGenomes-Gn:BCAL0141"
                     /db_xref="EnsemblGenomes-Tr:CAR50449"
                     /db_xref="GOA:B4EE66"
                     /db_xref="InterPro:IPR001712"
                     /db_xref="InterPro:IPR006301"
                     /db_xref="InterPro:IPR025505"
                     /db_xref="InterPro:IPR042193"
                     /db_xref="InterPro:IPR042194"
                     /db_xref="InterPro:IPR042196"
                     /db_xref="UniProtKB/TrEMBL:B4EE66"
                     /protein_id="CAR50449.1"
                     /translation="MSTPTTGLFAKRPNLLAGTNLRALAGPILICMILGMMILPLPPM
                     LLDLLFTFNIALSVMVLLVSMYTMKPLDFAAFPSVLLFSTLLRLSLNVASTRVVLLEG
                     HTGPDAAGQVIEAFGHFLVGGNFAVGIVVFVILMIINFMVITKGAGRIAEVSARFTLD
                     AMPGKQMAIDADLNAGLINEEQARKRRLAVSQEAEFYGSMDGASKFVRGDAIAGLIIM
                     AINVIGGLIVGMVQHDMSFAAAGTNYTLLTIGDGLVAQIPSLVISTAAGVIVSRVATD
                     EDIGTQITGQLFTNPRVLTITGAIIVLMGLIPGMPHFAFLALGGGAIWLARTQTRRAA
                     ARKAAGDVTDIAPPAVLPADSHEATWDDVQLIDPLGLEVGYRLIPLVDKNSDGELLKR
                     IKSIRKKFAQEIGFLPPVIHIRDNLELRPNAYRIALKGVEIGAGEVFPGQWLAINPGQ
                     VTAALPGAVTQDPAFGLPAVWIDVALREQAQVYGYTVVDASTVVATHLNHLVVQHAAE
                     LLGRQEVQALVERTGKDAPSLVEDLVPKTISLTTLQKVLQNLLEEGVPIRDMRTILEA
                     VSEHAGRGDAFEITAAVRLSLGRAITQQWYPGNGEMQVMGLDANLERVLSQALATGAN
                     PGLEPGLAHNLLTGTQQAMLRQQNLGLPPVLLVQHALRAMLARFLRRSLPQLKVLSYA
                     EVPDTRTIKVVNVIGGSA"
     misc_feature    join(163466..163525,163535..163603,163637..163705,
                     163763..163831,164036..164104,164162..164230,
                     164291..164359)
                     /gene="flhA"
                     /locus_tag="BCAL0141"
                     /note="7 probable transmembrane helices predicted for
                     BCAL0141 by TMHMM2.0 at aa 21-40, 44-66, 78-100, 120-142,
                     211-233, 253-275 and 296-318"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    163499..165475
                     /gene="flhA"
                     /locus_tag="BCAL0141"
                     /note="HMMPfam hit to PF00771, FHIPEP family, score 0"
                     /inference="protein motif:HMMPfam:PF00771"
     misc_feature    163850..163921
                     /note="PS00994 Bacterial export FHIPEP family signature."
                     /inference="protein motif:Prosite:PS00994"
     misc_feature    164276..164323
                     /note="PS00038 Myc-type, 'helix-loop-helix' dimerization
                     domain signature."
                     /inference="protein motif:Prosite:PS00038"
     CDS             165505..167304
                     /transl_table=11
                     /locus_tag="BCAL0142"
                     /product="putative flagellar biosynthesis protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0142"
                     /db_xref="EnsemblGenomes-Tr:CAR50450"
                     /db_xref="GOA:B4EE67"
                     /db_xref="InterPro:IPR000897"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR020006"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:B4EE67"
                     /protein_id="CAR50450.1"
                     /translation="MNIRKFTGATSRDALRLVREALGADAVVLSNRTLDDGSVEIVAL
                     ADSDLAAVAPPAARPRVATSRVPESVPAAAVPGIVSRPGIAPRPAVNPYAAGEGGLPD
                     VFSSVFGASADAHDADAHSPSSDADAPAAAAPSIVAPAAGTPAPGSPAAPSEPAPWLV
                     EHAKRLTQQRDALIARAQAPVEPQPSAPAPRAAASATPPDWARDIVRDAERRMPAAGS
                     LAAGSPAAGSPAAAKRASDTGAAYAGRASERTRLSADTAAAVADAVKSRLERIVNDTV
                     MQELGELRGMMQEQFDSLMWHDRQRRSAVHGALTKHLFAAGFSAQLVRMLVDNLPSGD
                     GAQTFGQAAEWAQSVLASNLPVLDSEDALMERGGVFALMGPTGVGKTTTTAKLAARCV
                     MRFGASKVALLTTDSYRIGGHEQLRIFGKILGVPVHAVKDAGDLALALSELRNKHIVL
                     IDTIGMSQRDRAVSDQIAMLHGANAPVQRLLLLNATSHGDTLNEVVQAYRSAGEHPDL
                     AGCILTKLDEATHLGGVLDTVIRYKLPVHYVSTGQKVPENLYVASTKFLLKSAFCVPR
                     DGSPFVPQDEDMPTLLSALTARSTAELHEVRFG"
     misc_feature    166600..167193
                     /locus_tag="BCAL0142"
                     /note="HMMPfam hit to PF00448, SRP54-type protein, GTPase
                     domain, score 2.6e-23"
                     /inference="protein motif:HMMPfam:PF00448"
     misc_feature    166624..166647
                     /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
                     /inference="protein motif:Prosite:PS00017"
     CDS             167297..168115
                     /transl_table=11
                     /locus_tag="BCAL0143"
                     /product="putative flagellar biosynthesis protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0143"
                     /db_xref="EnsemblGenomes-Tr:CAR50451"
                     /db_xref="InterPro:IPR002586"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:B4EE68"
                     /protein_id="CAR50451.1"
                     /translation="MDKRIIDQAEGLRRLLAGRASRIVAVTGGPAGVGCTSTVVNLAA
                     ALASLGKDVLVVDERADVHSASATLAGAWLRDGERTRVAAGFGLCGAARLARAGYSDA
                     QLSDFIDGPADIVLVDAQLGADGSFSALAREAHDVLVVTRVAAQAITEAYACMKRLHF
                     AHAFAQFRVLTNQVGSHADAKTAFDNLAGVASRYLTVSIADAGCVSADPLVEHARDLM
                     HAVVDAFPSSPAARDYRQIAADLLYWPMRPRSGAGRAVHAGGKPSYEAGAAHAA"
     misc_feature    167369..167401
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
                     /inference="protein motif:Prosite:PS00013"
     CDS             168141..168872
                     /transl_table=11
                     /gene="fliA"
                     /locus_tag="BCAL0144"
                     /product="RNA polymerase sigma factor for flagellar
                     regulon FliA"
                     /db_xref="EnsemblGenomes-Gn:BCAL0144"
                     /db_xref="EnsemblGenomes-Tr:CAR50452"
                     /db_xref="GOA:B4EE69"
                     /db_xref="InterPro:IPR000943"
                     /db_xref="InterPro:IPR007624"
                     /db_xref="InterPro:IPR007627"
                     /db_xref="InterPro:IPR007630"
                     /db_xref="InterPro:IPR012845"
                     /db_xref="InterPro:IPR013324"
                     /db_xref="InterPro:IPR013325"
                     /db_xref="InterPro:IPR014284"
                     /db_xref="InterPro:IPR028617"
                     /db_xref="UniProtKB/TrEMBL:B4EE69"
                     /protein_id="CAR50452.1"
                     /translation="MYNAQGKMSQADVLAQYAPLVRRLGLQLVAKMPASVDLDDLIQA
                     GMIGLMDAAGRYKEDQGAQFETYATQRIRGAMLDELRSNDWLPRSLRKTSREVEHAVH
                     QVEQHLGRSASETEIAQHLNMPLDEYQGMLQDLHGSQLIYYEDFDRAADDEPFLDRYR
                     VDHADPLSALLDEHLREALVEAIERLPEREKLLMSLYYERGLNLREIGAVLEVSESRV
                     CQLHSQAVARLRARLREQAWVGAES"
     misc_feature    168177..168398
                     /gene="fliA"
                     /locus_tag="BCAL0144"
                     /note="HMMPfam hit to PF04542, Sigma-70 region, score
                     1.9e-18"
                     /inference="protein motif:HMMPfam:PF04542"
     misc_feature    168258..168299
                     /note="PS00715 Sigma-70 factors family signature 1."
                     /inference="protein motif:Prosite:PS00715"
     misc_feature    168399..168641
                     /gene="fliA"
                     /locus_tag="BCAL0144"
                     /note="HMMPfam hit to PF04539, Sigma-70 region, score
                     2.1e-09"
                     /inference="protein motif:HMMPfam:PF04539"
     misc_feature    168666..168827
                     /gene="fliA"
                     /locus_tag="BCAL0144"
                     /note="HMMPfam hit to PF08281, Sigma-70, region, score
                     5.4e-07"
                     /inference="protein motif:HMMPfam:PF08281"
     misc_feature    168684..168833
                     /gene="fliA"
                     /locus_tag="BCAL0144"
                     /note="HMMPfam hit to PF04545, Sigma-70, region, score
                     7.1e-17"
                     /inference="protein motif:HMMPfam:PF04545"
     misc_feature    168744..168809
                     /note="Predicted helix-turn-helix motif with score
                     1243.000, SD 3.42 at aa 202-223, sequence
                     LNLREIGAVLEVSESRVCQLHS"
                     /inference="protein motif:helixturnhelix:EMBOSS"
     misc_feature    168747..168827
                     /note="PS00716 Sigma-70 factors family signature 2."
                     /inference="protein motif:Prosite:PS00716"
     CDS             169124..170542
                     /transl_table=11
                     /gene="ahcY"
                     /locus_tag="BCAL0145"
                     /product="adenosylhomocysteinase"
                     /EC_number="3.3.1.1"
                     /db_xref="EnsemblGenomes-Gn:BCAL0145"
                     /db_xref="EnsemblGenomes-Tr:CAR50453"
                     /db_xref="GOA:B4EE70"
                     /db_xref="InterPro:IPR000043"
                     /db_xref="InterPro:IPR015878"
                     /db_xref="InterPro:IPR020082"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="InterPro:IPR042172"
                     /db_xref="UniProtKB/TrEMBL:B4EE70"
                     /protein_id="CAR50453.1"
                     /translation="MNAIIDSKASTDYVVADMALAGWGRKELNIAETEMPGLVQIRDE
                     YKAQQPLKGARIAGSLHMTIQTGVLIETLKALGADVRWASCNIFSTQDHAAAAIVEAG
                     TPVFAFKGESLDEYWEFSHRIFEWPNGEFANMILDDGGDATLLLILGSKAEKDRSVIA
                     KPTNEEEVALYKSIAKHLDVDATWYSKRLAHIKGVTEETTTGVHRLYQMEKDGRLPFP
                     AFNVNDSVTKSKFDNLYGCRESLVDGIKRATDVMIAGKVAVVAGYGDVGKGCAQSLRG
                     LGATVWVTEIDPICALQAAMEGYRVVTMEYAADKADIFVTATGNYHVINHDHMKAMRH
                     NAIVCNIGHFDSEIDVASTRQYQWENIKPQVDHIIFPDGKRVILLAEGRLVNLGCATG
                     HPSFVMSNSFANQTLAQIELFTRGEQYENKVYVLPKHLDEKVARLHLARIGANLSVLS
                     DEQAAYIGVQKDGPFKPNHYRY"
     misc_feature    169154..170536
                     /gene="ahcY"
                     /locus_tag="BCAL0145"
                     /note="HMMPfam hit to PF05221, S-adenosyl-L-homocysteine
                     hydrolase, score 3.7e-193"
                     /inference="protein motif:HMMPfam:PF05221"
     misc_feature    169373..169417
                     /note="PS00738 S-adenosyl-L-homocysteine hydrolase
                     signature 1."
                     /inference="protein motif:Prosite:PS00738"
     misc_feature    169820..170299
                     /gene="ahcY"
                     /locus_tag="BCAL0145"
                     /note="HMMPfam hit to PF00670, S-adenosyl-L-homocysteine
                     hydrolase, NA, score 1.3e-111"
                     /inference="protein motif:HMMPfam:PF00670"
     misc_feature    169886..169936
                     /note="PS00739 S-adenosyl-L-homocysteine hydrolase
                     signature 2."
                     /inference="protein motif:Prosite:PS00739"
     CDS             170651..171004
                     /transl_table=11
                     /locus_tag="BCAL0146"
                     /product="putative membrane protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0146"
                     /db_xref="EnsemblGenomes-Tr:CAR50454"
                     /db_xref="GOA:B4EE71"
                     /db_xref="InterPro:IPR007165"
                     /db_xref="UniProtKB/TrEMBL:B4EE71"
                     /protein_id="CAR50454.1"
                     /translation="MSVILTWVINALALLIITYLVPSIHIKSFGTALIIAVVLGLINT
                     VIRPVLILLTLPVTIVTLGVFILVVNALCFWFASSLLKGFEVSGFWSAFFGSILYSIV
                     SWLLSALIFGQRDIG"
     misc_feature    170651..170992
                     /locus_tag="BCAL0146"
                     /note="HMMPfam hit to PF04020, Membrane protein of unknown
                     function, score 6.6e-37"
                     /inference="protein motif:HMMPfam:PF04020"
     misc_feature    join(170660..170728,170747..170815,170825..170893,
                     170912..170980)
                     /locus_tag="BCAL0146"
                     /note="4 probable transmembrane helices predicted for
                     BCAL0146 by TMHMM2.0 at aa 4-26, 33-55, 59-81 and 88-110"
                     /inference="protein motif:TMHMM:2.0"
     CDS             171035..171865
                     /transl_table=11
                     /gene="metF"
                     /locus_tag="BCAL0147"
                     /product="5,10-methylenetetrahydrofolate reductase"
                     /EC_number="1.7.99.5"
                     /db_xref="EnsemblGenomes-Gn:BCAL0147"
                     /db_xref="EnsemblGenomes-Tr:CAR50455"
                     /db_xref="GOA:B4EE72"
                     /db_xref="InterPro:IPR003171"
                     /db_xref="InterPro:IPR004620"
                     /db_xref="InterPro:IPR029041"
                     /db_xref="UniProtKB/TrEMBL:B4EE72"
                     /protein_id="CAR50455.1"
                     /translation="MKPIELSFEFFPPKTADGVEKLRATRAQLLPLKPKFVSVTFGAG
                     GSTQQGTLDTVLDMQKDGLEAAPHLSCIGSSRDSLRAILDQYRSHGIRHIVALRGDLP
                     SGMGEVGELRYASELVSFIRAEHGDWFHIEVAGYPEYHPQSRSPKADLENFARKVKAG
                     ANSAITQYFFNADAYFRFVDDARKLGVDVPIVPGIMPITNFSQLMRFSEMCGAEVPRW
                     VARRLESFGDDRESIRAFGADVVTSLCQRLIDAGVPGLHFYTLNAATATRTICERLAV
                     "
     misc_feature    171038..171859
                     /gene="metF"
                     /locus_tag="BCAL0147"
                     /note="HMMPfam hit to PF02219, Methylenetetrahydrofolate
                     reductase, score 1.4e-107"
                     /inference="protein motif:HMMPfam:PF02219"
     CDS             complement(171968..173446)
                     /transl_table=11
                     /locus_tag="BCAL0148"
                     /product="putative amidase"
                     /db_xref="EnsemblGenomes-Gn:BCAL0148"
                     /db_xref="EnsemblGenomes-Tr:CAR50456"
                     /db_xref="GOA:B4EE73"
                     /db_xref="InterPro:IPR000120"
                     /db_xref="InterPro:IPR020556"
                     /db_xref="InterPro:IPR023631"
                     /db_xref="InterPro:IPR036928"
                     /db_xref="UniProtKB/TrEMBL:B4EE73"
                     /protein_id="CAR50456.1"
                     /translation="MHSDYLAHDAIGLAALVRDRQASPRELLDAAIGQAEAVNGAINA
                     IVLQDYEAARQRAASAPEPGAATPFAGVPYLVKDLGAAVAGLPLSMGSRHYRYFVPAD
                     DSPVIARSRAAGLNVFGKTNTSEIGQMPYTEPELFGACRNPWNLDHTPGGSSGGAAAA
                     VAAGIVPLAHASDGGGSIRIPASCCGLFGLKPSRNPVLVDLPSNGELVVQHAVSRSVR
                     DSALLLDVTTGQTLPPGAPGTFLGALDTPPGPLRIGLVIDPMLAPALADDTRAALDDA
                     AALLESLGHHVEPTTLQIDYVRAAETFLTLWATIAEEMVLGARELTGRTPRRGEFEAA
                     TWAMAVVGRRLARTRLPDVLEWQRQLTVQVAGLVSRYDAILCASLAGPPVKIGELQPT
                     PFESAQMKLVAALPVKPLLKEMLAKSSEKAFAWAGCTELFNLTGQPAMSVPLYWNARG
                     LPIGVQFAARHADEALLLKLARQLEQARPWFDRRPPLMQAQR"
     misc_feature    complement(172043..173371)
                     /locus_tag="BCAL0148"
                     /note="HMMPfam hit to PF01425, Amidase, score 2.4e-79"
                     /inference="protein motif:HMMPfam:PF01425"
     misc_feature    complement(172901..172996)
                     /note="PS00571 Amidases signature."
                     /inference="protein motif:Prosite:PS00571"
     misc_feature    complement(173084..173107)
                     /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
                     /inference="protein motif:Prosite:PS00017"
     CDS             complement(173527..174219)
                     /transl_table=11
                     /locus_tag="BCAL0149"
                     /product="putative dienelactone hydrolase"
                     /db_xref="EnsemblGenomes-Gn:BCAL0149"
                     /db_xref="EnsemblGenomes-Tr:CAR50457"
                     /db_xref="GOA:B4EE74"
                     /db_xref="InterPro:IPR002925"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:B4EE74"
                     /protein_id="CAR50457.1"
                     /translation="MTAQWIDIPTGNDSFGGYLALPKRGKGPAVIIIQEIFGVNAHIR
                     AVADQYAADGFVALAPDVFWRTQPRVELTYEGADRDKGIELMKKTDVGLAVADIGAAA
                     DALRARPEVDGKLAAIGYCFGGQLAYRAAATGKLDAAVSYYGGGIQNALDLAGQVTQP
                     ILFHYAENDHGIPLTAVDQVKAAFAGHGHASFHVYPGAEHGFNCTDRASYNQRAAALA
                     HGRTLTFLAEHL"
     misc_feature    complement(173530..174177)
                     /locus_tag="BCAL0149"
                     /note="HMMPfam hit to PF01738, Dienelactone hydrolase
                     family, score 2.7e-68"
                     /inference="protein motif:HMMPfam:PF01738"
     CDS             174444..175526
                     /transl_table=11
                     /locus_tag="BCAL0150"
                     /product="putative oxidoreductase"
                     /db_xref="EnsemblGenomes-Gn:BCAL0150"
                     /db_xref="EnsemblGenomes-Tr:CAR50458"
                     /db_xref="GOA:B4EE75"
                     /db_xref="InterPro:IPR004136"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:B4EE75"
                     /protein_id="CAR50458.1"
                     /translation="MSARSLSTPFSERFGLRLPLVQAPMVGATTTAMVAAASNAGALG
                     SLGAGALAPERIEAEVAAIRAATDRPFAINLFVLPDEAAPDAATVARALAAIDPLNAT
                     LGLPPGTAPARYAPDFRAQLDALVALRVPVASFTFGVLDAADVARLKAAGTYVIGTAT
                     HVAEGLAWQAAGADALSAQGAEAGGHRGTFIGSADDALIGTLALVPQLVDATGLPVLA
                     AGGIMDGRGIAAALALGAQAAQLGTAFLTCAESAIAADWKARLLASADTSTQVTRAIT
                     GRHARGLRNTLMARLGEHVADAAPYPVQNALTQPLRQAAARANDGDYLSLWAGQGAPL
                     ARRRGDTLTTSQLVAALDAEWRASAA"
     sig_peptide     174444..174563
                     /locus_tag="BCAL0150"
                     /note="Signal peptide predicted for BCAL0150 by SignalP
                     2.0 HMM (Signal peptide probability 0.805) with cleavage
                     site probability 0.274 between residues 40 and 41"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    174462..175505
                     /locus_tag="BCAL0150"
                     /note="HMMPfam hit to PF03060, 2-nitropropane dioxygenase,
                     score 1.9e-84"
                     /inference="protein motif:HMMPfam:PF03060"
     CDS             175965..177107
                     /transl_table=11
                     /locus_tag="BCAL0151"
                     /product="extracellular ligand binding protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0151"
                     /db_xref="EnsemblGenomes-Tr:CAR50459"
                     /db_xref="GOA:B4EE76"
                     /db_xref="InterPro:IPR000709"
                     /db_xref="InterPro:IPR028081"
                     /db_xref="InterPro:IPR028082"
                     /db_xref="UniProtKB/TrEMBL:B4EE76"
                     /protein_id="CAR50459.1"
                     /translation="MNIKMQKLLPITAAAMLCAAAASNASADQVVKIGHVAPLTGGIA
                     HLGKDNENGARLAVEEINAKGLTIGGQKITLQLDPQDDAADPRQATQVAQKLVDDKVV
                     AVVGHLNSGTSIPASKIYSDAGVVQISPSATNPAYTQQGFKTTYRVVATDAQQGPALA
                     DYAHSKGIKSVAVVDDSTAYGQGLANEFEKKAKALGLKVMSHDATNDKAVDFRAILTK
                     IKGENPDAIMYGGMDATGGPFAKQAKQLGLRAKIFAGDGVCTEKLADLAGDATDNIVC
                     SEAGASLEKMPGGAAFKAKYEKRFGQPIQIYAPFTYDAVYIIADAMKRANSTDPAKIL
                     AAMPATKYTGVIGTTTFDSKGDLQHGVISLYNYKSGKKSLLDEVKM"
     sig_peptide     175965..176045
                     /locus_tag="BCAL0151"
                     /note="Signal peptide predicted for BCAL0151 by SignalP
                     2.0 HMM (Signal peptide probability 1.000) with cleavage
                     site probability 0.924 between residues 27 and 28"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    176109..177071
                     /locus_tag="BCAL0151"
                     /note="HMMPfam hit to PF01094, Receptor family ligand
                     binding region, score 1.5e-68"
                     /inference="protein motif:HMMPfam:PF01094"
     CDS             complement(177197..178414)
                     /transl_table=11
                     /locus_tag="BCAL0152"
                     /product="Major Facilitator Superfamily protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0152"
                     /db_xref="EnsemblGenomes-Tr:CAR50460"
                     /db_xref="GOA:B4EE77"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR036259"
                     /db_xref="UniProtKB/TrEMBL:B4EE77"
                     /protein_id="CAR50460.1"
                     /translation="MSESSSPESSSPFAAPPDAHRVLSLPARQRARTASMALFFVAGM
                     MYASWGVHVPTVRDKFALSPGLLSIALFAVAGGSIAAMLTIARWIARVGSRTACLAGG
                     LVMSACAALILVVPDYWMLLAVLALFGFSMATLDVAMNAEASAVEIALGKPIMSSLHG
                     MFSIGGMAGAAAGGALLSAGMAPVAHLALAAAVSAAVLVAASPAVLPHVPHHEQAHGG
                     GNRWRSPALWMLGGIALIALIAEGAMYDWATVYMRDVVAASPALASAAYAAFSGGMAL
                     ARFAGDAVRARFGAPQLVFASASLACAGMIGALLLPYPAAVLTGFTLMGLGLANMMPV
                     LFAAAARVKGIHAAEGLAHVAGLAYFGLLFGPVVIGAVAQAANLTIGLSVVALCAALV
                     ALVAPKVLSHLKI"
     misc_feature    complement(join(177215..177283,177296..177364,
                     177401..177469,177482..177550,177584..177652,
                     177680..177739,177797..177865,177875..177943,
                     178004..178063,178073..178126,178145..178213,
                     178256..178324))
                     /locus_tag="BCAL0152"
                     /note="12 probable transmembrane helices predicted for
                     BCAL0152 by TMHMM2.0 at aa 42-64, 79-101, 108-125,
                     129-148, 169-191, 195-217, 237-256, 266-288, 300-322,
                     327-349, 362-384 and 389-411"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    complement(177293..178303)
                     /locus_tag="BCAL0152"
                     /note="HMMPfam hit to PF07690, Major Facilitator
                     Superfamily, score 4.5e-16"
                     /inference="protein motif:HMMPfam:PF07690"
     CDS             178647..179306
                     /transl_table=11
                     /locus_tag="BCAL0153"
                     /product="putative FMN flavoprotein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0153"
                     /db_xref="EnsemblGenomes-Tr:CAR50461"
                     /db_xref="GOA:B4EE78"
                     /db_xref="InterPro:IPR012349"
                     /db_xref="InterPro:IPR037119"
                     /db_xref="UniProtKB/TrEMBL:B4EE78"
                     /protein_id="CAR50461.1"
                     /translation="MNIDPAFALHLLHRCALGTLATHAREPQGFPYPTVVPFAPDASH
                     RPVILVSGLAEHTRNLVADPRAGFLVVDAGDGDVLNAERATLLGRFVPLGDDPHVTAR
                     YLRYEPDAARYLALGDFAFWALEIERLRYIGGFGRMGWVDGTQLDALPPLAFDDEQAL
                     WHAYEAGDARRDGLDLLGVDRHGADWRCDGRRVRTPFDAPSADIGALRDRLIACAQDV
                     T"
     misc_feature    178653..178937
                     /locus_tag="BCAL0153"
                     /note="HMMPfam hit to PF01243, Pyridoxamine 5'-phosphate
                     oxidase, score 1.2e-10"
                     /inference="protein motif:HMMPfam:PF01243"
     CDS             179663..179956
                     /transl_table=11
                     /locus_tag="BCAL0154"
                     /product="histone-like nucleoid-structuring (H-NS)
                     protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0154"
                     /db_xref="EnsemblGenomes-Tr:CAR50462"
                     /db_xref="GOA:B4EE79"
                     /db_xref="InterPro:IPR001801"
                     /db_xref="InterPro:IPR027444"
                     /db_xref="InterPro:IPR037150"
                     /db_xref="UniProtKB/TrEMBL:B4EE79"
                     /protein_id="CAR50462.1"
                     /translation="MSSYKDLLAQQEKLEKQIEEAKSREYAEVLNDVKQKIADYGFSL
                     AELGLSRAKAGKVGRPRAGVAAKYRDPETGATWSGRGKPPRWIAGKNREQFAI"
     misc_feature    179666..179953
                     /locus_tag="BCAL0154"
                     /note="HMMPfam hit to PF00816, H-NS histone family, score
                     3.9e-20"
                     /inference="protein motif:HMMPfam:PF00816"
     CDS             180213..181370
                     /transl_table=11
                     /locus_tag="BCAL0155"
                     /product="putative cation efflux protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0155"
                     /db_xref="EnsemblGenomes-Tr:CAR50463"
                     /db_xref="GOA:B4EE80"
                     /db_xref="InterPro:IPR002524"
                     /db_xref="InterPro:IPR027469"
                     /db_xref="InterPro:IPR027470"
                     /db_xref="InterPro:IPR036837"
                     /db_xref="UniProtKB/TrEMBL:B4EE80"
                     /protein_id="CAR50463.1"
                     /translation="MSTFSGDAQSADKHAVARKSTLVSIVLNVVLATFQIVVGVIAHS
                     QALIADGVHSISDLISDFVVLVANRHSGASPDADHNYGHSRYETVASLFLGAILIAVG
                     IGMLWRAGDRLVNLENIPAVHFSALIVALTVLVSKEALFRYMLREARRVRSAMLVANA
                     WHARSDAASSLVVAIGIVGSLAGVRLLDPIAAAIVGFMVARMGWTFGYDALQDLSDRA
                     LDTADTAEIRALLAATPGVRDVHDLRTRKMGDAALVDAHILVDPKISVSEGHYIAETA
                     RARVLSDPRVLDALIHVDPGNDAARRPALALPPRGELAARLEAALAQRGLRAAAINLH
                     YLSTGLEVDVTLDSDPHDTDAALAGRLDIETLKREFGARRIGFTRTLPART"
     misc_feature    180273..181112
                     /locus_tag="BCAL0155"
                     /note="HMMPfam hit to PF01545, Cation efflux family, score
                     3.6e-73"
                     /inference="protein motif:HMMPfam:PF01545"
     misc_feature    join(180273..180341,180474..180533,180552..180620)
                     /locus_tag="BCAL0155"
                     /note="3 probable transmembrane helices predicted for
                     BCAL0155 by TMHMM2.0 at aa 21-43, 88-107 and 114-136"
                     /inference="protein motif:TMHMM:2.0"
     CDS             complement(181422..181892)
                     /transl_table=11
                     /locus_tag="BCAL0156"
                     /product="AnsC family regulatory protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0156"
                     /db_xref="EnsemblGenomes-Tr:CAR50464"
                     /db_xref="GOA:B4EE81"
                     /db_xref="InterPro:IPR000485"
                     /db_xref="InterPro:IPR011008"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR019885"
                     /db_xref="InterPro:IPR019887"
                     /db_xref="InterPro:IPR019888"
                     /db_xref="InterPro:IPR036388"
                     /db_xref="InterPro:IPR036390"
                     /db_xref="UniProtKB/TrEMBL:B4EE81"
                     /protein_id="CAR50464.1"
                     /translation="MEAQVTLDSFSQKILRLLQLDARRSVQEISDQVGLSSTPCWRRI
                     KDMEQSGVIQRYTALLDREKLGLHVCALAHVHLTRHNEGGVEQFEREIATCPEVTECY
                     STTGEADYILKIVAPDIKAYDVFLHERIFKIPAVSQVRTSVVLREIKFDTQLPL"
     misc_feature    complement(181452..181682)
                     /locus_tag="BCAL0156"
                     /note="HMMPfam hit to PF01037, AsnC family, score 8.9e-33"
                     /inference="protein motif:HMMPfam:PF01037"
     misc_feature    complement(181740..181820)
                     /note="PS00519 Bacterial regulatory proteins, asnC family
                     signature."
                     /inference="protein motif:Prosite:PS00519"
     misc_feature    complement(181758..181823)
                     /note="Predicted helix-turn-helix motif with score
                     1034.000, SD 2.71 at aa 24-45, sequence
                     RSVQEISDQVGLSSTPCWRRIK"
                     /inference="protein motif:helixturnhelix:EMBOSS"
     CDS             complement(181972..182631)
                     /transl_table=11
                     /locus_tag="BCAL0157"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0157"
                     /db_xref="EnsemblGenomes-Tr:CAR50465"
                     /db_xref="GOA:B4EE82"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR036397"
                     /db_xref="UniProtKB/TrEMBL:B4EE82"
                     /protein_id="CAR50465.1"
                     /translation="MNQTAIPEIYVSTDVEADGPIPGPHSMLSFASAAYTEDKQLIAT
                     FSANLETLPGAHAHPVQEAWWKTEPEAWAACRRDLQTPEAALVAYVEWVEALPGKPVF
                     VAMPAGFDFTFMFWYMMRFAGRCPFSWSALDIKTLAFAMTGLPYRKAIKPRFPKHWFD
                     DHPHTHVALDDAIEQGALFCNMLADLRRQQAALAGLAVSDTDRSESAGAGQNPTDPRA
                     N"
     CDS             complement(182628..183272)
                     /transl_table=11
                     /locus_tag="BCAL0158"
                     /product="metallo-beta-lactamase superfamily protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0158"
                     /db_xref="EnsemblGenomes-Tr:CAR50466"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="InterPro:IPR036866"
                     /db_xref="UniProtKB/TrEMBL:B4EE83"
                     /protein_id="CAR50466.1"
                     /translation="MKVTLIPVTPFQQNCSLLVCEKTGRAAVVDPGGDLDRIEQEVAR
                     QNVQVEKVLLTHGHIDHCAGAKTLATHYGVPIEGPQEEERFWIEKLPMQSERFGFPAA
                     DSFEPDQWLNDGDTVRFGDETLEVYHCPGHTPGHVVFFSRAHRIAIVGDVLFAGSIGR
                     TDFPRGNHEDLVRSIKEKLWPLGDDVTFVPGHGPVSTFGDERRTNPFVSDKVFG"
     misc_feature    complement(182697..183239)
                     /locus_tag="BCAL0158"
                     /note="HMMPfam hit to PF00753, Metallo-beta-lactamase
                     superfamily, score 1.8e-37"
                     /inference="protein motif:HMMPfam:PF00753"
     CDS             183928..184539
                     /transl_table=11
                     /locus_tag="BCAL0159"
                     /product="putative RlpA-like lipoprotein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0159"
                     /db_xref="EnsemblGenomes-Tr:CAR50467"
                     /db_xref="GOA:B4EE84"
                     /db_xref="InterPro:IPR009009"
                     /db_xref="InterPro:IPR012997"
                     /db_xref="InterPro:IPR034718"
                     /db_xref="InterPro:IPR036908"
                     /db_xref="UniProtKB/TrEMBL:B4EE84"
                     /protein_id="CAR50467.1"
                     /translation="MNLRFPSRFGTIALFFALTGCAVPPSQTTGSVNQKKAVDKTAAA
                     AKADDDKQPLSFDSALASMPAADSKDAKKSSLADAEPIDGKDVSDFRQTGRASWYGRD
                     FHGRRTANGERFNMNAFTAAHRTLPLSSYIKVTNASTGKWVVVKVNDRGPFKRGRVLD
                     LSYAAAKVIGLVHAGTGRVKIEGLSPQEAREARDEMFASISAK"
     misc_feature    184198..184470
                     /locus_tag="BCAL0159"
                     /note="HMMPfam hit to PF03330, Rare lipoprotein A
                     (RlpA)-like double-psi be, score 7.4e-40"
                     /inference="protein motif:HMMPfam:PF03330"
     CDS             complement(184618..185505)
                     /transl_table=11
                     /locus_tag="BCAL0160"
                     /product="putative methylase"
                     /db_xref="EnsemblGenomes-Gn:BCAL0160"
                     /db_xref="EnsemblGenomes-Tr:CAR50468"
                     /db_xref="GOA:B4EE85"
                     /db_xref="InterPro:IPR000878"
                     /db_xref="InterPro:IPR008189"
                     /db_xref="InterPro:IPR014776"
                     /db_xref="InterPro:IPR014777"
                     /db_xref="InterPro:IPR018063"
                     /db_xref="InterPro:IPR035996"
                     /db_xref="UniProtKB/TrEMBL:B4EE85"
                     /protein_id="CAR50468.1"
                     /translation="MTALLELAHTQHYPDATLYVVATPIGNTADITLRALHVLGLADR
                     IAAEDTRNTGQLLARYGISKPLVAVHEHNEREAAQRVIELLRGGERVAYVSDAGTPGI
                     SDPGARLVDAVRAAGFAVVPLPGASAAVTALSVAGDWAGAFTFAGFLPPKAKQRASAL
                     QALVSHPYALVFYEAPHRIAETVAALADAFGPARRLLIARELTKLHEQLFQGTLAEGQ
                     GWLAGDANRQRGEFVLVVEGAPAASGEADDAAHDALLRLLLEEVPVKSAAKLAAALTG
                     ASRNALYARALVLKEGTEG"
     misc_feature    complement(184852..185457)
                     /locus_tag="BCAL0160"
                     /note="HMMPfam hit to PF00590, Tetrapyrrole
                     (Corrin/Porphyrin) Methylas, score 3.1e-43"
                     /inference="protein motif:HMMPfam:PF00590"
     misc_feature    complement(185188..185223)
                     /note="PS01296 Uncharacterized protein family UPF0011
                     signature."
                     /inference="protein motif:Prosite:PS01296"
     CDS             185552..185980
                     /transl_table=11
                     /locus_tag="BCAL0161"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0161"
                     /db_xref="EnsemblGenomes-Tr:CAR50469"
                     /db_xref="GOA:B4EE86"
                     /db_xref="InterPro:IPR003509"
                     /db_xref="InterPro:IPR011335"
                     /db_xref="InterPro:IPR011856"
                     /db_xref="UniProtKB/TrEMBL:B4EE86"
                     /protein_id="CAR50469.1"
                     /translation="MCHAAPARPEGARGRPRSGDNFSGAARSKPVGAAFEQRARQFLE
                     RHGLGFVAANVTMRGGELDLVMREPDGMLVFVEVRARRSTRHGGAAASVGWRKRRRLV
                     AAALQFWSRHGAGAACRFDVVAFEAGRLAWLRDAFRTDDA"
     misc_feature    185651..185929
                     /locus_tag="BCAL0161"
                     /note="HMMPfam hit to PF02021, Uncharacterised protein
                     family UPF0102, score 3e-26"
                     /inference="protein motif:HMMPfam:PF02021"
     CDS             186107..186691
                     /transl_table=11
                     /gene="gmhA"
                     /locus_tag="BCAL0162"
                     /product="phosphoheptose isomerase"
                     /EC_number="5.3.1.-"
                     /db_xref="EnsemblGenomes-Gn:BCAL0162"
                     /db_xref="EnsemblGenomes-Tr:CAR50470"
                     /db_xref="GOA:B4EE87"
                     /db_xref="InterPro:IPR001347"
                     /db_xref="UniProtKB/TrEMBL:B4EE87"
                     /protein_id="CAR50470.1"
                     /translation="MSVERIQQQFRDSAALHAEAADALSLPIAAAVDAMFAALANGNK
                     IVACGDGPSAAAAQYLAASLVGGFERERPGLPAIALATDASQAGLAGAAAAEQLFAQQ
                     VRVLGQTGDILLVLDAGGASPRVLAAIGEAHEREMTVVALTGGNDHTVAAALSDTDIP
                     ISVPAVRAARIHEVHLLTIHSLCDGIDAMLLGED"
     CDS             186688..187509
                     /transl_table=11
                     /locus_tag="BCAL0163"
                     /product="putative phospholipid-binding lipoprotein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0163"
                     /db_xref="EnsemblGenomes-Tr:CAR50471"
                     /db_xref="InterPro:IPR007055"
                     /db_xref="InterPro:IPR014004"
                     /db_xref="UniProtKB/TrEMBL:B4EE88"
                     /protein_id="CAR50471.1"
                     /translation="MNEGEPSMNQSRVKQTLVRTTLLAALTAGLAVSLQGCVLGVVGA
                     AAGGGALIATDRRTLGAQTEDREIQVKSLTQINNGLPDQSHVNVTVFNRRVLLTGEVP
                     NDASKQRAEEIVRGINNVNGIVNELSVEPASSLSSRANDSYLEGRVKSELIATKGISA
                     NYYKVVSERGNLYLMGLVTVDEGNRGAEAASQVPGVEKVVKVFQYVKPQDAQALQDAS
                     PASGASGAQAAAAPADNATVGAVPDASVQSTPLQPPAPISNSSSVHPGNPKAKAQ"
     sig_peptide     186688..186795
                     /locus_tag="BCAL0163"
                     /note="Signal peptide predicted for BCAL0163 by SignalP
                     2.0 HMM (Signal peptide probability 0.728) with cleavage
                     site probability 0.212 between residues 36 and 37"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    186748..186816
                     /locus_tag="BCAL0163"
                     /note="1 probable transmembrane helix predicted for
                     BCAL0163 by TMHMM2.0 at aa 21-43"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    186766..186798
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
                     /inference="protein motif:Prosite:PS00013"
     misc_feature    186895..187080
                     /locus_tag="BCAL0163"
                     /note="HMMPfam hit to PF04972, Putative
                     phospholipid-binding domain, score 5.4e-13"
                     /inference="protein motif:HMMPfam:PF04972"
     misc_feature    187120..187299
                     /locus_tag="BCAL0163"
                     /note="HMMPfam hit to PF04972, Putative
                     phospholipid-binding domain, score 0.00011"
                     /inference="protein motif:HMMPfam:PF04972"
     CDS             187506..187868
                     /transl_table=11
                     /locus_tag="BCAL0164"
                     /product="putative cytochrome c-551 precursor"
                     /db_xref="EnsemblGenomes-Gn:BCAL0164"
                     /db_xref="EnsemblGenomes-Tr:CAR50472"
                     /db_xref="GOA:B4EE89"
                     /db_xref="InterPro:IPR002324"
                     /db_xref="InterPro:IPR009056"
                     /db_xref="InterPro:IPR036909"
                     /db_xref="UniProtKB/TrEMBL:B4EE89"
                     /protein_id="CAR50472.1"
                     /translation="MTGMQIKSMKRRVVQGAAAAALVAGTLGAAHADVGDGLKVARSN
                     ACMGCHAVDRKLVGPSFKDIAARYKSDPQAVAKLSKKVKDGGSGVWGAIPMPAHPRMS
                     DADVRSVVEWVLAGAPSK"
     sig_peptide     187506..187601
                     /locus_tag="BCAL0164"
                     /note="Signal peptide predicted for BCAL0164 by SignalP
                     2.0 HMM (Signal peptide probability 1.000) with cleavage
                     site probability 0.997 between residues 32 and 33"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    187542..187610
                     /locus_tag="BCAL0164"
                     /note="1 probable transmembrane helix predicted for
                     BCAL0164 by TMHMM2.0 at aa 13-35"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    187605..187856
                     /locus_tag="BCAL0164"
                     /note="HMMPfam hit to PF00034, Cytochrome c, score
                     6.5e-07"
                     /inference="protein motif:HMMPfam:PF00034"
     misc_feature    187641..187658
                     /note="PS00190 Cytochrome c family heme-binding site
                     signature."
                     /inference="protein motif:Prosite:PS00190"
     tRNA            187935..188010
                     /gene="BCALr0164"
                     /note="tRNA Ala anticodon CGC, Cove score 84.28"
     repeat_region   187964..188010
                     /note="Perfect repeat flanking genomic island"
     misc_feature    188011..204429
                     /note="BcenGI2"
     CDS             188900..189877
                     /transl_table=11
                     /locus_tag="BCAL0165"
                     /product="putative plasmid replication-associated protein"
                     /note="Possible alternative translational start site after
                     codon 54"
                     /db_xref="EnsemblGenomes-Gn:BCAL0165"
                     /db_xref="EnsemblGenomes-Tr:CAR50473"
                     /db_xref="InterPro:IPR018777"
                     /db_xref="UniProtKB/TrEMBL:B4EE90"
                     /protein_id="CAR50473.1"
                     /translation="MQVFIAEATPPASPAEACDASASTYSRLAPLRHRQCDFFVADIL
                     DASPKDDLASMEHPLFALRAGDRRIRVYERKETRVTVKPGVDGCATIHDKDLWIYCIS
                     QLVAAKNRGREITRTVRFTAYDFLHSTNRDTSGRAYIRMGEMLARLTGTRIETNIETA
                     GKRERGFFGLIDSAKVIERDGGDRMVAVEVTLPDWLFRSVDAMQVKTLSPNYFRLRKP
                     LDRRIYELACKHCGNQPTWKSSIATLHEKSGSADKLFKFRAAIKALAASGELPDYRMA
                     YDPKADNVTFYANGPKGYRAEIAAIMKGLPHTSVKAREKAHARKRGRPK"
     misc_feature    189560..189625
                     /note="Predicted helix-turn-helix motif with score
                     1060.000, SD 2.80 at aa 221-242, sequence
                     RRIYELACKHCGNQPTWKSSIA"
                     /inference="protein motif:helixturnhelix:EMBOSS"
     repeat_region   complement(190258..190260)
                     /note="duplicated insertion sequence target"
     mobile_element  complement(190261..191699)
                     /mobile_element_type="insertion sequence:ISBcen9"
                     /note="putative IS element - ISBcen9"
     repeat_region   190261..190285
                     /note="IS element imperfect inverted repeat region"
     CDS             complement(190294..191130)
                     /transl_table=11
                     /locus_tag="BCAL0166"
                     /product="putative transposase"
                     /db_xref="EnsemblGenomes-Gn:BCAL0166"
                     /db_xref="EnsemblGenomes-Tr:CAR50474"
                     /db_xref="GOA:B4E6E8"
                     /db_xref="InterPro:IPR001584"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR025948"
                     /db_xref="InterPro:IPR036397"
                     /db_xref="InterPro:IPR038965"
                     /db_xref="UniProtKB/TrEMBL:B4E6E8"
                     /protein_id="CAR50474.1"
                     /translation="MLELRQQFPLAGLLRVAGLARSTFYYQCKALAAPDRHASVKAKI
                     RALFEQHKGRYGYRRITLALRRLGQMINHKTVARLMRKMQLKSCVRVKKYRAYRGNTC
                     KTAPHLLQRQFHAARPNEKWVTDITEFSVGGQKLYLSPVLDLYNGEIIAYQTHTRPAF
                     QMVTDMLRKALRRLQPDERPMLHSDQGWHYQMPGWRLMLEQRSLAQSMSRKGNCLDNA
                     AMESFFGTLKSEFFYLNHFSSIEQLRIGLKRYIRYYNHERIKLKLKGLSPVQYRTQPH
                     PA"
     misc_feature    complement(190312..190791)
                     /locus_tag="BCAL0166"
                     /note="HMMPfam hit to PF00665, Integrase core domain,
                     score 5.1e-42"
                     /inference="protein motif:HMMPfam:PF00665"
     CDS             complement(191130..191654)
                     /transl_table=11
                     /locus_tag="BCAL0167"
                     /product="putative transposase"
                     /db_xref="EnsemblGenomes-Gn:BCAL0167"
                     /db_xref="EnsemblGenomes-Tr:CAR50475"
                     /db_xref="GOA:B4E6E7"
                     /db_xref="InterPro:IPR002514"
                     /db_xref="InterPro:IPR010921"
                     /db_xref="UniProtKB/TrEMBL:B4E6E7"
                     /protein_id="CAR50475.1"
                     /translation="MARYTEQFKLSVVKRCIGGEAIRAVARTHGLSHSTVSQWYATYQ
                     AHGKDGVRRKYNSYDVAFRLKVVQHMREHGVSSKEAAARFNIRNPSAVLEWARRYDDG
                     GLTALAPRPKGRRPTAMPKTPPAQPLNPTDGTDTRTREDLLQELNYLRMENAYLKKLR
                     ALVQAQAVPRKKRK"
     misc_feature    complement(191532..191597)
                     /note="Predicted helix-turn-helix motif with score
                     1703.000, SD 4.99 at aa 20-41, sequence
                     EAIRAVARTHGLSHSTVSQWYA"
                     /inference="protein motif:helixturnhelix:EMBOSS"
     repeat_region   complement(191675..191699)
                     /note="IS element imperfect inverted repeat region"
     CDS             complement(191700..191987)
                     /pseudo
                     /transl_table=11
                     /locus_tag="BCAL0168"
                     /product="hypothetical protein (fragment)"
                     /note="CDS is disrupted by the insertion of an IS element
                     after codon 95"
     repeat_region   complement(191700..191702)
                     /note="duplicated insertion sequence target"
     CDS             complement(192105..192797)
                     /transl_table=11
                     /locus_tag="BCAL0169"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0169"
                     /db_xref="EnsemblGenomes-Tr:CAR50477"
                     /db_xref="UniProtKB/TrEMBL:B4EE93"
                     /protein_id="CAR50477.1"
                     /translation="MARPARSDFEKRRGGMRAAALLHELAARMGAKNPHQFAVCFDNN
                     FGMLTQQSGKWRANFGGAKPLSAQQRKLLARLDTDADVLHDDGPAALWKAMWGQLNEL
                     QSIVSVELEKWLTLDMVLAEFEADLLLAELERAPLSLANLATAVALYRLHLEVEAIVP
                     LGLDGKGICRCLRLCLDNDQIQQELSRLGVQHAVDSELTSWIVSRPDLEVAWASSRTR
                     WNVLAERLDWVS"
     CDS             192918..193169
                     /transl_table=11
                     /locus_tag="BCAL0170"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0170"
                     /db_xref="EnsemblGenomes-Tr:CAR50478"
                     /db_xref="UniProtKB/TrEMBL:B4EE94"
                     /protein_id="CAR50478.1"
                     /translation="MFDILKDRYGAVMTLDQLAAALSRKPEGLRMALLKPKSEWAHCL
                     NSHKFYVGRRMYFPTEVVAHLFDSGFELQRGGDDEEFSG"
     CDS             193147..193539
                     /transl_table=11
                     /locus_tag="BCAL0171"
                     /product="putative plasmid conjugal transfer protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0171"
                     /db_xref="EnsemblGenomes-Tr:CAR50479"
                     /db_xref="InterPro:IPR035225"
                     /db_xref="UniProtKB/TrEMBL:B4EE95"
                     /protein_id="CAR50479.1"
                     /translation="MTKNFPDELAAWVAQRRNAAKHKRNEYLVSFLAVRNDVIEATAA
                     GYALKTIWEHMQATGRVSFRYETFLKYVRRHIANSSLPGVTPARRGSERGRSDKSKTN
                     EIGSSKKGEIPAIGGFSFKATPNGDELL"
     CDS             193882..194244
                     /transl_table=11
                     /locus_tag="BCAL0172"
                     /product="putative plasmid conjugal transfer protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0172"
                     /db_xref="EnsemblGenomes-Tr:CAR50480"
                     /db_xref="UniProtKB/TrEMBL:B4EE96"
                     /protein_id="CAR50480.1"
                     /translation="MENGKKSMTRKRGLHLRVPVLPDEEAAIRSNAAKAGLSVAAYLR
                     NVGLGYEIRGILDYARIADLAKVNGDLGRLGGLLKLWLTNDKRVEGFSQSTILALLAK
                     IEGTQNEMRQIMALVVAR"
     CDS             194371..195144
                     /transl_table=11
                     /locus_tag="BCAL0173"
                     /product="putative plasmid conjugal transfer protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0173"
                     /db_xref="EnsemblGenomes-Tr:CAR50481"
                     /db_xref="InterPro:IPR014147"
                     /db_xref="UniProtKB/TrEMBL:B4EE97"
                     /protein_id="CAR50481.1"
                     /translation="MKILAAKTVVLAVAIGGAVSHSALAGGIPVIDVTNVMQTTISAI
                     NNVQAVQKQIEQYTTQLQQYQNMLQNTVAPAAYVWDQVNGTINKLLQAQDMLNYYKNQ
                     AGNIDAYLSRYQDVAYYRSSPCFTATGCTDAQRQALADAQVNGSEAQKRANDAVLKGV
                     DQQQQTLVTDAANLRSLQAQASSAQGQMQAIQAANQLASAQTNQLLQLRGLLVAQQAA
                     AATRAQIVADREAQQAAAGVQLRDGSNITHSAPKSWTFQ"
     CDS             195154..195345
                     /transl_table=11
                     /locus_tag="BCAL0173a"
                     /product="hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0173a"
                     /db_xref="EnsemblGenomes-Tr:CAR50482"
                     /db_xref="UniProtKB/TrEMBL:B4EE98"
                     /protein_id="CAR50482.1"
                     /translation="MKVAIWALVSLAMLAGCDDKGASAEAKQAASAAQLRDGSNVVSS
                     PPKNWTWGDAPSQQPKKNQ"
     CDS             195365..196792
                     /transl_table=11
                     /locus_tag="BCAL0174"
                     /product="putative plasmid conjugal transfer protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0174"
                     /db_xref="EnsemblGenomes-Tr:CAR50483"
                     /db_xref="GOA:B4EE99"
                     /db_xref="InterPro:IPR007688"
                     /db_xref="InterPro:IPR014150"
                     /db_xref="UniProtKB/TrEMBL:B4EE99"
                     /protein_id="CAR50483.1"
                     /translation="MFFKRGNLFALGLMMLLHVATAFAAPMDVNVVDSVMGKYQSAAS
                     SWGGVMVSYGSWLFWGLALVSMVWTYGMMAMRRSDIQEFFAESIRFFGTLGFFWWILY
                     NGPAIGDAIVKSMWMIGAKAIGQATDFTPGGIVQIGYDIFAKALDQSSVWSPTDSVVG
                     LLMALAVMLVLTIVGVNLLLVFVSAWIVIYGGVFFLGFGGSRWTSDIAISFYKHVLAI
                     GAELMVMLLLIGIGKTFINEYYSSMAAGIDLKEMAVMLIAAFALMYLTNKIPPRIAGI
                     VGVGGVGSIGGVGVGSVMAAAAMTASAAASAGSSVMAGATNAAGGASALKAAFQGAQQ
                     HMAGGTGMFSGSNAASGSLAGGNGGVSSSSGGSGGFSSFMSNAGRFAADMSSNLAKGA
                     GDVAKDKAAAMMESAKGNVAQTTGGKIASAIHGGADFRDLTGANTVSFADDSLGASNG
                     RSRQNHMHDEVAAFVNKDRSSHEEA"
     misc_feature    join(195386..195445,195503..195571,195632..195700,
                     195836..195904,195908..195976,196004..196072,
                     196091..196159,196187..196255)
                     /locus_tag="BCAL0174"
                     /note="8 probable transmembrane helices predicted for
                     BCAL0174 by TMHMM2.0 at aa 68-87, 107-129, 150-172,
                     218-240, 242-264, 274-296, 303-325 and 335-357"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    195527..196222
                     /locus_tag="BCAL0174"
                     /note="HMMPfam hit to PF04610, TrbL/VirB6 plasmid conjugal
                     transfer protein, score 1e-12"
                     /inference="protein motif:HMMPfam:PF04610"
     CDS             196857..197147
                     /transl_table=11
                     /locus_tag="BCAL0175"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0175"
                     /db_xref="EnsemblGenomes-Tr:CAR50484"
                     /db_xref="InterPro:IPR024640"
                     /db_xref="UniProtKB/TrEMBL:B4EEA0"
                     /protein_id="CAR50484.1"
                     /translation="MATMHDTEAREVIHHTAMRLAALEFIDRHAAKDLSQMAEAVANL
                     FVVVFYQAETGRATRSDFREAMTAVRQALQQYAEPPKRYDVISGEGANKVWS"
     CDS             197138..197497
                     /transl_table=11
                     /locus_tag="BCAL0176"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0176"
                     /db_xref="EnsemblGenomes-Tr:CAR50485"
                     /db_xref="GOA:B4EEA1"
                     /db_xref="InterPro:IPR001387"
                     /db_xref="InterPro:IPR010982"
                     /db_xref="InterPro:IPR013430"
                     /db_xref="UniProtKB/TrEMBL:B4EEA1"
                     /protein_id="CAR50485.1"
                     /translation="MVMKNHPHPGELLLEEVRRRFGLDVAGAAKRLNVSCTMLSRVLD
                     GRASISPDLAMHLERAGFSSARVWMTLQSDFDQRGAEPELVRMLDGVTPDNLHGEVDF
                     GSATGCKTSDQDKWGRL"
     CDS             197494..197796
                     /transl_table=11
                     /locus_tag="BCAL0177"
                     /product="putative plasmid conjugal transfer protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0177"
                     /db_xref="EnsemblGenomes-Tr:CAR50486"
                     /db_xref="UniProtKB/TrEMBL:B4EEA2"
                     /protein_id="CAR50486.1"
                     /translation="MIADSNEKQSHVNLSPKPSGGEAIPSHVLADDALSAREGLANRN
                     VLADRSDALGPTFVEEIGPLDVIPLFITRANARELFGRRPGETVAQALVRMAEDGW"
     CDS             198105..198917
                     /transl_table=11
                     /locus_tag="BCAL0178"
                     /product="putative DNA methyltransferase"
                     /db_xref="EnsemblGenomes-Gn:BCAL0178"
                     /db_xref="EnsemblGenomes-Tr:CAR50487"
                     /db_xref="GOA:B4EEA3"
                     /db_xref="InterPro:IPR012327"
                     /db_xref="InterPro:IPR023095"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:B4EEA3"
                     /protein_id="CAR50487.1"
                     /translation="MPDLIKHYSPLRYPGGKSWLAPELREWLAKDGQAELVELFAGGA
                     YASLLAVLEGYVHRATLVEVDPAICAVWRTVFSSDARKLCSRIRAFRFTEENVEELLD
                     KKFRTDVGLAFQTIVKNRARRGGILADGAGILRAGERNKGLASRWYPQTLIDRIGRLN
                     GYAESFKVIEGDALEYLALLNRRRRPVKLFVDPPYTKLSEYGVKPLYRFNHIDHAKLF
                     GRLHRTSHDVLITYDDSDLVRKKAMQHEFDVKRILMRTAHSVKKYELLLTRR"
     misc_feature    198141..198863
                     /locus_tag="BCAL0178"
                     /note="HMMPfam hit to PF02086, D12 class N6
                     adenine-specific DNA met, score 0.0013"
                     /inference="protein motif:HMMPfam:PF02086"
     misc_feature    198669..198689
                     /note="PS00092 N-6 Adenine-specific DNA methylases
                     signature."
                     /inference="protein motif:Prosite:PS00092"
     CDS             complement(198900..201533)
                     /transl_table=11
                     /locus_tag="BCAL0179"
                     /product="hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0179"
                     /db_xref="EnsemblGenomes-Tr:CAR50488"
                     /db_xref="InterPro:IPR038735"
                     /db_xref="UniProtKB/TrEMBL:B4EEA4"
                     /protein_id="CAR50488.1"
                     /translation="MPIQPQHPITIVDESDTRIISASLITKELVGEKAYGLSCIPSAW
                     TLPFVVASSKLYEGYSRATPSAKVELISRWASRVADALSGIGISGDTAVWVRSSGVTE
                     TIAQRGRFHSEQTTVTDLARALEICLRQISSSLSSSSEQVCLIVQRAVVPISAKGHLS
                     DERQYAQEARDWLGEIETPAQDPYFQINLRQWRRRQNEAAFSLPLGCTLRVSISRALE
                     PAAWWAYKLDTRAHFEWVWDGKAVYLVQVDEAITRDGFDPTAQTKALQRQKGTTPALR
                     CLKEISEEHARKFHKINNVEIYKKLGLPSCPIFVLDDVDILSEIISGEIRDDLRSDIE
                     KLCEYSLVIRTDIETDAQAKRQLLPRTCEVRDSQAALKFLKETLENFKQANITEPVAF
                     IFHNFIPAVSSAFAYAAPGARKVHIECLWGLPEGLYYNSHDKIIVDTKKGPITSDSTL
                     DPQKFSIQYKERYKGFCVAPDHDGQWVRMALAEPYDWRRAISKDEWIREIALQSRRIA
                     EMSAEPLSIMWFVGVPSRFSSKPTFPWYHEPYLVQEQQRNASRRRKAAWDKTLVIESA
                     ADVERLKAEATQEHSQVKQIRLQPADNDLLRNKHLLETVGELAKQIDAVVYLEGGTLS
                     HAYYQLLQTKAQIDIAQPFDQLDETQEFHKLVRDGVPRKITSGGEAAKIVRLSGDDFL
                     HALREKLVEEAIEALDARGHDKLLEELADVEEVIDGILRQLKISRTELNRLKKQKHAQ
                     SGGFEEGVVLVATANPSRIGQPTESGNLFEDNSTAIAAPSLETVDRRGAVTRRWEDKR
                     EHSSKTERVLRVSVGLTQDNWTTDSREISVGERGDSAIRARITGRREGSSMTLEVSLY
                     TLPRQLDLFQLEDETPSSPRQ"
     misc_feature    complement(201126..201191)
                     /note="Predicted helix-turn-helix motif with score
                     1098.000, SD 2.93 at aa 115-136, sequence
                     TTVTDLARALEICLRQISSSLS"
                     /inference="protein motif:helixturnhelix:EMBOSS"
     CDS             complement(201536..202231)
                     /transl_table=11
                     /locus_tag="BCAL0180"
                     /product="putative membrane protein"
                     /note="Possible alternative translational start sites"
                     /db_xref="EnsemblGenomes-Gn:BCAL0180"
                     /db_xref="EnsemblGenomes-Tr:CAR50489"
                     /db_xref="GOA:B4EEA5"
                     /db_xref="UniProtKB/TrEMBL:B4EEA5"
                     /protein_id="CAR50489.1"
                     /translation="MRRQTGSEDGATESNGGTGEPVRGSAAEDAASDSPDPDTDPKPK
                     DDASSGAKPRSSGPDSGDPTDGRQKFQWQTRYTGGTAWRQISIEAIYTVAVALLSLIL
                     IFVVWRGIIPKWLDLTAAEAKAFRVYGFYTAAGLLGGTVFCLKYLYRVVARGYWHEDR
                     RLWRFISPLIAASVAFAIGALIQSKLISFAVSSRAPGIVGTGFLVGYFGDQAVAKLHE
                     IANVLFGTSTRSS"
     misc_feature    complement(join(201605..201673,201683..201751,
                     201788..201856,201899..201967))
                     /locus_tag="BCAL0180"
                     /note="4 probable transmembrane helices predicted for
                     BCAL0180 by TMHMM2.0 at aa 94-116, 131-153, 166-188 and
                     192-214"
                     /inference="protein motif:TMHMM:2.0"
     CDS             complement(202239..202880)
                     /transl_table=11
                     /locus_tag="BCAL0181"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0181"
                     /db_xref="EnsemblGenomes-Tr:CAR50490"
                     /db_xref="InterPro:IPR036265"
                     /db_xref="UniProtKB/TrEMBL:B4EEA6"
                     /protein_id="CAR50490.1"
                     /translation="MKNRCRFCAVSEDQRSFGAADTKLASDGHYFAIPSIGSLVEGWT
                     LIVPNEHCVSLRAHYGNSDFGAFVADVAGKVRDIYGSVIAFEHGANHEGSATGCGTDH
                     AHLHIVPFDGIDVRDLDSSGVMFHPMDTADIAQVVGSSEYLAFFPDIVAKPTYALVAI
                     LDTSISQFFRRLIGHKLGLSAEEIDYRKSPRLDVASATVAALTPAFETATENE"
     CDS             complement(203211..204338)
                     /transl_table=11
                     /locus_tag="BCAL0182"
                     /product="putative plasmid recombinase"
                     /db_xref="EnsemblGenomes-Gn:BCAL0182"
                     /db_xref="EnsemblGenomes-Tr:CAR50491"
                     /db_xref="GOA:B4EEA7"
                     /db_xref="InterPro:IPR002104"
                     /db_xref="InterPro:IPR010998"
                     /db_xref="InterPro:IPR011010"
                     /db_xref="InterPro:IPR013762"
                     /db_xref="UniProtKB/TrEMBL:B4EEA7"
                     /protein_id="CAR50491.1"
                     /translation="MATITKRGPYQWRAQVRRHGYPAQSKTFNTKVEAEAWANMIESE
                     MSRGVWISRSEAEATTLFEALKRYEKEVSSMKKGTAQELSVLKACTLVDLAKRPLAAI
                     RSADLAKLRDEWLKDYKPATVLRRLAVLSHVFNIARKEWGMENLSNPVELVRKPQPNN
                     ARTRRITDAEPIVDALAQGESDRRARQGELECLVAASESTFLPSIVWLAVETAMRRGE
                     IVNLRWEHVDLKRRVAHLPVTKNGSARDVPLSPRAVAVLQALKDARDGTGSKTTGATD
                     DADVGRVFEIRGDAVTRAFERAVVRARTNYLDACREAGQRPDRTFLTDLRFHDLRHEA
                     TSRLASIFPMHELTKITGHKDPRMLMRYYHPRAEDLAKRLI"
     misc_feature    complement(203223..203762)
                     /locus_tag="BCAL0182"
                     /note="HMMPfam hit to PF00589, Phage integrase family,
                     score 3e-28"
                     /inference="protein motif:HMMPfam:PF00589"
     repeat_region   204430..204476
                     /note="Perfect repeat flanking genomic island, 3-prime
                     fragement of tRNA Ala"
     CDS             complement(204567..205964)
                     /transl_table=11
                     /gene="gudD"
                     /locus_tag="BCAL0183"
                     /product="putative glucarate dehydratase"
                     /EC_number="4.2.1.40"
                     /db_xref="EnsemblGenomes-Gn:BCAL0183"
                     /db_xref="EnsemblGenomes-Tr:CAR50492"
                     /db_xref="GOA:B4EEA8"
                     /db_xref="InterPro:IPR013342"
                     /db_xref="InterPro:IPR029017"
                     /db_xref="InterPro:IPR029065"
                     /db_xref="InterPro:IPR034593"
                     /db_xref="InterPro:IPR034598"
                     /db_xref="InterPro:IPR036849"
                     /db_xref="UniProtKB/TrEMBL:B4EEA8"
                     /protein_id="CAR50492.1"
                     /translation="MSEPSRAGTPRVTRMQVIPVAGRDSMLLNLCGAHAPYFTRNLVI
                     LDDSSGHTGVGEVPGGEGIRHALERMTDLVVGQSIGRYQATLNAVRAALSGAGAGAGR
                     TIRHEVTSAGEAAVLRQPHEINLRLDNVITAIEAALLDLLGQHLDVPVAALLGEGQQR
                     DAVPMLAYLFYIGDRRRTDLPYRDEAQAPDPWFRLRNEAALTPAAIARQAEAAVERYG
                     FADFKLKGGVMAGADEMEAIAAIKARFPDARTTLDPNGAWSLDEAVALCRGQGHLLAY
                     AEDPCGPEGGYSGREVMAEFRRATGIPTATNMIATDWRQMDHAVRLQAVDIPLADPHF
                     WTMQGSVRLAQLCRDWGLTWGSHSNNHFDVSLAMFTHAAAAAPGKITAIDTHWIWQEG
                     DARLTRESLAIVGGKVAVPERPGLGIELDIAQVEAAHALYNAVGGTARDDAVAMRYLV
                     PGWTYDPKRPSLGRV"
     CDS             complement(206027..207367)
                     /transl_table=11
                     /gene="gudP"
                     /locus_tag="BCAL0184"
                     /product="putative glucarate transporter"
                     /db_xref="EnsemblGenomes-Gn:BCAL0184"
                     /db_xref="EnsemblGenomes-Tr:CAR50493"
                     /db_xref="GOA:B4EEA9"
                     /db_xref="InterPro:IPR000849"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="InterPro:IPR036259"
                     /db_xref="UniProtKB/TrEMBL:B4EEA9"
                     /protein_id="CAR50493.1"
                     /translation="MNPLHALPASASATARRTRVRWLVLAVLFAVTTINYADRAAIAI
                     AGPALARSMHLTHVQMGFIFSAFGWSYVVAQLPGGWLLDRFGSRIVYAFSIFFWSLFT
                     LLQGGIGFFGGAAAFALLFGLRFLVGAAEAPSFPANSRIVSTWFPAPERGTASAIFNA
                     AQYAATVVFAPLMGWLVHAFGWQSVFAVMGVLGFALVLVWNRTMYDPKDHPGINRAEL
                     DYLTEGGALVNIDQAIGGRDGGPSLHHVKALLRNRMLVGVYVAQYCINALTYFFITWF
                     PVYLVQARGMSILNAGLVASIPAVCGFLGGILGGVVSDALLRQGRSLSIARKVPIVIG
                     MLLSMSMIVCNYTDSHVLVVVFMALSFFGKGLGALGWAVNADTAPRQIAGLSGALLNT
                     CGNLSSITTPIAIGYIVDRSGSFNGALVYVVAHALVAVICYLFVVGEIRRVELQ"
     misc_feature    complement(join(206048..206116,206144..206212,
                     206249..206317,206327..206395,206429..206497,
                     206540..206608,206765..206833,207017..207085,
                     207122..207190,207233..207301))
                     /gene="gudP"
                     /locus_tag="BCAL0184"
                     /note="10 probable transmembrane helices predicted for
                     BCAL0184 by TMHMM2.0 at aa 23-45, 60-82, 95-117, 179-201,
                     254-276, 291-313, 325-347, 351-373, 386-408 and 418-440"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    complement(206138..207286)
                     /gene="gudP"
                     /locus_tag="BCAL0184"
                     /note="HMMPfam hit to PF07690, Major Facilitator
                     Superfamily, score 2.2e-55"
                     /inference="protein motif:HMMPfam:PF07690"
     CDS             complement(207582..208505)
                     /transl_table=11
                     /locus_tag="BCAL0185"
                     /product="LysR family regulatory protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0185"
                     /db_xref="EnsemblGenomes-Tr:CAR50494"
                     /db_xref="GOA:B4EEB0"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="InterPro:IPR036388"
                     /db_xref="InterPro:IPR036390"
                     /db_xref="UniProtKB/TrEMBL:B4EEB0"
                     /protein_id="CAR50494.1"
                     /translation="MWTLEVNLNDLYLFVQAVDAGSMSAAARRLDLPKSTVSKRVAEL
                     ERTLGARLVHRTSRSFRLTPVGAEFFEHARAAVIEADSARDAVLRQAAEPAGVVRITS
                     SVPVAQHILAPCLPALAIAHPKLLLQIHASDRLVDIAQEGFDIAVRSHFAPLPDSALV
                     QRPLAASPIVVVAAPAYLARAGTPDTPADLAQHDGLHPGPQPWRLQRGGDAVDVTPRL
                     RLQADESTLLLQAATAGLGLACLPDWIAGAALASGTLVRVLPGWCAGTVTTTLLMPHR
                     RGQLPGVRAAVEFLAQHVARHHGSGPDDARA"
     misc_feature    complement(207621..208235)
                     /locus_tag="BCAL0185"
                     /note="HMMPfam hit to PF03466, LysR substrate binding
                     domain, score 2.7e-44"
                     /inference="protein motif:HMMPfam:PF03466"
     misc_feature    complement(207786..207818)
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
                     /inference="protein motif:Prosite:PS00013"
     misc_feature    complement(208305..208484)
                     /locus_tag="BCAL0185"
                     /note="HMMPfam hit to PF00126, Bacterial regulatory
                     helix-turn-helix, score 2.5e-18"
                     /inference="protein motif:HMMPfam:PF00126"
     misc_feature    complement(208350..208442)
                     /note="PS00044 Bacterial regulatory proteins, lysR family
                     signature."
                     /inference="protein motif:Prosite:PS00044"
     misc_feature    complement(208380..208445)
                     /note="Predicted helix-turn-helix motif with score
                     1533.000, SD 4.41 at aa 21-42, sequence
                     GSMSAAARRLDLPKSTVSKRVA"
                     /inference="protein motif:helixturnhelix:EMBOSS"
     CDS             208597..209328
                     /transl_table=11
                     /locus_tag="BCAL0186"
                     /product="putative glutathione S-transferase"
                     /db_xref="EnsemblGenomes-Gn:BCAL0186"
                     /db_xref="EnsemblGenomes-Tr:CAR50495"
                     /db_xref="GOA:B4EEB1"
                     /db_xref="InterPro:IPR004045"
                     /db_xref="InterPro:IPR004046"
                     /db_xref="InterPro:IPR010987"
                     /db_xref="InterPro:IPR036249"
                     /db_xref="InterPro:IPR036282"
                     /db_xref="InterPro:IPR040079"
                     /db_xref="UniProtKB/TrEMBL:B4EEB1"
                     /protein_id="CAR50495.1"
                     /translation="MSPILLYGIPAGCSFGSIVALEWTGRPYRLSRITMPGAVTSDAF
                     LALNPVAETPAFVTANGDVLTESIAILGHIGAQALDSGLAFRQGSAAFDRLNRMLAWL
                     NTTFFNAFGALWYVYEHDTEGAEKAALQAYGRGKVLKAHRQLEALLERGEGPWLLGAR
                     RTLADAYFTGIARWADYHAVFEPDAFPRVAALRARLADDAGVQFAHAIEENLPPPASS
                     AFEGHVSLDDALASARDIVVSARVV"
     sig_peptide     208597..208656
                     /locus_tag="BCAL0186"
                     /note="Signal peptide predicted for BCAL0186 by SignalP
                     2.0 HMM (Signal peptide probability 0.622) with cleavage
                     site probability 0.577 between residues 20 and 21"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    208600..208824
                     /locus_tag="BCAL0186"
                     /note="HMMPfam hit to PF02798, Glutathione S-transferase,
                     N-terminal domain, score 0.012"
                     /inference="protein motif:HMMPfam:PF02798"
     misc_feature    208909..209196
                     /locus_tag="BCAL0186"
                     /note="HMMPfam hit to PF00043, Glutathione S-transferase,
                     C-terminal domain, score 1.3e-05"
                     /inference="protein motif:HMMPfam:PF00043"
     CDS             209455..210087
                     /transl_table=11
                     /locus_tag="BCAL0187"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0187"
                     /db_xref="EnsemblGenomes-Tr:CAR50496"
                     /db_xref="InterPro:IPR018715"
                     /db_xref="UniProtKB/TrEMBL:B4EEB2"
                     /protein_id="CAR50496.1"
                     /translation="MTSPTLLPSYTAFDGHRRLASGPLATVALAVRQAAGDAMPGTIL
                     IFDDATGRSIDLDLRGTADDIRARYAAPAADASSGAGEPAGAGAAEQRGRGRPKLGVV
                     SREVTLLPRHWEWLGAQPGGASVALRKLVEDARRTHAAADRQRDAQARAYHFMSAMAG
                     DLPGFEEAARALYANDAARLAELIAGWPDDVRDHALALARGDLPPAAEDC"
     CDS             210103..211440
                     /transl_table=11
                     /locus_tag="BCAL0188"
                     /product="putative dioxygenase"
                     /db_xref="EnsemblGenomes-Gn:BCAL0188"
                     /db_xref="EnsemblGenomes-Tr:CAR50497"
                     /db_xref="GOA:B4EEB3"
                     /db_xref="InterPro:IPR004294"
                     /db_xref="UniProtKB/TrEMBL:B4EEB3"
                     /protein_id="CAR50497.1"
                     /translation="MTVFDLNRGALAPVADEVDVVELRVTGAIPRELDGTLLRNGPNP
                     PGGRFDGNDMLSWWPEAAMLHAIAFDDGRAAGYRNRWARTRRWAAVHAPGQAPQLPDT
                     NPNVNVLQHAGELLALAEGGAPLAITAALDSFGAPTRHAGIDGGMTAHPKVDPVTGEL
                     ILFRADWRAPWLRYGVIDATGVTRVDVEIELGAPAMMHDLAITETRSLLLDLNVGYDF
                     SLLQHGHRMPLRWHDDRPARIGVLPRHGGDVRWFGVEPCFIQHVVNAYDCDASCLVLD
                     AVRYPSFLRLDARTGRFADNPVGELWRYVIDTANGLIDEGPLADGGIELPRINESRTG
                     RGYRYLYAVEQPNNAEMRGVMRFDHARGTTTHYAVPAGDQNGEPVFVPRPGGADEDDG
                     WLLVMVYRAATDTSDVVILDARAIDAGPVATVHLPRRVPAGFHGAWVPRERRA"
     misc_feature    210103..211425
                     /locus_tag="BCAL0188"
                     /note="HMMPfam hit to PF03055, Retinal pigment epithelial
                     membrane protein, score 9e-87"
                     /inference="protein motif:HMMPfam:PF03055"
     CDS             complement(211454..212620)
                     /transl_table=11
                     /locus_tag="BCAL0189"
                     /product="putative ABC transporter permease protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0189"
                     /db_xref="EnsemblGenomes-Tr:CAR50498"
                     /db_xref="GOA:B4EEB4"
                     /db_xref="InterPro:IPR003838"
                     /db_xref="InterPro:IPR025857"
                     /db_xref="UniProtKB/TrEMBL:B4EEB4"
                     /protein_id="CAR50498.1"
                     /translation="MAIPLTYIARNLWTRRLTTALTAGGMALVIFVFATVQMLDAGLT
                     KTLVSTGEPDNAVVIRKGAETEIQSSIDHQQANALEMHPAVALGPDGRPLVSKEAVVL
                     ISLVKTSTGKPSNVVIRGVSPAGLALRPHVKLVAGRPFAPGSSEIVVGSAIAKGFSGT
                     QLGDRLHFAQRDWTIVGIFDAGGSGFDSEIWGDVDQLMQSFRRTSYSSMVLRIPSADG
                     FARFKADIDVDPRLTDEAKREQTFYGDQSKALSTFINILGITLSTIFSIAAMIGAMIT
                     MYASVANRVAEIGTLRALGFKRTSVLAAFLLEALLLGFVGGVAGLACASLMQFASFST
                     TNFQTFSDLSFRFVLTPAIVVKTLVFSLVMGLVGGFLPAMRAARLKIVDALRAQ"
     misc_feature    complement(211478..212005)
                     /locus_tag="BCAL0189"
                     /note="HMMPfam hit to PF02687, Predicted permease, score
                     1.9e-29"
                     /inference="protein motif:HMMPfam:PF02687"
     misc_feature    complement(join(211508..211576,211652..211720,
                     211778..211846,212504..212572))
                     /locus_tag="BCAL0189"
                     /note="4 probable transmembrane helices predicted for
                     BCAL0189 by TMHMM2.0 at aa 17-39, 259-281, 301-323 and
                     349-371"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    complement(211652..211684)
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
                     /inference="protein motif:Prosite:PS00013"
     sig_peptide     complement(212519..212620)
                     /locus_tag="BCAL0189"
                     /note="Signal peptide predicted for BCAL0189 by SignalP
                     2.0 HMM (Signal peptide probability 0.959) with cleavage
                     site probability 0.453 between residues 34 and 35"
                     /inference="protein motif:SignalP:2.0"
     CDS             complement(212629..213783)
                     /transl_table=11
                     /locus_tag="BCAL0190"
                     /product="putative ABC transporter permease protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0190"
                     /db_xref="EnsemblGenomes-Tr:CAR50499"
                     /db_xref="GOA:B4EEB5"
                     /db_xref="InterPro:IPR003838"
                     /db_xref="InterPro:IPR025857"
                     /db_xref="UniProtKB/TrEMBL:B4EEB5"
                     /protein_id="CAR50499.1"
                     /translation="MYVLKLIARNALRHRLRTLLTVLGLTIAVLAFGLLHTVVDAWYA
                     GAAAASSGRLVTRNAISLVFPLPVSYENRIRGVDGVTAVVRSNWFGGIYRDPKNFFAS
                     FAVSENYLDLYPEFILPAQQRADYDRDRRGCLVGRQLATQFGFKVGDVIPLKGTIYPG
                     TWDFVVRGILDGRDDSTITRQLVFHWDYLNETVRKRTPKQADQVGVFVLGVANPDDGA
                     SIARNVDAVFKNSLAETLTETEQAFQLGFVAMSNQIIAAIRLVSYVVILIIMAVMANA
                     MAMSARERTAEYATLKALGFGPGFLALIVFGESVVIAVAGGGLGILATPPAASLFKQA
                     AGGIFPVFKVSTETIVLQAACSVAVGLAAALVPAWQAARVRVVEGLRAIG"
     misc_feature    complement(212656..213174)
                     /locus_tag="BCAL0190"
                     /note="HMMPfam hit to PF02687, Predicted permease, score
                     2.2e-22"
                     /inference="protein motif:HMMPfam:PF02687"
     misc_feature    complement(join(212671..212739,212821..212889,
                     212950..213018,213655..213723))
                     /locus_tag="BCAL0190"
                     /note="4 probable transmembrane helices predicted for
                     BCAL0190 by TMHMM2.0 at aa 21-43, 256-278, 299-321 and
                     349-371"
                     /inference="protein motif:TMHMM:2.0"
     sig_peptide     complement(213637..213783)
                     /locus_tag="BCAL0190"
                     /note="Signal peptide predicted for BCAL0190 by SignalP
                     2.0 HMM (Signal peptide probability 0.994) with cleavage
                     site probability 0.458 between residues 49 and 50"
                     /inference="protein motif:SignalP:2.0"
     CDS             complement(213805..214503)
                     /transl_table=11
                     /locus_tag="BCAL0191"
                     /product="ABC transporter ATP-binding protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0191"
                     /db_xref="EnsemblGenomes-Tr:CAR50500"
                     /db_xref="GOA:B4EEB6"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:B4EEB6"
                     /protein_id="CAR50500.1"
                     /translation="MNDAPPPLVELSHVAKSYRRGNQIVPVLTDITLDIGEGDFVALM
                     GPSGSGKSTLLNLVAGIDRPDSGELRVGGLDISQLAEAQLAEWRAANVGFIFQFYNLM
                     PVLTAFENVELPLMLTHLSRRERRERVELVLDMVNLGDRTSHYPSELSGGQQQRVAIA
                     RALITDPVLIVADEPTGDLDRASATDVLAMLQRMNAELGKTIIMVTHDAHAAGAARSL
                     VHLEKGELIDGHAG"
     misc_feature    complement(213832..214392)
                     /locus_tag="BCAL0191"
                     /note="HMMPfam hit to PF00005, ABC transporter, score
                     4e-62"
                     /inference="protein motif:HMMPfam:PF00005"
     misc_feature    complement(214015..214059)
                     /note="PS00211 ABC transporters family signature."
                     /inference="protein motif:Prosite:PS00211"
     misc_feature    complement(214348..214371)
                     /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
                     /inference="protein motif:Prosite:PS00017"
     CDS             complement(214509..215714)
                     /transl_table=11
                     /locus_tag="BCAL0192"
                     /product="transporter system transport protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0192"
                     /db_xref="EnsemblGenomes-Tr:CAR50501"
                     /db_xref="GOA:B4EEB7"
                     /db_xref="InterPro:IPR006143"
                     /db_xref="InterPro:IPR032317"
                     /db_xref="UniProtKB/TrEMBL:B4EEB7"
                     /protein_id="CAR50501.1"
                     /translation="MPDHNLDKLKIDRRPIAPVPRRRRWARYAVAAALIVVAIVAGLA
                     LTGRPTVDTTSVTSAYPYQNDTQLNATGYVVPQRKAAVASKGQGRVEWLGVLEGTRVK
                     KDEIIARLESNDVQASLAQARAQVQVSRANFGVAQAELKDAEIALRRTSALAPKGAVP
                     AAQLDTDTARVNKARATLASDQAAIVSAEANAQAAQVAVDQTVIRAPFDGIVLAKHAN
                     VGDNITPFSSASDSKGAVVTIADMDTLEVEADVAESNIAKIRAEQPCEIQLDALPDMR
                     FAGRVSRIVPTVDRSKATVLVKVRFVDRDERVLPDMSAKIAFLSKPATPQDRQPVTAV
                     QASAVVERDGRPAVFVVKDDSAHAVAVTRGMRIGELVAVRGVKPGDTVVLAPDAKLKD
                     GAKVTVAKK"
     misc_feature    complement(214698..215483)
                     /locus_tag="BCAL0192"
                     /note="HMMPfam hit to PF00529, HlyD family secretion
                     protein, score 5.5e-05"
                     /inference="protein motif:HMMPfam:PF00529"
     misc_feature    complement(215574..215642)
                     /locus_tag="BCAL0192"
                     /note="1 probable transmembrane helix predicted for
                     BCAL0192 by TMHMM2.0 at aa 25-47"
                     /inference="protein motif:TMHMM:2.0"
     sig_peptide     complement(215577..215714)
                     /locus_tag="BCAL0192"
                     /note="Signal peptide predicted for BCAL0192 by SignalP
                     2.0 HMM (Signal peptide probability 0.678) with cleavage
                     site probability 0.506 between residues 46 and 47"
                     /inference="protein motif:SignalP:2.0"
     CDS             216073..216306
                     /transl_table=11
                     /locus_tag="BCAL0193"
                     /product="putative exported protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0193"
                     /db_xref="EnsemblGenomes-Tr:CAR50502"
                     /db_xref="UniProtKB/TrEMBL:B4EEB8"
                     /protein_id="CAR50502.1"
                     /translation="MKKTLASIIAAAFALASVSAFAQASAPAADTSAAAPAPAKKDHS
                     KPKHQLKHHGSKKGQAKAAAASAAGTNDAGTQN"
     sig_peptide     216073..216138
                     /locus_tag="BCAL0193"
                     /note="Signal peptide predicted for BCAL0193 by SignalP
                     2.0 HMM (Signal peptide probability 1.000) with cleavage
                     site probability 0.875 between residues 22 and 23"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    216085..216153
                     /locus_tag="BCAL0193"
                     /note="1 probable transmembrane helix predicted for
                     BCAL0193 by TMHMM2.0 at aa 5-27"
                     /inference="protein motif:TMHMM:2.0"
     CDS             complement(216387..217157)
                     /transl_table=11
                     /locus_tag="BCAL0193a"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0193a"
                     /db_xref="EnsemblGenomes-Tr:CAR50503"
                     /db_xref="InterPro:IPR002782"
                     /db_xref="InterPro:IPR016155"
                     /db_xref="InterPro:IPR027798"
                     /db_xref="UniProtKB/TrEMBL:B4EEB9"
                     /protein_id="CAR50503.1"
                     /translation="MATATFRFHGELNAFLARPQRDRAFAHACARDATVKHAIEALGV
                     PHTEIGRLYVNDAPAALDRPLDDGDRVEVLPERAGPAANGATGPPPAAWRFVADAHLG
                     GLAQLLRLAGFDTCYDNHYRDDELAALAERENRIVLTRDRELLKRRAVVRGCYLHAQR
                     PADQLHELFERLDLAPHMRPFRLCLRCNAPLHPLDAAAAAPRVPAGVRLRHRRFAACD
                     VCRRVFWEGSHWRRMRAVVDAMRAPPPVRADEPGESGA"
     misc_feature    complement(216432..216881)
                     /locus_tag="BCAL0193a"
                     /note="HMMPfam hit to PF01927, Protein of unknown function
                     DUF82, score 1.8e-30"
                     /inference="protein motif:HMMPfam:PF01927"
     CDS             217254..218123
                     /transl_table=11
                     /locus_tag="BCAL0194"
                     /product="putative oxidoreductase"
                     /note="C-terminus is similar to Escherichia coli, and
                     Escherichia coli O6 2-hydroxy-3-oxopropionate reductase
                     GarR or b3125 or c3880 SWALL:GARR_ECOLI (SWALL:P23523)
                     (294 aa) fasta scores: E(): 8e-14, 27.66% id in 282 aa,
                     and C-terminus is similar to Xanthomonas campestris
                     dehydrogenase xcc0308 SWALL:Q8PDM7 (EMBL:AE012127) (291
                     aa) fasta scores: E(): 1.3e-48, 53.1% id in 290 aa"
                     /db_xref="EnsemblGenomes-Gn:BCAL0194"
                     /db_xref="EnsemblGenomes-Tr:CAR50504"
                     /db_xref="GOA:B4EEC0"
                     /db_xref="InterPro:IPR006115"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR013328"
                     /db_xref="InterPro:IPR015815"
                     /db_xref="InterPro:IPR029154"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="UniProtKB/TrEMBL:B4EEC0"
                     /protein_id="CAR50504.1"
                     /translation="MDLGFIGLGEMGQAIATNLLKAGHTVRVWNRSRERAEPLAAFGA
                     QIVDTPADAFRGDAVFSMLGDDAAARAVFDDALLAQAPRGLIHVNMATVSVALAESLA
                     HAHASRGIDYVAAPVMGRPDVAAAARLTIMAGGPAEAIDRVQPLFDAIGQKTWRFGSL
                     PQHANVAKIAANFTLASAIETLGEASALLGAHGVAMRDFLDVITSSVFPGPVYEGYGA
                     MIAERRYEPARFKARLGLKDVRLALEAGDATSVPLPVASVVRDSLLDALAHGGGDQDF
                     AVLGEAALRRAGR"
     misc_feature    217254..217730
                     /locus_tag="BCAL0194"
                     /note="HMMPfam hit to PF03446, NAD binding domain of
                     6-phosphogluconat, score 2.3e-44"
                     /inference="protein motif:HMMPfam:PF03446"
     misc_feature    217257..217766
                     /locus_tag="BCAL0194"
                     /note="HMMPfam hit to PF03807, NADP oxidoreductase
                     coenzyme F420-depen, score 0.00017"
                     /inference="protein motif:HMMPfam:PF03807"
     CDS             218197..218832
                     /transl_table=11
                     /locus_tag="BCAL0195"
                     /product="putative amino acid transport protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0195"
                     /db_xref="EnsemblGenomes-Tr:CAR50505"
                     /db_xref="GOA:B4EEC1"
                     /db_xref="InterPro:IPR001123"
                     /db_xref="UniProtKB/TrEMBL:B4EEC1"
                     /protein_id="CAR50505.1"
                     /translation="MNLHTWWLFVATVFVVSAIPGPNMLLVMTHGARHGLRRSSATMA
                     GCLSALVLMLAVSAAGLGAVLEAWPAMFNGLRFAGAAYLIYLGVKAWRARVDDTPAAD
                     VDAVSHGASASRAVLFRNGFLVAGSNPKAILFAAALLPQFINAAEPTLPQFGILVVTF
                     AVIEVSWYLVYASFGTRIGATLKSQSVAKVFNRLTGGLFVGFGAMMALVRH"
     sig_peptide     218197..218370
                     /locus_tag="BCAL0195"
                     /note="Signal peptide predicted for BCAL0195 by SignalP
                     2.0 HMM (Signal peptide probability 0.661) with cleavage
                     site probability 0.311 between residues 58 and 59"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    join(218209..218277,218314..218382,218395..218454,
                     218557..218625,218653..218721,218755..218823)
                     /locus_tag="BCAL0195"
                     /note="6 probable transmembrane helices predicted for
                     BCAL0195 by TMHMM2.0 at aa 5-27, 40-62, 67-86, 121-143,
                     153-175 and 187-209"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    218236..218826
                     /locus_tag="BCAL0195"
                     /note="HMMPfam hit to PF01810, LysE type translocator,
                     score 4.5e-32"
                     /inference="protein motif:HMMPfam:PF01810"
     CDS             complement(218924..220207)
                     /transl_table=11
                     /locus_tag="BCAL0196"
                     /product="Major Facilitator Superfamily protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0196"
                     /db_xref="EnsemblGenomes-Tr:CAR50506"
                     /db_xref="GOA:B4EEC2"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="InterPro:IPR036259"
                     /db_xref="UniProtKB/TrEMBL:B4EEC2"
                     /protein_id="CAR50506.1"
                     /translation="MNCPAHRCTAPVSPSVAAPPALSTGMTLFFAATVGVIVMDLFAA
                     QPLTGPISADLHLPPGLAGLVAMLPQLGYAAGLALLVPLVDLFENRRLIVATLAVCAA
                     ALALPAFTQSGTVFLLATLVAGAASSVIQMLVPMAASMAPEAQRGRAVGNVMSGLMLG
                     ILLSRPLASLIAGSAGWRAFYLLAALANAAIAVVLALRLPARTPSITAGYRALLASMG
                     RLLADEPVLRRHALSAALAMAAFSAFWTAVGLRLAQPPFALDLHGIALFAFAGASGAI
                     VTPLAGRAGDRGHGPAAQRLAHGTMLAALVVLGVAGAGWFGFDAHAHRGVALALLAGG
                     AALLDAGVIVDQTIGRREINLLNPAARGRLNGLFVGLFFCGGALGAALAGSAWAWGGW
                     SAVCGVGFAFAGATAVFGLVAGRGAGAAALDRPRG"
     misc_feature    complement(join(218969..219037,219047..219115,
                     219176..219244,219254..219322,219359..219427,
                     219464..219532,219617..219685,219695..219763,
                     219797..219865,219878..219937,219956..220024,
                     220082..220150))
                     /locus_tag="BCAL0196"
                     /note="12 probable transmembrane helices predicted for
                     BCAL0196 by TMHMM2.0 at aa 20-42, 62-84, 91-110, 115-137,
                     149-171, 175-197, 226-248, 261-283, 296-318, 322-344,
                     365-387 and 391-413"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    complement(219044..220120)
                     /locus_tag="BCAL0196"
                     /note="HMMPfam hit to PF07690, Major Facilitator
                     Superfamily, score 4e-27"
                     /inference="protein motif:HMMPfam:PF07690"
     misc_feature    complement(219173..219205)
                     /note="PS00136 Serine proteases, subtilase family,
                     aspartic acid active site."
                     /inference="protein motif:Prosite:PS00136"
     sig_peptide     complement(220139..220207)
                     /locus_tag="BCAL0196"
                     /note="Signal peptide predicted for BCAL0196 by SignalP
                     2.0 HMM (Signal peptide probability 0.643) with cleavage
                     site probability 0.325 between residues 23 and 24"
                     /inference="protein motif:SignalP:2.0"
     CDS             220305..221234
                     /transl_table=11
                     /locus_tag="BCAL0197"
                     /product="LysR family regulatory protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0197"
                     /db_xref="EnsemblGenomes-Tr:CAR50507"
                     /db_xref="GOA:B4EEC3"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="InterPro:IPR036388"
                     /db_xref="InterPro:IPR036390"
                     /db_xref="UniProtKB/TrEMBL:B4EEC3"
                     /protein_id="CAR50507.1"
                     /translation="MNTRDLQAFVAVVDSGSMVAAAAKLHLTQPGLTRRVQNLETLLG
                     VPLLERQSKPLKPTAAGRDVYALARNVLGAVDELMAAGAPDSEPSGELRIGVPPFLSE
                     LALERPIDRLRDAFPRLTLRVTAGWSPALVQGIERGALDVATVMVPASATLPDALTAT
                     LLATQPTVLVAARDFPLPDGPLSLDTLSGFPWVLSQDGCGMRSALSRALGAAGLPFDV
                     AVEAFGSELQLSLVARGAGIGIAPPNALARSAHRDALRIVETAGLETRINVWIVHGAL
                     PGRLMRPVALLRDALGEVLERENGTGSGAVTAD"
     misc_feature    220311..220490
                     /locus_tag="BCAL0197"
                     /note="HMMPfam hit to PF00126, Bacterial regulatory
                     helix-turn-helix, score 6.4e-21"
                     /inference="protein motif:HMMPfam:PF00126"
     misc_feature    220353..220445
                     /note="PS00044 Bacterial regulatory proteins, lysR family
                     signature."
                     /inference="protein motif:Prosite:PS00044"
     misc_feature    220557..221192
                     /locus_tag="BCAL0197"
                     /note="HMMPfam hit to PF03466, LysR substrate binding
                     domain, score 2.9e-36"
                     /inference="protein motif:HMMPfam:PF03466"
     CDS             complement(221419..222255)
                     /transl_table=11
                     /locus_tag="BCAL0198"
                     /product="putative outer membrane protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0198"
                     /db_xref="EnsemblGenomes-Tr:CAR50508"
                     /db_xref="GOA:B4EEC4"
                     /db_xref="InterPro:IPR005618"
                     /db_xref="InterPro:IPR011250"
                     /db_xref="UniProtKB/TrEMBL:B4EEC4"
                     /protein_id="CAR50508.1"
                     /translation="MMKKTLLCAAAGAAAVAPLAAHAQSAGSNVVTLGWFHIMPQQSS
                     TPMTTNVAPTPINTPLRLPPSFTSPGTGLHTSGADTVGLTVSHFLTDHIAVTSVAGVP
                     PVFKVSGQGTIKPPGPAGALGTQNIGLGSVNPIVKSVRQWSPAVILQYYFGQATAKFR
                     PFLGLGVSYNWFSDLQLNTNFIKQTQDNLGAILAAGAGKPGTTSVEAKASSSWQPVFN
                     AGLQYNMTEHFGLVASVTYIPLKTTSTVTIKAADGSVLAESKSDLKADPIISYVGMTY
                     KF"
     misc_feature    complement(221422..222135)
                     /locus_tag="BCAL0198"
                     /note="HMMPfam hit to PF03922, OmpW family, score 6.6e-12"
                     /inference="protein motif:HMMPfam:PF03922"
     sig_peptide     complement(222187..222255)
                     /locus_tag="BCAL0198"
                     /note="Signal peptide predicted for BCAL0198 by SignalP
                     2.0 HMM (Signal peptide probability 1.000) with cleavage
                     site probability 0.995 between residues 23 and 24"
                     /inference="protein motif:SignalP:2.0"
     CDS             complement(222271..223512)
                     /transl_table=11
                     /locus_tag="BCAL0199"
                     /product="putative lipoprotein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0199"
                     /db_xref="EnsemblGenomes-Tr:CAR50509"
                     /db_xref="InterPro:IPR021340"
                     /db_xref="UniProtKB/TrEMBL:B4EEC5"
                     /protein_id="CAR50509.1"
                     /translation="MKRNLILAAALAAPLLSACGGGSDNPPPLVEDRLCPATLDYNTV
                     FTGGAGSGELAKVQLDTTKMTWQVTYVESPVPQKTGTVVPTRAGTVDSGTLTQETLLP
                     TNKLNQCAFRLNGASLDASRPARIFVGFGVAGGTIPGKEIQFDGVLGQAAVPDTKFPY
                     YPFIGFSSIETDITKVAGTYSHIGFGEVPSQKFAPASIDAKVTINADGTWTKCDTTGQ
                     FAGGACVQQGTNFVQSADGSGAFQSNNYRSQLKPTLSATPQGKGFMIVGKLRNQLVPI
                     LVRTGVANPNPTPDSNGVPGLTADDESSISILAPQTAVAAGSQNGEYIGVDSQFDYRT
                     TALIDKQATLLDPFQPSQASLATALDLDYTQKVPGTVTTIHTGSGSTSPTGKFIFTGG
                     VFGFLDNAGSTPYFTIGAFVQ"
     sig_peptide     complement(223444..223512)
                     /locus_tag="BCAL0199"
                     /note="Signal peptide predicted for BCAL0199 by SignalP
                     2.0 HMM (Signal peptide probability 1.000) with cleavage
                     site probability 0.271 between residues 23 and 24"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    complement(223456..223488)
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
                     /inference="protein motif:Prosite:PS00013"
     CDS             complement(223661..225091)
                     /transl_table=11
                     /locus_tag="BCAL0200"
                     /product="putative lipoprotein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0200"
                     /db_xref="EnsemblGenomes-Tr:CAR50510"
                     /db_xref="InterPro:IPR021340"
                     /db_xref="UniProtKB/TrEMBL:B4EEC6"
                     /protein_id="CAR50510.1"
                     /translation="MSHALSKGVATAFAIAPFLVACGGGDSGGALAPIDAPQCSGSSC
                     GTQGPPPSQPINGALCPANADIVKSTYLGGAGSGEIVSVNIDAVAMTYTLKWLESPIP
                     LKTGTVTPSRAGTTITGKVVHPPTGTLPTAEQTRCAFVLTPGTGTAPDGSTYSTAADF
                     NQANPPMLLVGMGVAGGGIPGATVQYDGLTISVIGLPVFQNVGQVPNRHFDFYPFLGF
                     ANTTTDLTKLPGTYNALLYHLVPSGNYATKGVNSSETFDANGACTSSGSGGCQTTGDP
                     WKTSANGGYFDSTQAPQILPQTKLPLIGATGKSATAHMVIGQLNGATVPVIVRTGYVN
                     LGTPPLHTDAKVDDESGIAVLGAATAITSGAIDGGYAGADSNFKYTAALIRGSNASFI
                     NPSTQAEEDGFTLDYGQATPGLLNAKTTPPSGASYPSASGVVIATGGLYAALIQGTVN
                     GGVTPTSANSTTSSTPYFGVGAQISK"
     misc_feature    complement(224282..224314)
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
                     /inference="protein motif:Prosite:PS00013"
     sig_peptide     complement(224996..225091)
                     /locus_tag="BCAL0200"
                     /note="Signal peptide predicted for BCAL0200 by SignalP
                     2.0 HMM (Signal peptide probability 0.906) with cleavage
                     site probability 0.516 between residues 32 and 33"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    complement(225026..225058)
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
                     /inference="protein motif:Prosite:PS00013"
     CDS             complement(225526..226476)
                     /transl_table=11
                     /gene="argC"
                     /locus_tag="BCAL0201"
                     /product="N-acetyl-gamma-glutamyl-phosphate reductase"
                     /EC_number="1.2.1.38"
                     /db_xref="EnsemblGenomes-Gn:BCAL0201"
                     /db_xref="EnsemblGenomes-Tr:CAR50511"
                     /db_xref="GOA:B4EEC7"
                     /db_xref="InterPro:IPR000534"
                     /db_xref="InterPro:IPR010136"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="UniProtKB/TrEMBL:B4EEC7"
                     /protein_id="CAR50511.1"
                     /translation="MSTKVFVDGQEGTTGLKIFEYLSARSDIEILRIDEAKRKDVDER
                     RRLINASDVTFLCLPDVASRESASLVENPNTTLIDASTAFRTHADWAYGLPELTRAQR
                     EKIRTSKRIAVPGCHASAFVLAMRPLVDAGIVAPTFAAHSYSITGYSGGGKSMIAEYE
                     SAAPGGKLASPRPYALGLAHKHLPEMAAHTGLANAPIFTPIVGPFLKGLAVTTYFTPG
                     QLAKRATPQDVQRVFAEYYADEAFVRVAPFDADANLDSGFFDVQANNDTNRVDLFVFG
                     NAERFVTVARLDNLGKGASGAAIQCMNLNIGAAEDAGLKR"
     misc_feature    complement(226015..226038)
                     /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
                     /inference="protein motif:Prosite:PS00017"
     misc_feature    complement(226162..226467)
                     /gene="argC"
                     /locus_tag="BCAL0201"
                     /note="HMMPfam hit to PF01118, Semialdehyde dehydrogenase,
                     NAD bindin, score 2.8e-06"
                     /inference="protein motif:HMMPfam:PF01118"
     CDS             complement(226668..227240)
                     /transl_table=11
                     /locus_tag="BCAL0202"
                     /product="putative flavoprotein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0202"
                     /db_xref="EnsemblGenomes-Tr:CAR50512"
                     /db_xref="GOA:B4EEC8"
                     /db_xref="InterPro:IPR001226"
                     /db_xref="InterPro:IPR005025"
                     /db_xref="InterPro:IPR008254"
                     /db_xref="InterPro:IPR029039"
                     /db_xref="UniProtKB/TrEMBL:B4EEC8"
                     /protein_id="CAR50512.1"
                     /translation="MSNIVIVYHSGYGHTQKLAEAVHAGAQDAGAAARLLAVGELDDA
                     GWAALDAADAIVFGAPTYMGGPSAQFKQFADATSKPWFTQKWKDKIAAGFTNSATMNG
                     DKFSTIQYFVTLAMQHGMVWVGTGMMPANSKAATRNDINYVGGFTGLLAQSPADATPD
                     EGPLPGDLDTAKAFGRRVAEATARWVAGGR"
     misc_feature    complement(226884..227225)
                     /locus_tag="BCAL0202"
                     /note="HMMPfam hit to PF00258, Flavodoxin, score 0.0005"
                     /inference="protein motif:HMMPfam:PF00258"
     misc_feature    complement(227175..227225)
                     /note="PS00201 Flavodoxin signature."
                     /inference="protein motif:Prosite:PS00201"
     CDS             complement(227455..228051)
                     /transl_table=11
                     /locus_tag="BCAL0203"
                     /product="phosphatidylethanolamine-binding protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0203"
                     /db_xref="EnsemblGenomes-Tr:CAR50513"
                     /db_xref="InterPro:IPR005247"
                     /db_xref="InterPro:IPR008914"
                     /db_xref="InterPro:IPR036610"
                     /db_xref="UniProtKB/TrEMBL:B4E588"
                     /protein_id="CAR50513.1"
                     /translation="MRVDRRITPPAPSGRPSPLRFSALLCAAVFAALPAHAEGPFTVT
                     SDDLTAGARVRPANVFDRGDCKGANRSPQLAWHNPPPGTRGYAVTIFDPDAPGHGWWH
                     WAVAGIPATVTSLPADASASGFLRRIGASEARNDFGIDGYGGPCPPPGKPHRYVITVY
                     ALKGTDLRISQGRPAPMFEHEIGTLAIGTARLTVTYGQ"
     misc_feature    complement(227473..227946)
                     /locus_tag="BCAL0203"
                     /note="HMMPfam hit to PF01161,
                     Phosphatidylethanolamine-binding protein, score 1.3e-06"
                     /inference="protein motif:HMMPfam:PF01161"
     sig_peptide     complement(227941..228051)
                     /locus_tag="BCAL0203"
                     /note="Signal peptide predicted for BCAL0203 by SignalP
                     2.0 HMM (Signal peptide probability 1.000) with cleavage
                     site probability 0.998 between residues 37 and 38"
                     /inference="protein motif:SignalP:2.0"
     CDS             complement(228292..228978)
                     /transl_table=11
                     /gene="pyrE"
                     /locus_tag="BCAL0204"
                     /product="orotate phosphoribosyltransferase"
                     /EC_number="2.4.2.10"
                     /db_xref="EnsemblGenomes-Gn:BCAL0204"
                     /db_xref="EnsemblGenomes-Tr:CAR50514"
                     /db_xref="GOA:B4E589"
                     /db_xref="InterPro:IPR000836"
                     /db_xref="InterPro:IPR004467"
                     /db_xref="InterPro:IPR023031"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="PDB:4OHC"
                     /db_xref="UniProtKB/TrEMBL:B4E589"
                     /protein_id="CAR50514.1"
                     /translation="MTGYDRQSISDTTAKILLEVQAVHFNAEKPFIFTSGWASPVYID
                     CRKLISYPRVRRALMEMAETTITRDIGFEQIDAVAGGETAGIPFAAWIADRMMVPMQY
                     VRKKPKGFGRNAQIEGHLEEGSRVLLVEDLTTDSRSKINFVNALRTAGATVNHCFVLF
                     HYNIFKESVSVLKDIDVDLHALATWWDVLRVAKASGYFETKTLDEVEKFLHAPAEWSA
                     AHGGATAPKE"
     misc_feature    complement(228475..228849)
                     /gene="pyrE"
                     /locus_tag="BCAL0204"
                     /note="HMMPfam hit to PF00156, Phosphoribosyl transferase
                     domain, score 3.9e-17"
                     /inference="protein motif:HMMPfam:PF00156"
     CDS             229439..231709
                     /transl_table=11
                     /locus_tag="BCAL0205"
                     /product="NADP-dependent malic enzyme"
                     /EC_number="1.1.1.40"
                     /db_xref="EnsemblGenomes-Gn:BCAL0205"
                     /db_xref="EnsemblGenomes-Tr:CAR50515"
                     /db_xref="GOA:B4E590"
                     /db_xref="InterPro:IPR001891"
                     /db_xref="InterPro:IPR002505"
                     /db_xref="InterPro:IPR012188"
                     /db_xref="InterPro:IPR012301"
                     /db_xref="InterPro:IPR012302"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="InterPro:IPR037062"
                     /db_xref="InterPro:IPR042112"
                     /db_xref="InterPro:IPR042113"
                     /db_xref="UniProtKB/TrEMBL:B4E590"
                     /protein_id="CAR50515.1"
                     /translation="MDEQLKQAALAYHLNPKPGKISVTPTKPLSNQLDLSLAYSPGVA
                     AACEAIHADPLDAQKYTSRGNLVGVITNGTAVLGLGNIGPLAAKPVMEGKGCLFKKFA
                     GIDVFDIELSESDPDKLVEAIAMLEPTLGGINLEDIKAPECFYIEQKLRERMKIPVFH
                     DDQHGTAIIASAAILNGLKVVGKKLSEVKLVCSGAGAAAIACLDLLVNLGLTKSNILV
                     ADSKGVIYEGRGNLDPSKQRYAANTDARTLADAIVGADVFLGCSSAGVLKQDMVKTMG
                     DKPLILALANPEPEIRPEDAKAVRPDAIVATGRSDYPNQVNNVLCFPFIFRGALDVGA
                     TTITEEMKLACVRAIAELAEETDQSEEVAKAYEGHSLEFGPDYLIPKPFDPRLIIKIA
                     PAVAQAAMDSGVATRPIQDMDAYREQLGATVYRTGMVMRPVFAAAKQKEARIVFAEGE
                     DERVLRAAQFVLLEKIAKPIIVGRPSVVDMRLQKIGSKLKAGVDFEIVDPEDDARYHR
                     YWQAYQEIGARDGVTPEVAKAAMRKFNTLIGAMLVHLGDADGMICGMIDTFHSHLKFI
                     EQVLGRAKGAEHFAAMNLLMLPGRNLFVCDTYVNELPSADQLADMTIQAAAEIERFGI
                     APKAALLSNSNFGSAPSASSRRMAEARKLIVERAPNLEVDGEMHGDAALSELIRKQAF
                     PGTTLSGEANLLIMPNVEAANIAYNLLKMVGGEGVTVGPFLLGAAKPVHILTPAATVR
                     RIINMTAVAAANVNTK"
     misc_feature    229493..229921
                     /locus_tag="BCAL0205"
                     /note="HMMPfam hit to PF00390, Malic enzyme, N-terminal
                     domain, score 3.9e-77"
                     /inference="protein motif:HMMPfam:PF00390"
     misc_feature    229547..229579
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
                     /inference="protein motif:Prosite:PS00013"
     misc_feature    229925..230638
                     /locus_tag="BCAL0205"
                     /note="HMMPfam hit to PF03949, Malic enzyme, NAD binding
                     domain, score 1.6e-127"
                     /inference="protein motif:HMMPfam:PF03949"
     misc_feature    230012..230044
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
                     /inference="protein motif:Prosite:PS00013"
     misc_feature    230720..231688
                     /locus_tag="BCAL0205"
                     /note="HMMPfam hit to PF01515, Phosphate acetyl/butaryl
                     transferase, score 2.1e-108"
                     /inference="protein motif:HMMPfam:PF01515"
     CDS             complement(231858..235448)
                     /transl_table=11
                     /locus_tag="BCAL0206"
                     /product="putative pyruvate ferredoxin/flavodoxin
                     oxidoreductase"
                     /db_xref="EnsemblGenomes-Gn:BCAL0206"
                     /db_xref="EnsemblGenomes-Tr:CAR50516"
                     /db_xref="GOA:B4E591"
                     /db_xref="InterPro:IPR002869"
                     /db_xref="InterPro:IPR011766"
                     /db_xref="InterPro:IPR017896"
                     /db_xref="InterPro:IPR019752"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:B4E591"
                     /protein_id="CAR50516.1"
                     /translation="MNAPLDADQRASLEAALKSVTLDDKYTLERGRAYMSGIQALVRL
                     PMLQQERDRAAGLNTAGFISGYRGSPLGGLDLSLWKAKQHLAAHQIVFQPGLNEDLAA
                     TAVWGSQQVNLYPGAKYDGVFGMWYGKGPGVDRTGDVFKHANSAGSSQHGGVLVLAGD
                     DHAAKSSTLAHQSEHIFKACGLPVLFPSNVQEYLDFGLHGWAMSRYSGLWVALKCVTD
                     VVESSASVDIDPHRTEIVLPTDFILPEGGLNIRWPDPPLVQEARLLDYKWYAALAYVR
                     ANKLDRIEIDSPNARFGIMTGGKAYLDVRQALTDLGLDDETCARIGIRLYKVGCVWPL
                     EAQGAQAFARGLDEILVVEEKRQILEYAIKEELYNWPDAQRPRVFGKFDEKDGAGGEW
                     SVPMGNWLLPAHYELSPAIIAKAIATRLEKFELPSDVRARIAARLAVINAKEMALAKP
                     HVQTERKPWFCSGCPHNTSTNVPEGSRAIAGIGCHYMTVWMDRSTSTFSQMGGEGVPW
                     IGQAPFTDEKHVFANLGDGTYFHSGLLAVRAAISSKANITYKILYNDAVAMTGGQPVD
                     GVLTVPQITHQLASEGAKKIVIVTDEPEKYDSQKALLAPGVTIHHRDQLDDVQRELRE
                     IEGTTILIYDQTCATEKRRRRKRGTYPDPAKRVVINDAVCEGCGDCSVQSNCLSVEPL
                     ETEFGTKRQINQSSCNKDFSCVKGFCPSFVTVEGGQLKKPKAVSVDGSALPPIPEPTL
                     PAIDRAYGVLVTGVGGTGVVTIGALLGMAAHLENKGVTVLDVTGLAQKGGAVMSHVQI
                     SHAPTDIHATRIAMGEADLVIGCDAIVTAGDECTSRMRHDTTRVVVNSAQTPTAEFIK
                     NPNWAFPGLSAENDIRAAAGVAVDFIDANRFAVALLGDAIYTNPFVLGYAWQKGWLPL
                     TLASLERAIELNAVSVDKNRAAFDWGRRAAYDLASVKQAAAGDARPAQGATVISLHTK
                     KAVDALIAKRVEFLSAYQNAAYASRYAAFVDKVRATERALADGDTVQEPLTEAVARNL
                     FKLMAYKDEYEVARLQSDPAFLARLRAQFEGDWKLKFHLAPPLFAKTDAHGHLVKKAY
                     GPWMMSAFRLLAKAKFLRGTALDPFGRTAERRTERALIGEYEALIGEVLAKLNAANRP
                     LALELAALPDGIRGYGHVKENNLRAVRQKWDTLLAKWRSPAGGQSHQQVA"
     misc_feature    complement(232623..233186)
                     /locus_tag="BCAL0206"
                     /note="HMMPfam hit to PF01558, Pyruvate
                     ferredoxin/flavodoxin oxidoreductas, score 1.1e-05"
                     /inference="protein motif:HMMPfam:PF01558"
     CDS             235778..235972
                     /transl_table=11
                     /locus_tag="BCAL0206A"
                     /product="putative outer membrane protein"
                     /note="Similar to Burkholderia pseudomallei (strain 1710b)
                     putative outer membrane protein UniProt:Q3JYB8
                     (EMBL:CP000124) (65 aa) fasta scores: E()=6.9e-06, 45.312%
                     id in 64 aa. Possible gene remnant. Similar to the
                     N-terminal region of Caulobacter crescentus motA/tolQ/exbB
                     proton channel family protein SWALL:Q9A5W1 (EMBL:AE005903)
                     (302 aa) fasta scores: E(): 6.2, 43.13% id in 51 aa"
                     /db_xref="EnsemblGenomes-Gn:BCAL0206A"
                     /db_xref="EnsemblGenomes-Tr:CAR50517"
                     /db_xref="UniProtKB/TrEMBL:B4E592"
                     /protein_id="CAR50517.1"
                     /translation="MNTRHIQSFLIVSAAFFSMTGPVHARGASALAAAGAQMQQIVPA
                     QDAAAQPSAERAAESKANVR"
     CDS             complement(236106..237203)
                     /transl_table=11
                     /gene="hppD"
                     /locus_tag="BCAL0207"
                     /product="4-hydroxyphenylpyruvic acid dioxygenase"
                     /EC_number="1.13.11.27"
                     /note="CDS is involved in the synthesis of melanin-like
                     pigment which is capable of protecting the organism from
                     in vitro and in vivo sources of oxidative stress"
                     /db_xref="EnsemblGenomes-Gn:BCAL0207"
                     /db_xref="EnsemblGenomes-Tr:CAR50518"
                     /db_xref="GOA:B4E593"
                     /db_xref="InterPro:IPR004360"
                     /db_xref="InterPro:IPR005956"
                     /db_xref="InterPro:IPR029068"
                     /db_xref="InterPro:IPR037523"
                     /db_xref="InterPro:IPR041735"
                     /db_xref="InterPro:IPR041736"
                     /db_xref="UniProtKB/TrEMBL:B4E593"
                     /protein_id="CAR50518.1"
                     /translation="MQIPTWDNPVGTDGFEFIEYTAPDPKALGHLFERMGFTAIARHR
                     HKDVTVYRQGDINFIINAEPDSFAQRFARLHGPSICAIAFRVQDAAKAYQRALELGAW
                     GFDNKTGPMELNIPAIKGIGDSLIYFVDRWRGKNGAQPGAIGDISIYDVDFEPIPGAN
                     PNPVGHGLTYIDHLTHNVHRGRMQEWAEFYERLFNFREVRYFDIEGKVTGVKSKAMTS
                     PCGKIRIPINEEGSDTAGQIQEYLDAYHGEGIQHIALGASDIYQAVDGLRSKEVKLLD
                     TIDTYYELVDRRVPNHGESLAELKKRKILIDGARDDLLLQIFTENQIGPIFFEIIQRK
                     GNQGFGEGNFKALFESIELDQIRRGVVQDKA"
     misc_feature    complement(236307..236696)
                     /gene="hppD"
                     /locus_tag="BCAL0207"
                     /note="HMMPfam hit to PF00903, Glyoxalase/Bleomycin
                     resistance protein/Di, score 1.1e-11"
                     /inference="protein motif:HMMPfam:PF00903"
     CDS             237418..237942
                     /transl_table=11
                     /locus_tag="BCAL0208"
                     /product="AnsC family regulatory protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0208"
                     /db_xref="EnsemblGenomes-Tr:CAR50519"
                     /db_xref="GOA:B4E594"
                     /db_xref="InterPro:IPR000485"
                     /db_xref="InterPro:IPR011008"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR019885"
                     /db_xref="InterPro:IPR019887"
                     /db_xref="InterPro:IPR019888"
                     /db_xref="InterPro:IPR036388"
                     /db_xref="InterPro:IPR036390"
                     /db_xref="UniProtKB/TrEMBL:B4E594"
                     /protein_id="CAR50519.1"
                     /translation="MAQAELDAIDRRILAILQENGRLSNQEIAERVNLSPSPCLRRIR
                     RLEDIGVITGYVALLNPQKLGLDLLAYVSVRLEKRGGLAPVRVDETSARAGATHAELF
                     RAAVQAWPEVVACHAMTGDMDYLLRVQVEDMAHFSRFVQEHLLHHPSVIDVKTSFSLD
                     CFKETTALPIRSVR"
     misc_feature    237484..237549
                     /note="Predicted helix-turn-helix motif with score
                     1496.000, SD 4.28 at aa 23-44, sequence
                     LSNQEIAERVNLSPSPCLRRIR"
                     /inference="protein motif:helixturnhelix:EMBOSS"
     misc_feature    237487..237567
                     /note="PS00519 Bacterial regulatory proteins, asnC family
                     signature."
                     /inference="protein motif:Prosite:PS00519"
     misc_feature    237625..237900
                     /locus_tag="BCAL0208"
                     /note="HMMPfam hit to PF01037, AsnC family, score 2.7e-24"
                     /inference="protein motif:HMMPfam:PF01037"
     CDS             complement(238009..238656)
                     /transl_table=11
                     /locus_tag="BCAL0209"
                     /product="acetyltransferase (GNAT) family protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0209"
                     /db_xref="EnsemblGenomes-Tr:CAR50520"
                     /db_xref="GOA:B4E595"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:B4E595"
                     /protein_id="CAR50520.1"
                     /translation="MNTRSNRRADAVGHAGTAPVLVRELASKDREQMLTHFLSLDEED
                     RLLRFGQVVPDHVIENYVRTIDFGRDTVFGVFDHDLELIGVGHLAYLPAEGDKRTAEF
                     GVSVLESARGRGVGSKLFERAAMRSRNTHVTMLYMHCLSRNATMMHIAKKSGMRIEYA
                     YGEADAYLSLPPADHSTIIAEMLQEQAAVFDYAMKRQARRTTKFIESLIPAALTA"
     misc_feature    complement(238189..238437)
                     /locus_tag="BCAL0209"
                     /note="HMMPfam hit to PF00583, Acetyltransferase (GNAT)
                     family, score 5.8e-09"
                     /inference="protein motif:HMMPfam:PF00583"
     CDS             complement(238891..239496)
                     /transl_table=11
                     /locus_tag="BCAL0210"
                     /product="TetR family regulatory protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0210"
                     /db_xref="EnsemblGenomes-Tr:CAR50521"
                     /db_xref="GOA:B4E596"
                     /db_xref="InterPro:IPR001647"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR036271"
                     /db_xref="InterPro:IPR041490"
                     /db_xref="UniProtKB/TrEMBL:B4E596"
                     /protein_id="CAR50521.1"
                     /translation="MARTRAPDHESQREQILDLAAEKFAQTSYPSTSMSDLATASGTS
                     KARLYHYYESKEAILFDLLDRYTKRLMLIIAEVEGASQRRGLSERDAFAELVRAFLAE
                     YETSHSRHVALLNDVKYLEDAQREIVLDRQRDIVAAFTRQLARAYPDRISKENQTSVT
                     MMVFGMINWTFTWLKPGGRLGYRDFAEQVIDLIERGLSTAA"
     misc_feature    complement(239311..239451)
                     /locus_tag="BCAL0210"
                     /note="HMMPfam hit to PF00440, Bacterial regulatory
                     proteins, tetR family, score 7.4e-12"
                     /inference="protein motif:HMMPfam:PF00440"
     misc_feature    complement(239338..239403)
                     /note="Predicted helix-turn-helix motif with score
                     1303.000, SD 3.62 at aa 32-53, sequence
                     TSMSDLATASGTSKARLYHYYE"
                     /inference="protein motif:helixturnhelix:EMBOSS"
     CDS             complement(239510..240331)
                     /transl_table=11
                     /locus_tag="BCAL0211"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0211"
                     /db_xref="EnsemblGenomes-Tr:CAR50522"
                     /db_xref="InterPro:IPR014973"
                     /db_xref="InterPro:IPR022123"
                     /db_xref="UniProtKB/TrEMBL:B4E597"
                     /protein_id="CAR50522.1"
                     /translation="MSTIHVIQGGTAAASLREALVQAGRDERVVGLLDDLGVGPLKGA
                     DETPDTRAAFWQHVLGDQIPDWNAEIEGEFARLDQLAMDTGQVVVWHAPSVGDKLLLR
                     RVAYHLRNVPQRLNEVRLSAADLDAAQRASLSRTDQACATGMFSPAELARKRPVAAPI
                     SVLRIGRLALEWQEAKHLNAELRYWVSNTIKSGHYADLDALIVARAETDWQPARRLVG
                     SIMAAADRGGLFVSDSIAWWRCRELAATGRLELQDDAPAALSSTQVRAAPAAAHR"
     CDS             complement(240459..241547)
                     /transl_table=11
                     /gene="paaE"
                     /locus_tag="BCAL0212"
                     /product="putative phenylacetic acid degradation NADH
                     oxidoreductase PaaE"
                     /EC_number="1.-.-.-"
                     /db_xref="EnsemblGenomes-Gn:BCAL0212"
                     /db_xref="EnsemblGenomes-Tr:CAR50523"
                     /db_xref="GOA:B4E598"
                     /db_xref="InterPro:IPR001041"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR001834"
                     /db_xref="InterPro:IPR008333"
                     /db_xref="InterPro:IPR011884"
                     /db_xref="InterPro:IPR012675"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="InterPro:IPR036010"
                     /db_xref="InterPro:IPR039261"
                     /db_xref="UniProtKB/TrEMBL:B4E598"
                     /protein_id="CAR50523.1"
                     /translation="MATPQFHPLRIRDVRPETADAVTVSFDVPPELRDAYRFTQGQFV
                     TLKTHIDGEETRRSYSICVGTTDYDRDGELRIGIKRVRGGRFSNFAFDTLKPGHMIDV
                     MTPDGRFFTHLNADHGKQYVAFSGGSGITPVLAIVKTTLELEPRSTFTLIYGNRSVDA
                     IMFAEELEDLKNRYMNRFVLYHVLSDDLQDVELFNGVLDQAKCAEFLATLTPADAIDE
                     AFICGPAPMMDAAEAALKAAGVPQAKVHVERFGTPLPQAGAPVVEITDQTPAADLEIV
                     LDGKKRKLRLPYEGVSLLDVGLRAGLALPYACKGGVCCTCRAKVVEGEVRMEKNYTLE
                     EHEVEDGFVLTCQCHPISDKVVVSFDER"
     misc_feature    complement(240492..240725)
                     /gene="paaE"
                     /locus_tag="BCAL0212"
                     /note="HMMPfam hit to PF00111, 2Fe-2S iron-sulfur cluster
                     binding doma, score 7.4e-17"
                     /inference="protein motif:HMMPfam:PF00111"
     misc_feature    complement(240849..241184)
                     /gene="paaE"
                     /locus_tag="BCAL0212"
                     /note="HMMPfam hit to PF00175, Oxidoreductase NAD-binding
                     domain, score 8.6e-15"
                     /inference="protein motif:HMMPfam:PF00175"
     misc_feature    complement(241215..241526)
                     /gene="paaE"
                     /locus_tag="BCAL0212"
                     /note="HMMPfam hit to PF00970, Oxidoreductase FAD-binding
                     domain, score 2.4e-14"
                     /inference="protein motif:HMMPfam:PF00970"
     CDS             complement(241550..242104)
                     /transl_table=11
                     /gene="paaD"
                     /locus_tag="BCAL0213"
                     /product="phenylacetic acid degradation protein PaaD"
                     /db_xref="EnsemblGenomes-Gn:BCAL0213"
                     /db_xref="EnsemblGenomes-Tr:CAR50524"
                     /db_xref="InterPro:IPR002744"
                     /db_xref="InterPro:IPR011883"
                     /db_xref="InterPro:IPR034904"
                     /db_xref="UniProtKB/TrEMBL:B4E599"
                     /protein_id="CAR50524.1"
                     /translation="MSAQTAAPAPAAHRDDPLLARAWDVLEAVPDPEIPVVSIRELGI
                     LRDVRRADDGQLEVVITPTYSGCPAMSQIAEDIAAALQAADLPPHRIETVLAPAWTTD
                     WITQEARDKLRAYGIAPPVGQCGSAAPRENVVRFVPRPVAAPTCPRCGSARTERLAQF
                     ASTACKALYRCVDCREPFDYFKPY"
     misc_feature    complement(241817..242053)
                     /gene="paaD"
                     /locus_tag="BCAL0213"
                     /note="HMMPfam hit to PF01883, Domain of unknown function
                     DUF59, score 6.5e-15"
                     /inference="protein motif:HMMPfam:PF01883"
     CDS             complement(242130..242933)
                     /transl_table=11
                     /gene="paaC"
                     /locus_tag="BCAL0214"
                     /product="phenylacetic acid degradation protein PaaC"
                     /db_xref="EnsemblGenomes-Gn:BCAL0214"
                     /db_xref="EnsemblGenomes-Tr:CAR50525"
                     /db_xref="GOA:B4E5A0"
                     /db_xref="InterPro:IPR007814"
                     /db_xref="InterPro:IPR009078"
                     /db_xref="InterPro:IPR011882"
                     /db_xref="InterPro:IPR012347"
                     /db_xref="UniProtKB/TrEMBL:B4E5A0"
                     /protein_id="CAR50525.1"
                     /translation="MTITPEHLSYVLRLADNALILGQRNAEWCGHGPILEEDIALTNM
                     SLDLIGQARMLYTHAAELERQLTGATKTEDDYAYFRTEREFANFTLAELPHYGPVSGT
                     AHADKDYAVTIVRNFLYAALMLHVWSALETSTDTQLAAIAAKSVKETRYHVQHAREWL
                     VRLGDGTDESHRRAQAALDYLMPYTREFFAADAIDDAIVAPGIGPAPAAIEAAWRADV
                     DDALAEATLTLPAPVKHVTTGKQGEHSEHMGYLLAEMQSLARQHPGASW"
     misc_feature    complement(242133..242933)
                     /gene="paaC"
                     /locus_tag="BCAL0214"
                     /note="HMMPfam hit to PF05138, Phenylacetic acid catabolic
                     protein, score 9.9e-52"
                     /inference="protein motif:HMMPfam:PF05138"
     CDS             complement(242944..243228)
                     /transl_table=11
                     /gene="paaB"
                     /locus_tag="BCAL0215"
                     /product="phenylacetic acid degradation protein PaaB"
                     /db_xref="EnsemblGenomes-Gn:BCAL0215"
                     /db_xref="EnsemblGenomes-Tr:CAR50526"
                     /db_xref="InterPro:IPR009359"
                     /db_xref="InterPro:IPR038693"
                     /db_xref="UniProtKB/TrEMBL:B4E5A1"
                     /protein_id="CAR50526.1"
                     /translation="MNKEWPIWEVFVRSKQGLDHKHCGSLHAADATMALRMARDVYTR
                     RQEGVSIWVVPSSAITASDPSEKAELFEPAGDKIYRHPTFYTLPDEVNHM"
     misc_feature    complement(242947..243216)
                     /gene="paaB"
                     /locus_tag="BCAL0215"
                     /note="HMMPfam hit to PF06243, Phenylacetic acid
                     degradation B, score 8.5e-71"
                     /inference="protein motif:HMMPfam:PF06243"
     CDS             complement(243264..244262)
                     /transl_table=11
                     /gene="paaA"
                     /locus_tag="BCAL0216"
                     /product="phenylacetic acid degradation protein PaaA"
                     /db_xref="EnsemblGenomes-Gn:BCAL0216"
                     /db_xref="EnsemblGenomes-Tr:CAR50527"
                     /db_xref="GOA:B4E5A2"
                     /db_xref="InterPro:IPR007814"
                     /db_xref="InterPro:IPR009078"
                     /db_xref="InterPro:IPR011881"
                     /db_xref="InterPro:IPR012347"
                     /db_xref="UniProtKB/TrEMBL:B4E5A2"
                     /protein_id="CAR50527.1"
                     /translation="MYTQSLDIPGNVAPLDAATESPEQTRFDAVMAADGKIEPQDWMP
                     DAYRKTLVRQISQHAHSEVVGMLPEGNWISRAPSLKRKAILLAKVQDEAGHGLYLYSA
                     AETLGVSRDSLIDALHAGKAKYSSIFNYPTPTWADVGVIGWLVDGAAIMNQIPLCRCT
                     YGPYARAMIRVCKEESFHQRQGFDALLSMMKGSDAQRAMVQQAVNRWWWPVLMMFGPS
                     DADSVHSSQSAKWGIKRISNDDLRQKFVDATVDQAKVLGVTLPDPDLKWNEARGHHDY
                     GAIDWDEFWRVVNGDGPCNKERLATRVKAHEDGAWVREAALAHEAKRRARAEQQAA"
     misc_feature    complement(243330..244262)
                     /gene="paaA"
                     /locus_tag="BCAL0216"
                     /note="HMMPfam hit to PF05138, Phenylacetic acid catabolic
                     protein, score 2.9e-146"
                     /inference="protein motif:HMMPfam:PF05138"
     CDS             244457..245728
                     /transl_table=11
                     /locus_tag="BCAL0217"
                     /product="putative exported GDSL-like
                     lipase/acylhydrolase"
                     /db_xref="EnsemblGenomes-Gn:BCAL0217"
                     /db_xref="EnsemblGenomes-Tr:CAR50528"
                     /db_xref="GOA:B4E5A3"
                     /db_xref="InterPro:IPR013830"
                     /db_xref="InterPro:IPR036514"
                     /db_xref="UniProtKB/TrEMBL:B4E5A3"
                     /protein_id="CAR50528.1"
                     /translation="MPMSFRSSFAAAVLGAAVLVSPLAASAAPAGWVAAWATALQPIP
                     DLAAPPPLYRAPDVAGRTVRQIVYPTVSGRAARIRVSNAYGRAPLVVEAASLARAGEG
                     AALAGGAAVPVRFGGKASVTLAPGQELESDPVAIGVTAAQPYAISLQMGPNQRMTVWH
                     RVSNQFNYVSGPGDHVNDPGAETFRTRFTQYAWVTELAVEAGPAHASVAAIGDSITDG
                     LRSSVNRNRRWPDALARRLAAAGADSVGVVNLGISGNRLLSDSACYGTSLASRFERDA
                     LSRSGVKAAIVLIGINDINFAAMPPRAGLDCDHPHTPVTAASLIDGYRRLIETAHRQG
                     VKVFGATLTPAALPAGREAIRLEVNRWIRSGGGFDGVVDFDAALRDPARPSVLQRRYD
                     SGDGIHPSDAGYTAMADAVPIERLQAAAGGS"
     sig_peptide     244493..244537
                     /locus_tag="BCAL0217"
                     /note="Signal peptide predicted for BCAL0217 by SignalP
                     2.0 HMM (Signal peptide probability 0.991) with cleavage
                     site probability 0.393 between residues 15 and 16"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    245078..245689
                     /locus_tag="BCAL0217"
                     /note="HMMPfam hit to PF00657, GDSL-like
                     Lipase/Acylhydrolase, score 1.5e-22"
                     /inference="protein motif:HMMPfam:PF00657"
     rRNA            246294..247825
                     /note="16S"
     tRNA            247890..247966
                     /gene="BCALr0217b"
                     /note="tRNA Ile anticodon GAT, Cove score 93.29"
     tRNA            248006..248081
                     /gene="BCALr0217c"
                     /note="tRNA Ala anticodon TGC, Cove score 90.89"
     rRNA            248361..251237
                     /note="23S"
     rRNA            251395..251509
                     /note="5S"
     CDS             253036..253371
                     /transl_table=11
                     /locus_tag="BCAL0218"
                     /product="hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:BCAL0218"
                     /db_xref="EnsemblGenomes-Tr:CAR50529"
                     /db_xref="UniProtKB/TrEMBL:B4E5A4"
                     /protein_id="CAR50529.1"
                     /translation="MSGTKSLPKPRHVAAPQRNAVTDQARHMKEADCRVEMGTGGRPA
                     IRDDIVLLGKVIERNRVIEFGDETGSPRSPKGAAKAFVPMLAWIGAGSLQCPLQSRYF
                     LQEALTNLP"
     tRNA            253677..253762
                     /gene="BCALr0218a"
                     /note="tRNA Tyr anticodon GTA, Cove score 66.50"
     tRNA            253806..253879
                     /gene="BCALr0218b"
                     /note="tRNA Gly anticodon TCC, Cove score 82.17"
     tRNA            253902..253976
                     /gene="BCALr0218c"
                     /note="tRNA Thr anticodon GGT, Cove score 90.12"
     CDS             254043..255233
                     /transl_table=11
                     /gene="tufA1"
                     /locus_tag="BCAL0219"
                     /product="elongation factor Tu"
                     /db_xref="EnsemblGenomes-Gn:BCAL0219"
                     /db_xref="EnsemblGenomes-Tr:CAR50530"
                     /db_xref="GOA:B4E5A5"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004160"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR004541"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR031157"
                     /db_xref="InterPro:IPR033720"
                     /db_xref="InterPro:IPR041709"
                     /db_xref="UniProtKB/TrEMBL:B4E5A5"
                     /protein_id="CAR50530.1"
                     /translation="MAKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLTKKFGGEA
                     KAYDQIDAAPEEKARGITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGA
                     ILVCSAADGPMPQTREHILLARQVGVPYIIVFLNKCDMVDDAELLELVEMEVRELLSK
                     YDFPGDDTPIVKGSAKLALEGDTGELGEVAIMSLADALDTYIPTPERAVDGAFLMPVE
                     DVFSISGRGTVVTGRVERGIVKVGEEIEIVGIKPTVKTTCTGVEMFRKLLDQGQAGDN
                     VGILLRGTKREDVERGQVLAKPGSITPHTHFTAEVYVLSKDEGGRHTPFFNNYRPQFY
                     FRTTDVTGSIELPKDKEMVMPGDNVSITVKLIAPIAMEEGLRFAIREGGRTVGAGVVA
                     KIIE"
     misc_feature    254070..254660
                     /gene="tufA1"
                     /locus_tag="BCAL0219"
                     /note="HMMPfam hit to PF00009, Elongation factor Tu GTP
                     binding domain, score 7e-102"
                     /inference="protein motif:HMMPfam:PF00009"
     misc_feature    254097..254120
                     /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
                     /inference="protein motif:Prosite:PS00017"
     misc_feature    254193..254240
                     /note="PS00301 GTP-binding elongation factors signature."
                     /inference="protein motif:Prosite:PS00301"
     misc_feature    254721..254930
                     /gene="tufA1"
                     /locus_tag="BCAL0219"
                     /note="HMMPfam hit to PF03144, Elongation factor Tu
                     domain, score 7.5e-26"
                     /inference="protein motif:HMMPfam:PF03144"
     misc_feature    254943..255227
                     /gene="tufA1"
                     /locus_tag="BCAL0219"
                     /note="HMMPfam hit to PF03143, Elongation factor Tu
                     C-terminal domain, score 2.5e-62"
                     /inference="protein motif:HMMPfam:PF03143"
     tRNA            255293..255368
                     /gene="BCALr00219"
                     /note="tRNA Trp anticodon CCA, Cove score 84.85"
     CDS             255411..255791
                     /transl_table=11
                     /gene="secE"
                     /locus_tag="BCAL0220"
                     /product="preprotein translocase SecE subunit"
                     /db_xref="EnsemblGenomes-Gn:BCAL0220"
                     /db_xref="EnsemblGenomes-Tr:CAR50531"
                     /db_xref="GOA:B4E5A6"
                     /db_xref="InterPro:IPR001901"
                     /db_xref="InterPro:IPR005807"
                     /db_xref="InterPro:IPR038379"
                     /db_xref="UniProtKB/TrEMBL:B4E5A6"
                     /protein_id="CAR50531.1"
                     /translation="MANPSVETVNTSGDKLMLALGVLLVLAGFVGFFWLANQQWYVRG
                     AALAVGIIAGVAVGLMSAPGKSLIAFAKDSYKEVRKVVWPTRKEATQTTLVVFGFVLV
                     MAIFLWLSDKSIEWVIFSAILGWK"
     misc_feature    join(255453..255521,255555..255623,255681..255740)
                     /gene="secE"
                     /locus_tag="BCAL0220"
                     /note="3 probable transmembrane helices predicted for
                     BCAL0220 by TMHMM2.0 at aa 15-37, 49-71 and 91-110"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    255606..255779
                     /gene="secE"
                     /locus_tag="BCAL0220"
                     /note="HMMPfam hit to PF00584, SecE/Sec61-gamma subunits
                     of protein translo, score 3.4e-17"
                     /inference="protein motif:HMMPfam:PF00584"
     CDS             255793..256350
                     /transl_table=11
                     /gene="nusG"
                     /locus_tag="BCAL0221"
                     /product="transcription antitermination protein NusG"
                     /db_xref="EnsemblGenomes-Gn:BCAL0221"
                     /db_xref="EnsemblGenomes-Tr:CAR50532"
                     /db_xref="GOA:B4E5A7"
                     /db_xref="InterPro:IPR001062"
                     /db_xref="InterPro:IPR005824"
                     /db_xref="InterPro:IPR006645"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="InterPro:IPR015869"
                     /db_xref="InterPro:IPR036735"
                     /db_xref="UniProtKB/TrEMBL:B4E5A7"
                     /protein_id="CAR50532.1"
                     /translation="MSDTPASPSGKRWYVVHAYSGMEKSVQRALQERIERAGMQDKFG
                     QILVPTEEVVEVKGGHKAVTERRFFPGYVLVEMEMTDETWHLVKNTAKVTGFVGGARN
                     RPTPISPKEVEKIMSQMQEGVEKPRPKTLFEVGEMVRVKEGPFTDFNGTVEEVNYEKS
                     RVRVSVTIFGRSTPVELEFGQVEKV"
     misc_feature    255823..256122
                     /gene="nusG"
                     /locus_tag="BCAL0221"
                     /note="HMMPfam hit to PF02357, Transcription termination
                     factor nusG, score 1.4e-54"
                     /inference="protein motif:HMMPfam:PF02357"
     misc_feature    256186..256299
                     /gene="nusG"
                     /locus_tag="BCAL0221"
                     /note="HMMPfam hit to PF00467, KOW motif, score 7.1e-10"
                     /inference="protein motif:HMMPfam:PF00467"
     misc_feature    256294..256323
                     /note="PS01014 Transcription termination factor nusG
                     signature."
                     /inference="protein motif:Prosite:PS01014"
     CDS             256492..256923
                     /transl_table=11
                     /gene="relC"
                     /gene_synonym="rplK"
                     /locus_tag="BCAL0222"
                     /product="50S ribosomal protein L11"
                     /db_xref="EnsemblGenomes-Gn:BCAL0222"
                     /db_xref="EnsemblGenomes-Tr:CAR50533"
                     /db_xref="GOA:B4E5A8"
                     /db_xref="InterPro:IPR000911"
                     /db_xref="InterPro:IPR006519"
                     /db_xref="InterPro:IPR020783"
                     /db_xref="InterPro:IPR020784"
                     /db_xref="InterPro:IPR020785"
                     /db_xref="InterPro:IPR036769"
                     /db_xref="InterPro:IPR036796"
                     /db_xref="UniProtKB/Swiss-Prot:B4E5A8"
                     /protein_id="CAR50533.1"
                     /translation="MAKKIIGFIKLQIPAGKANPSPPVGPALGQRGLNIMEFCKAFNA
                     QTQGMEPGLPVPVVITAFADKSFTFVMKTPPATVLIKKAAKVDKGSSKPHTDKVGSIT
                     RAQAEEIAKTKMPDLTAADLDAAVRTIAGSARSMGITVEGV"
     misc_feature    256513..256692
                     /gene="relC"
                     /locus_tag="BCAL0222"
                     /note="HMMPfam hit to PF03946, Ribosomal protein L11,
                     N-terminal dom, score 9e-35"
                     /inference="protein motif:HMMPfam:PF03946"
     misc_feature    256705..256911
                     /gene="relC"
                     /locus_tag="BCAL0222"
                     /note="HMMPfam hit to PF00298, Ribosomal protein L11, RNA
                     binding do, score 2.7e-35"
                     /inference="protein motif:HMMPfam:PF00298"
     misc_feature    256870..256917
                     /note="PS00359 Ribosomal protein L11 signature."
                     /inference="protein motif:Prosite:PS00359"
     CDS             256924..257622
                     /transl_table=11
                     /gene="rplA"
                     /locus_tag="BCAL0223"
                     /product="50S ribosomal protein L1"
                     /db_xref="EnsemblGenomes-Gn:BCAL0223"
                     /db_xref="EnsemblGenomes-Tr:CAR50534"
                     /db_xref="GOA:B4E5A9"
                     /db_xref="InterPro:IPR002143"
                     /db_xref="InterPro:IPR005878"
                     /db_xref="InterPro:IPR016095"
                     /db_xref="InterPro:IPR023673"
                     /db_xref="InterPro:IPR023674"
                     /db_xref="InterPro:IPR028364"
                     /db_xref="UniProtKB/Swiss-Prot:B4E5A9"
                     /protein_id="CAR50534.1"
                     /translation="MAKISKRRQAFAAKVDRQKLYAIEDALSLVKECASAKFDESIDV
                     AVQLGIDAKKSDQVVRGSVVLPAGTGKSVRVAVFAQGEKAEQARAAGAEIVGMEDLAE
                     QIKAGQMDFDIVIASPDTMRIVGTLGQILGPRGLMPNPKVGTVTPDVATAVKNAKAGQ
                     VQFRVDKAGIIHATIGRASFEPTALRSNLSALIEALQKAKPATSKGVYLRKIALSSTM
                     GVGVRVDQATLAAQ"
     misc_feature    256966..257586
                     /gene="rplA"
                     /locus_tag="BCAL0223"
                     /note="HMMPfam hit to PF00687, Ribosomal protein L1p/L10e
                     family, score 1.5e-122"
                     /inference="protein motif:HMMPfam:PF00687"
     misc_feature    257284..257340
                     /note="PS01199 Ribosomal protein L1 signature."
                     /inference="protein motif:Prosite:PS01199"
     CDS             257932..258429
                     /transl_table=11
                     /gene="rplJ"
                     /locus_tag="BCAL0224"
                     /product="50S ribosomal protein L10"
                     /db_xref="EnsemblGenomes-Gn:BCAL0224"
                     /db_xref="EnsemblGenomes-Tr:CAR50535"
                     /db_xref="GOA:B4E5B0"
                     /db_xref="InterPro:IPR001790"
                     /db_xref="InterPro:IPR022973"
                     /db_xref="UniProtKB/Swiss-Prot:B4E5B0"
                     /protein_id="CAR50535.1"
                     /translation="MPLNREDKQAVVAEVSAQVAKAQTVVLAEYRGIAVGDLTKLRAQ
                     AREQKVYLRVLKNTLARRAVEGTPFAPLAEQMTGPLIYGISEDAIAAAKVVNDFSKSN
                     DKLVIKAGSFDGKVMDKAGVQALASIPSREELLSKLLFVMQAPVSGFARALAALAEKK
                     QAEAA"
     misc_feature    257938..258231
                     /gene="rplJ"
                     /locus_tag="BCAL0224"
                     /note="HMMPfam hit to PF00466, Ribosomal protein L10,
                     score 3.8e-20"
                     /inference="protein motif:HMMPfam:PF00466"
     CDS             258493..258867
                     /transl_table=11
                     /gene="rplL"
                     /locus_tag="BCAL0225"
                     /product="50S ribosomal protein L7/L12"
                     /db_xref="EnsemblGenomes-Gn:BCAL0225"
                     /db_xref="EnsemblGenomes-Tr:CAR50536"
                     /db_xref="GOA:B4E5B1"
                     /db_xref="InterPro:IPR000206"
                     /db_xref="InterPro:IPR008932"
                     /db_xref="InterPro:IPR013823"
                     /db_xref="InterPro:IPR014719"
                     /db_xref="InterPro:IPR036235"
                     /db_xref="UniProtKB/Swiss-Prot:B4E5B1"
                     /protein_id="CAR50536.1"
                     /translation="MAIAKEDILAAVEGMTVLELNELVKAFEEKFGVSAAAVAVAGPA
                     GGGAAAAAEEKTEFTVVLAEAGANKVSVIKAVRELTGLGLKEAKDLVDGAPKPIKEGV
                     DKAAAEEAKKKLEEAGAKVEVK"
     sig_peptide     258535..258645
                     /gene="rplL"
                     /locus_tag="BCAL0225"
                     /note="Signal peptide predicted for BCAL0225 by SignalP
                     2.0 HMM (Signal peptide probability 0.712) with cleavage
                     site probability 0.487 between residues 37 and 38"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    258661..258864
                     /gene="rplL"
                     /locus_tag="BCAL0225"
                     /note="HMMPfam hit to PF00542, Ribosomal protein L7/L12
                     C-terminal dom, score 3.4e-38"
                     /inference="protein motif:HMMPfam:PF00542"
     CDS             259249..263355
                     /transl_table=11
                     /locus_tag="BCAL0226"
                     /product="DNA-directed RNA polymerase beta chain"
                     /EC_number="2.7.7.6"
                     /db_xref="EnsemblGenomes-Gn:BCAL0226"
                     /db_xref="EnsemblGenomes-Tr:CAR50537"
                     /db_xref="GOA:B4E5B2"
                     /db_xref="InterPro:IPR007120"
                     /db_xref="InterPro:IPR007121"
                     /db_xref="InterPro:IPR007641"
                     /db_xref="InterPro:IPR007642"
                     /db_xref="InterPro:IPR007644"
                     /db_xref="InterPro:IPR007645"
                     /db_xref="InterPro:IPR010243"
                     /db_xref="InterPro:IPR014724"
                     /db_xref="InterPro:IPR015712"
                     /db_xref="InterPro:IPR019462"
                     /db_xref="InterPro:IPR037033"
                     /db_xref="InterPro:IPR037034"
                     /db_xref="UniProtKB/Swiss-Prot:B4E5B2"
                     /protein_id="CAR50537.1"
                     /translation="MQYSFTEKKRIRKSFAKRPIVHQVPFLLATQLESFSTFLQADVP
                     ATQRKPEGLQAAFTSVFPIVSHNGFARLEFVSYALSSPAFNIKECQQRGLTYCSALRA
                     KVRLVILDKESPNKPVVKEVKEQEVYMGEIPLMTPTGSFVINGTERVIVSQLHRSPGV
                     FFEHDKGKTHSSGKLLFSARIIPYRGSWLDFEFDPKDILYFRVDRRRKMPVTILLKAI
                     GLTPEQILANFFVFDNFTLMDEGAQLEFVPERLRGEVARFDITDRDGKVIVQKDKRIN
                     AKHIRDLEAAKTKFISVPEDYLLGRVLAKNVVDGDTGEVIASANDEVTESVLEKLREA
                     GIKDIQTLYTNDLDQGPYISSTLRVDETTDKTAARIAIHRMMRPGEPPTEEAVEALFN
                     RLFYSEEAYDLSKVGRMKFNRRVGRDEIVGPMTLQDDDILATIKILVELRNGKGEVDD
                     IDHLGNRRVRCVGELAENQFRAGLVRVERAVKERLGQAESENLMPHDLINSKPISSAI
                     REFFGSSQLSQFMDQTNPLSEITHKRRVSALGPGGLTRERAGFEVRDVHPTHYGRVCP
                     IETPEGPNIGLINSLALYAHLNEYGFLETPYRKVVDSKVTDQIDYLSAIEEGRYMIAQ
                     ANAAIDEDGRLIDELVSSREAGETMMVTPDRIQYMDVAPSQIVSVAASLIPFLEHDDA
                     NRALMGSNMQRQAVPCLRPEKPVVGTGIERTCAVDSGTTVQAFRGGVVDYVDAGRIVI
                     RVNDDEAVAGEVGVDIYNLIKYTRSNQNTNINQRPIVKMGDKVSRGDVLADGASTDLG
                     ELALGQNMLIAFMPWNGYNFEDSILISEKVVADDRYTSIHIEELNVVARDTKLGPEEI
                     TRDISNLAEVQLGRLDESGIVYIGAEVEAGDVLVGKVTPKGETQLTPEEKLLRAIFGE
                     KASDVKDTSLRVPSGMSGTVIDVQVFTREGIQRDKRAQQIIDDELKRYRLDLNDQLRI
                     VEGDAFQRLARMLVGKVANGGPKKLAKGTKIDQAYLEDLDHYHWFDIRLADDEAAASL
                     EAIKNSIEEKRHQFDLAFEEKRKKLTQGDELPPGVLKMVKVYLAVKRRLQPGDKMAGR
                     HGNKGVVSKIVPIEDMPYMADGRPADVVLNPLGVPSRMNVGQVLEVHLGWAAKGLGWR
                     IGEMLQRQAKIEELRTFLTKIYNESGRQEDLESFTDDEILELAKNLREGVPFATPVFD
                     GATEEEMGKMLDLAFPDDIAEQLGMNPSKNQVRLYDGRTGEMFERRVTLGYMHYLKLH
                     HLVDDKMHARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGASYVLQEMLTVK
                     SDDVTGRTKVYENLVKGDHVIDAGMPESFNVLVKEIRSLGIDIDLDRN"
     sig_peptide     259249..259371
                     /locus_tag="BCAL0226"
                     /note="Signal peptide predicted for BCAL0226 by SignalP
                     2.0 HMM (Signal peptide probability 0.736) with cleavage
                     site probability 0.711 between residues 41 and 42"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    259327..260793
                     /locus_tag="BCAL0226"
                     /note="HMMPfam hit to PF04563, RNA polymerase beta
                     subunit, score 2e-28"
                     /inference="protein motif:HMMPfam:PF04563"
     misc_feature    259714..260628
                     /locus_tag="BCAL0226"
                     /note="HMMPfam hit to PF04561, RNA polymerase Rpb2,
                     domain, score 4.9e-06"
                     /inference="protein motif:HMMPfam:PF04561"
     misc_feature    260803..261012
                     /locus_tag="BCAL0226"
                     /note="HMMPfam hit to PF04565, RNA polymerase Rpb2,
                     domain, score 1.7e-45"
                     /inference="protein motif:HMMPfam:PF04565"
     misc_feature    261409..263118
                     /locus_tag="BCAL0226"
                     /note="HMMPfam hit to PF00562, RNA polymerase Rpb2,
                     domain, score 3.2e-184"
                     /inference="protein motif:HMMPfam:PF00562"
     misc_feature    262492..262530
                     /note="PS01166 RNA polymerases beta chain signature."
                     /inference="protein motif:Prosite:PS01166"
     misc_feature    263122..263352
                     /locus_tag="BCAL0226"
                     /note="HMMPfam hit to PF04560, RNA polymerase Rpb2,
                     domain, score 1.3e-47"
                     /inference="protein motif:HMMPfam:PF04560"
     CDS             263377..267618
                     /transl_table=11
                     /gene="rpoC"
                     /gene_synonym="tabB"
                     /locus_tag="BCAL0227"
                     /product="DNA-directed RNA polymerase beta' chain"
                     /EC_number="2.7.7.6"
                     /db_xref="EnsemblGenomes-Gn:BCAL0227"
                     /db_xref="EnsemblGenomes-Tr:CAR50538"
                     /db_xref="GOA:B4E5B3"
                     /db_xref="InterPro:IPR000722"
                     /db_xref="InterPro:IPR006592"
                     /db_xref="InterPro:IPR007066"
                     /db_xref="InterPro:IPR007080"
                     /db_xref="InterPro:IPR007081"
                     /db_xref="InterPro:IPR007083"
                     /db_xref="InterPro:IPR012754"
                     /db_xref="InterPro:IPR038120"
                     /db_xref="InterPro:IPR042102"
                     /db_xref="UniProtKB/Swiss-Prot:B4E5B3"
                     /protein_id="CAR50538.1"
                     /translation="MKALLDLFKQVQQEEVFDAIKIGLASPDKIRSWSFGEVKKPETI
                     NYRTFKPERDGLFCAKIFGPIKDYECLCGKYKRLKHRGVICEKCGVEVTLAKVRRERM
                     GHIELASPVAHIWFLKSLPSRLGMVLDMTLRDIERVLYFEAYVVIEPGMTPLKARQIM
                     TEEDYYNKVEEYGDEFRAEMGAEGVRELLRAINIDEQVETLRTELKNTGSEAKIKKYA
                     KRLKVLEAFQRSGIKPEWMILEVLPVLPPELRPLVPLDGGRFATSDLNDLYRRVINRN
                     NRLKRLLELKAPEIIVRNEKRMLQEAVDSLLDNGRRGKAMTGANKRPLKSLADMIKGK
                     GGRFRQNLLGKRVDYSGRSVIVVGPTLKLHQCGLPKLMALELFKPFIFNKLEVMGVAT
                     TIKAAKKEVENQTPVVWDILEEVIREHPVMLNRAPTLHRLGIQAFEPVLIEGKAIQLH
                     PLVCAAFNADFDGDQMAVHVPLSLEAQMEARTLMLASNNVLFPANGDPSIVPSQDIVL
                     GLYYATREAINGKGEGLSFTGVSEVIRAYENKEVELASRVNVRITEMVRNEDTSEGAP
                     EFVPKITLYATTVGRAILSEILPHGLPFSVLNKPLKKKEISRLINTAFRKCGLRATVV
                     FADQLMQSGFRLATRAGISICVDDMLVPPQKETIVGDAAKKVKEYDRQYMSGLVTAQE
                     RYNNVVDIWSATSEAVGKAMMEQLSTEPVIDRDGNETRQESFNSIYMMADSGARGSAV
                     QIRQLAGMRGLMAKPDGSIIETPITANFREGLNVLQYFISTHGARKGLADTALKTANS
                     GYLTRRLVDVTQDLVVVEDDCGTSNGVAMKALVEGGEVVEALRDRILGRVAVADVVNP
                     ETQETLYESGTLLDETAVEEIERLGIDEVRVRTPLTCETRYGLCAACYGRDLGRGSLV
                     NVGEAVGVIAAQSIGEPGTQLTMRTFHIGGAASRAAVASSVEAKSNGIVRFTATMRYV
                     TNAKGEQIVISRSGEAMITDDFGRERERHKVPYGATLLQLDGATIKAGTQLATWDPLT
                     RPIITEYGGTVKFENVEEGVTVAKQIDDVTGLSTLVVIDVKRRGSQASKSVRPQVKLL
                     DANGEEVKIPGTEHAVQIGFQVGALITVKDGQQVQVGEVLARIPTEAQKTRDITGGLP
                     RVAELFEARSPKDAGILAEVTGTTSFGKDTKGKQRLVITDLEGNQHEFLIAKEKQVLV
                     HDAQVVNKGEMIVDGPADPHDILRLQGIEALSRYIVDEVQDVYRLQGVKINDKHIEVI
                     VRQMLRRVQITDNGDTRFIPGEQVERSDMLDENDRMIAEGKRPASYDNVLLGITKASL
                     STDSFISAASFQETTRVLTEAAIMGKRDDLRGLKENVIVGRLIPAGTGLAFHKARKAK
                     ESSDRERFDQIAAEEAFDFGTPSAPAEEPQHPAAE"
     misc_feature    263416..264402
                     /gene="rpoC"
                     /locus_tag="BCAL0227"
                     /note="HMMPfam hit to PF04997, RNA polymerase Rpb1,
                     domain, score 4.6e-147"
                     /inference="protein motif:HMMPfam:PF04997"
     misc_feature    264406..264834
                     /gene="rpoC"
                     /locus_tag="BCAL0227"
                     /note="HMMPfam hit to PF00623, RNA polymerase Rpb1,
                     domain, score 1.2e-82"
                     /inference="protein motif:HMMPfam:PF00623"
     misc_feature    264841..265323
                     /gene="rpoC"
                     /locus_tag="BCAL0227"
                     /note="HMMPfam hit to PF04983, RNA polymerase Rpb1,
                     domain, score 1.4e-33"
                     /inference="protein motif:HMMPfam:PF04983"
     misc_feature    265408..265683
                     /gene="rpoC"
                     /locus_tag="BCAL0227"
                     /note="HMMPfam hit to PF05000, RNA polymerase Rpb1,
                     domain, score 1.1e-31"
                     /inference="protein motif:HMMPfam:PF05000"
     misc_feature    265687..267360
                     /gene="rpoC"
                     /locus_tag="BCAL0227"
                     /note="HMMPfam hit to PF04998, RNA polymerase Rpb1,
                     domain, score 8.8e-97"
                     /inference="protein motif:HMMPfam:PF04998"
     CDS             267898..269745
                     /transl_table=11
                     /gene="recQ"
                     /locus_tag="BCAL0228"
                     /product="ATP-dependent DNA helicase RecQ"
                     /EC_number="3.6.1.-"
                     /db_xref="EnsemblGenomes-Gn:BCAL0228"
                     /db_xref="EnsemblGenomes-Tr:CAR50539"
                     /db_xref="GOA:B4E5B4"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR002121"
                     /db_xref="InterPro:IPR004589"
                     /db_xref="InterPro:IPR006293"
                     /db_xref="InterPro:IPR010997"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR018982"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR032284"
                     /db_xref="InterPro:IPR036388"
                     /db_xref="UniProtKB/TrEMBL:B4E5B4"
                     /protein_id="CAR50539.1"
                     /translation="MSRALEILDEVFGYSAFRGQQGEIVEHVAGGGDCLVLMPTGGGK
                     SLCYQIPALLRREAGQGAGIVVSPLIALMQDQVAALSEVGVRAAYLNSTLSGAEAAAT
                     ERALREGEIDLLYVAPERLMTGRFLELLERAKIGLFAIDEAHCVSQWGHDFRPEYIQL
                     SVLHERFPSVPRIALTATADAITRDEIIHRLALDDVRVFVSSFDRPNIRYRIVEKDNA
                     RAQLLDFIRAEHTNADGTTDAGVVYCLSRRKVEETAEWLKAQGVRALPYHAGMEFEVR
                     QKHQEMFQREEGIVMCATIAFGMGIDKPDVRFVAHLDLPKSVEGYYQETGRAGRDGMP
                     ANAWMAYGLGDVVQQRKMIDESDADDAHKRVQTSKLDALLGLCETISCRRVRLLNYFG
                     EASQPCGNCDTCLEPPASWDATREAQMALSCVFRAQRASGFNFGSSHLIEILRGGRTE
                     KVLQRGHDQLSTFGIGAALSEPEWRAIFRQLVAYGYLAVDHGGFGALMLTEAAKPVLK
                     NEEKVTLRRYVKPQRTRQSSSRSGTRVDPTAGMGARERARWDALRAWRAETAKTDGVP
                     AYVIFHDATLAEIARNAPETIDDLRHIPGMGVRKLERFGDEIIDVVESA"
     misc_feature    267949..268458
                     /gene="recQ"
                     /locus_tag="BCAL0228"
                     /note="HMMPfam hit to PF00270, DEAD/DEAH box helicase,
                     score 3.6e-27"
                     /inference="protein motif:HMMPfam:PF00270"
     misc_feature    268663..268893
                     /gene="recQ"
                     /locus_tag="BCAL0228"
                     /note="HMMPfam hit to PF00271, Helicase conserved
                     C-terminal domain, score 6.8e-26"
                     /inference="protein motif:HMMPfam:PF00271"
     misc_feature    269521..269742
                     /gene="recQ"
                     /locus_tag="BCAL0228"
                     /note="HMMPfam hit to PF00570, HRDC domain, score 1.6e-20"
                     /inference="protein motif:HMMPfam:PF00570"
     CDS             269972..270352
                     /transl_table=11
                     /gene="rpsL"
                     /locus_tag="BCAL0229"
                     /product="30S ribosomal protein S12"
                     /db_xref="EnsemblGenomes-Gn:BCAL0229"
                     /db_xref="EnsemblGenomes-Tr:CAR50540"
                     /db_xref="GOA:B4E5B5"
                     /db_xref="InterPro:IPR005679"
                     /db_xref="InterPro:IPR006032"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="UniProtKB/Swiss-Prot:B4E5B5"
                     /protein_id="CAR50540.1"
                     /translation="MPTINQLVRKGRQSETTKSKSPALQDCPQRRGVCTRVYTTTPKK
                     PNSALRKVAKVRLTNGFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHMVRGSL
                     DTQGVKDRKQARSKYGAKRAKAAK"
     misc_feature    269975..270340
                     /gene="rpsL"
                     /locus_tag="BCAL0229"
                     /note="HMMPfam hit to PF00164, Ribosomal protein S12,
                     score 2.8e-76"
                     /inference="protein motif:HMMPfam:PF00164"
     misc_feature    270098..270121
                     /note="PS00055 Ribosomal protein S12 signature."
                     /inference="protein motif:Prosite:PS00055"
     CDS             270525..270995
                     /transl_table=11
                     /gene="rpsG"
                     /locus_tag="BCAL0230"
                     /product="30S ribosomal protein S7"
                     /db_xref="EnsemblGenomes-Gn:BCAL0230"
                     /db_xref="EnsemblGenomes-Tr:CAR50541"
                     /db_xref="GOA:B4E5B6"
                     /db_xref="InterPro:IPR000235"
                     /db_xref="InterPro:IPR005717"
                     /db_xref="InterPro:IPR020606"
                     /db_xref="InterPro:IPR023798"
                     /db_xref="InterPro:IPR036823"
                     /db_xref="UniProtKB/Swiss-Prot:B4E5B6"
                     /protein_id="CAR50541.1"
                     /translation="MPRRREVPKREVLPDPKFGNVDVAKFMNMLMLSGKKSVAERIVY
                     GAFEQIQTKGGKDPLEVFTVALNNVKPVVEVKSRRVGGANYQVPVEVRPSRRMALAMR
                     WLREAAKKRSEKSMALRLAGELSEAAEGRGGAMKKRDEVHRMAEANRAFSHFRF"
     misc_feature    270528..270971
                     /gene="rpsG"
                     /locus_tag="BCAL0230"
                     /note="HMMPfam hit to PF00177, Ribosomal protein S7p/S5e,
                     score 5.6e-82"
                     /inference="protein motif:HMMPfam:PF00177"
     misc_feature    270582..270662
                     /note="PS00052 Ribosomal protein S7 signature."
                     /inference="protein motif:Prosite:PS00052"
     CDS             271119..273221
                     /transl_table=11
                     /gene="fusA"
                     /locus_tag="BCAL0231"
                     /product="elongation factor G"
                     /db_xref="EnsemblGenomes-Gn:BCAL0231"
                     /db_xref="EnsemblGenomes-Tr:CAR50542"
                     /db_xref="GOA:B4E5B7"
                     /db_xref="InterPro:IPR000640"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR004540"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR005517"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009022"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR031157"
                     /db_xref="InterPro:IPR035647"
                     /db_xref="InterPro:IPR035649"
                     /db_xref="InterPro:IPR041095"
                     /db_xref="UniProtKB/TrEMBL:B4E5B7"
                     /protein_id="CAR50542.1"
                     /translation="MARKTPIERYRNIGISAHIDAGKTTTTERILFYTGVNHKIGEVH
                     DGAATMDWMEQEQERGITITSAATTAFWKGMGGNYPEHRINIIDTPGHVDFTIEVERS
                     MRVLDGACMVYCAVGGVQPQSETVWRQANKYKVPRLAFVNKMDRTGANFFKVYDQLRL
                     RLKANPVPVVVPIGAEENFKGVVDLIKMKAIIWDEASQGTKFDYVDIPAELAETCKEW
                     REKMVEVAAEASEDLMNKYLEEGDLPEADIVKALRDRTIACEIQPMLCGTAFKNKGVQ
                     RMLDAVIDFLPSPVDIPPVKGELENGEEAERKASDEEKFSSLAFKIMTDPFVGQLIFF
                     RVYSGVVNSGDTLLNSTKGKKERLGRILQMHANQREEIKEVRAGDIAAAVGLKEATTG
                     DTLCDPANPIVLERMVFPEPVISQAVEPKTKADQEKMGLALNRLAQEDPSFRVQTDEE
                     SGQTIISGMGELHLEILVDRMKREFGVEATVGKPQVAYRETIRSTAKDVDGKFVKQSG
                     GRGQYGHAVITLEPNEQGKGYEFFDEIKGGVIPREYIPAVDKGIQDTLKSGVLAGFPV
                     VDVKVHLTFGSYHDVDSNENAFRMAGSMAFKEAMRKANPVVLEPMMAVEVETPEDYMG
                     NVMGDLSGRRGIVQGMEDMVGGGKIVRAEVPLSEMFGYSTSLRSLTQGRATYTMEFKH
                     YAEAPRNVAEAIISAKSK"
     misc_feature    271140..271988
                     /gene="fusA"
                     /locus_tag="BCAL0231"
                     /note="HMMPfam hit to PF00009, Elongation factor Tu GTP
                     binding domain, score 1.2e-110"
                     /inference="protein motif:HMMPfam:PF00009"
     misc_feature    271167..271190
                     /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
                     /inference="protein motif:Prosite:PS00017"
     misc_feature    271269..271316
                     /note="PS00301 GTP-binding elongation factors signature."
                     /inference="protein motif:Prosite:PS00301"
     misc_feature    272103..272306
                     /gene="fusA"
                     /locus_tag="BCAL0231"
                     /note="HMMPfam hit to PF03144, Elongation factor Tu
                     domain, score 3.2e-21"
                     /inference="protein motif:HMMPfam:PF03144"
     misc_feature    272568..272930
                     /gene="fusA"
                     /locus_tag="BCAL0231"
                     /note="HMMPfam hit to PF03764, Elongation factor G, domain
                     IV, score 3e-70"
                     /inference="protein motif:HMMPfam:PF03764"
     misc_feature    272934..273200
                     /gene="fusA"
                     /locus_tag="BCAL0231"
                     /note="HMMPfam hit to PF00679, Elongation factor G
                     C-terminus, score 1.2e-50"
                     /inference="protein motif:HMMPfam:PF00679"
     CDS             273264..274454
                     /transl_table=11
                     /gene="tuf"
                     /locus_tag="BCAL0232"
                     /product="elongation factor Tu (EF-Tu)"
                     /db_xref="EnsemblGenomes-Gn:BCAL0232"
                     /db_xref="EnsemblGenomes-Tr:CAR50543"
                     /db_xref="GOA:B4E5A5"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004160"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR004541"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR031157"
                     /db_xref="InterPro:IPR033720"
                     /db_xref="InterPro:IPR041709"
                     /db_xref="UniProtKB/TrEMBL:B4E5A5"
                     /protein_id="CAR50543.1"
                     /translation="MAKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLTKKFGGEA
                     KAYDQIDAAPEEKARGITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGA
                     ILVCSAADGPMPQTREHILLARQVGVPYIIVFLNKCDMVDDAELLELVEMEVRELLSK
                     YDFPGDDTPIVKGSAKLALEGDTGELGEVAIMSLADALDTYIPTPERAVDGAFLMPVE
                     DVFSISGRGTVVTGRVERGIVKVGEEIEIVGIKPTVKTTCTGVEMFRKLLDQGQAGDN
                     VGILLRGTKREDVERGQVLAKPGSITPHTHFTAEVYVLSKDEGGRHTPFFNNYRPQFY
                     FRTTDVTGSIELPKDKEMVMPGDNVSITVKLIAPIAMEEGLRFAIREGGRTVGAGVVA
                     KIIE"
     misc_feature    273291..273881
                     /gene="tuf"
                     /locus_tag="BCAL0232"
                     /note="HMMPfam hit to PF00009, Elongation factor Tu GTP
                     binding domain, score 7e-102"
                     /inference="protein motif:HMMPfam:PF00009"
     misc_feature    273318..273341
                     /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
                     /inference="protein motif:Prosite:PS00017"
     misc_feature    273414..273461
                     /note="PS00301 GTP-binding elongation factors signature."
                     /inference="protein motif:Prosite:PS00301"
     misc_feature    273942..274151
                     /gene="tuf"
                     /locus_tag="BCAL0232"
                     /note="HMMPfam hit to PF03144, Elongation factor Tu
                     domain, score 7.5e-26"
                     /inference="protein motif:HMMPfam:PF03144"
     misc_feature    274164..274448
                     /gene="tuf"
                     /locus_tag="BCAL0232"
                     /note="HMMPfam hit to PF03143, Elongation factor Tu
                     C-terminal domain, score 2.5e-62"
                     /inference="protein motif:HMMPfam:PF03143"
     CDS             274742..275053
                     /transl_table=11
                     /gene="rpsJ"
                     /locus_tag="BCAL0233"
                     /product="30s ribosomal protein S10"
                     /db_xref="EnsemblGenomes-Gn:BCAL0233"
                     /db_xref="EnsemblGenomes-Tr:CAR50544"
                     /db_xref="GOA:B4E5B9"
                     /db_xref="InterPro:IPR001848"
                     /db_xref="InterPro:IPR018268"
                     /db_xref="InterPro:IPR027486"
                     /db_xref="InterPro:IPR036838"
                     /db_xref="UniProtKB/Swiss-Prot:B4E5B9"
                     /protein_id="CAR50544.1"
                     /translation="MQQQKIRIRLKAFDYRLIDQSAAEIVDTAKRTGAIVRGPVPLPT
                     RIQRFDILRSPHVNKTSRDQLEIRTHQRLMDIVDPTDKTVDALMKLDLPAGVDVEIKL
                     Q"
     misc_feature    274754..275041
                     /gene="rpsJ"
                     /locus_tag="BCAL0233"
                     /note="HMMPfam hit to PF00338, Ribosomal protein
                     S10p/S20e, score 2.3e-51"
                     /inference="protein motif:HMMPfam:PF00338"
     misc_feature    274826..274873
                     /note="PS00361 Ribosomal protein S10 signature."
                     /inference="protein motif:Prosite:PS00361"
     CDS             275232..275882
                     /transl_table=11
                     /gene="rplC"
                     /locus_tag="BCAL0234"
                     /product="50S ribosomal protein L3"
                     /db_xref="EnsemblGenomes-Gn:BCAL0234"
                     /db_xref="EnsemblGenomes-Tr:CAR50545"
                     /db_xref="GOA:B4E5C0"
                     /db_xref="InterPro:IPR000597"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR019926"
                     /db_xref="InterPro:IPR019927"
                     /db_xref="UniProtKB/Swiss-Prot:B4E5C0"
                     /protein_id="CAR50545.1"
                     /translation="MSLGLVGRKVGMTRIFTAEGDSIPVTVLDVSDNRVTQIKTVETD
                     GYTAVQVAFGSRRASRVTKPLAGHLAKAGVEAGEILKEFRIDAAKAAELSNGAVVGAD
                     LFEVGQKVDVQGVSIGKGYAGTIKRYNFSSGRATHGNSRSHNVPGSIGMAQDPGRVFP
                     GKRMTGHMGDVTVTVQNLEIARIDAERKLLLVKGAIPGAKGGKVFVTPAVKTKGAK"
     misc_feature    275256..275852
                     /gene="rplC"
                     /locus_tag="BCAL0234"
                     /note="HMMPfam hit to PF00297, Ribosomal protein L3, score
                     1.1e-80"
                     /inference="protein motif:HMMPfam:PF00297"
     misc_feature    275541..275612
                     /note="PS00474 Ribosomal protein L3 signature."
                     /inference="protein motif:Prosite:PS00474"
     CDS             275882..276502
                     /transl_table=11
                     /gene="rplD"
                     /gene_synonym="eryA"
                     /locus_tag="BCAL0235"
                     /product="50S ribosomal protein L4"
                     /db_xref="EnsemblGenomes-Gn:BCAL0235"
                     /db_xref="EnsemblGenomes-Tr:CAR50546"
                     /db_xref="GOA:B4E5C1"
                     /db_xref="InterPro:IPR002136"
                     /db_xref="InterPro:IPR013005"
                     /db_xref="InterPro:IPR023574"
                     /db_xref="UniProtKB/Swiss-Prot:B4E5C1"
                     /protein_id="CAR50546.1"
                     /translation="MELKLLNENGQEGAVVNASDVVFGRDYNEALIHQVVIAYQANAR
                     QGNRAQKDREQVKHTTKKPWRQKGTGRARAGMSSSPLWRGGGRIFPNSPEENFSHKVN
                     KKMHRAGLCSIFSQLAREGRLSVVEDIILEAPKTKLLADKFKTMGLDSVLIITDTVDE
                     NLYLASRNLPHVAIVEPRYADPLSLIYFKKVLVTKAAVAQIEELLS"
     misc_feature    275918..276493
                     /gene="rplD"
                     /locus_tag="BCAL0235"
                     /note="HMMPfam hit to PF00573, Ribosomal protein L4/L1
                     family, score 1.9e-46"
                     /inference="protein motif:HMMPfam:PF00573"
     CDS             276499..276813
                     /transl_table=11
                     /gene="rplW"
                     /locus_tag="BCAL0236"
                     /product="50S ribosomal protein L23"
                     /db_xref="EnsemblGenomes-Gn:BCAL0236"
                     /db_xref="EnsemblGenomes-Tr:CAR50547"
                     /db_xref="GOA:B4E5C2"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR012678"
                     /db_xref="InterPro:IPR013025"
                     /db_xref="UniProtKB/Swiss-Prot:B4E5C2"
                     /protein_id="CAR50547.1"
                     /translation="MSEIRKNDHRLMQVLLAPVISEKATLVADKNEQVVFEVAPDATK
                     QEVKAAVELLFKVEVDSVNVLVQKGKQKRFGRSMGRRKDVKKAYVCLKPGQEINFEAE
                     AK"
     misc_feature    276532..276807
                     /gene="rplW"
                     /locus_tag="BCAL0236"
                     /note="HMMPfam hit to PF00276, Ribosomal protein L23,
                     score 9.3e-28"
                     /inference="protein motif:HMMPfam:PF00276"
     CDS             276816..277643
                     /transl_table=11
                     /gene="rplB"
                     /locus_tag="BCAL0237"
                     /product="50S ribosomal protein L2"
                     /db_xref="EnsemblGenomes-Gn:BCAL0237"
                     /db_xref="EnsemblGenomes-Tr:CAR50548"
                     /db_xref="GOA:B4E5C3"
                     /db_xref="InterPro:IPR002171"
                     /db_xref="InterPro:IPR005880"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="InterPro:IPR014726"
                     /db_xref="InterPro:IPR022666"
                     /db_xref="InterPro:IPR022669"
                     /db_xref="InterPro:IPR022671"
                     /db_xref="UniProtKB/Swiss-Prot:B4E5C3"
                     /protein_id="CAR50548.1"
                     /translation="MAIVKVKPTSPGRRAMVKVVNKNLHQGKPFAALLDSQSSTAGRN
                     NNGRITTRHKGGGHKQHYRIVDFRRTKDGIPAKVERLEYDPNRSANIALVLYADGERR
                     YIIAPKGLTVGQQLMSGSEAPIRAGNTLPIRNIPVGTTIHCIEMLPGKGAQMARSAGT
                     SAMLLAREGVYAQVRLRSGEIRRVHIECRATIGEVGNEEHSLRQIGKAGANRWRGIRP
                     TVRGVAMNPVDHPHGGGEGKTAAGRDPVSPWGTPAKGYRTRSNKRTTTMIVQRRHKR"
     misc_feature    276939..277169
                     /gene="rplB"
                     /locus_tag="BCAL0237"
                     /note="HMMPfam hit to PF00181, Ribosomal Proteins L2, RNA
                     binding dom, score 2.3e-47"
                     /inference="protein motif:HMMPfam:PF00181"
     misc_feature    277185..277571
                     /gene="rplB"
                     /locus_tag="BCAL0237"
                     /note="HMMPfam hit to PF03947, Ribosomal Proteins L2,
                     C-terminal doma, score 8.1e-86"
                     /inference="protein motif:HMMPfam:PF03947"
     misc_feature    277467..277502
                     /note="PS00467 Ribosomal protein L2 signature."
                     /inference="protein motif:Prosite:PS00467"
     CDS             277654..277929
                     /transl_table=11
                     /gene="rpsS"
                     /locus_tag="BCAL0238"
                     /product="30S ribosomal protein S19"
                     /db_xref="EnsemblGenomes-Gn:BCAL0238"
                     /db_xref="EnsemblGenomes-Tr:CAR50549"
                     /db_xref="GOA:B4E5C4"
                     /db_xref="InterPro:IPR002222"
                     /db_xref="InterPro:IPR005732"
                     /db_xref="InterPro:IPR020934"
                     /db_xref="InterPro:IPR023575"
                     /db_xref="UniProtKB/Swiss-Prot:B4E5C4"
                     /protein_id="CAR50549.1"
                     /translation="MARSVKKGPFCDAHLLKKVEAAAASRDKKPIKTWSRRSTILPDF
                     IGLTIAVHNGRQHVPVYISENMVGHKLGEFALTRTFKGHAADKKAKK"
     misc_feature    277660..277902
                     /gene="rpsS"
                     /locus_tag="BCAL0238"
                     /note="HMMPfam hit to PF00203, Ribosomal protein S19,
                     score 3.5e-52"
                     /inference="protein motif:HMMPfam:PF00203"
     misc_feature    277810..277884
                     /note="PS00323 Ribosomal protein S19 signature."
                     /inference="protein motif:Prosite:PS00323"
     CDS             277942..278271
                     /transl_table=11
                     /gene="rplV"
                     /gene_synonym="eryB"
                     /locus_tag="BCAL0239"
                     /product="50S ribosomal protein L22"
                     /db_xref="EnsemblGenomes-Gn:BCAL0239"
                     /db_xref="EnsemblGenomes-Tr:CAR50550"
                     /db_xref="GOA:B4E5C5"
                     /db_xref="InterPro:IPR001063"
                     /db_xref="InterPro:IPR005727"
                     /db_xref="InterPro:IPR018260"
                     /db_xref="InterPro:IPR036394"
                     /db_xref="UniProtKB/Swiss-Prot:B4E5C5"
                     /protein_id="CAR50550.1"
                     /translation="MEVKAIHRGARISAQKTRLVADQIRGLPVDKALNVLTFSPKKAA
                     GIVKKVVLSAIANAEHNEGADIDELKIKSIYVDKAASLKRFTARAKGRGNRIEKQSCH
                     ITVTVGN"
     misc_feature    277954..278268
                     /gene="rplV"
                     /locus_tag="BCAL0239"
                     /note="HMMPfam hit to PF00237, Ribosomal protein
                     L22p/L17e, score 1.1e-44"
                     /inference="protein motif:HMMPfam:PF00237"
     misc_feature    278188..278262
                     /note="PS00464 Ribosomal protein L22 signature."
                     /inference="protein motif:Prosite:PS00464"
     CDS             278283..279083
                     /transl_table=11
                     /gene="rpsC"
                     /locus_tag="BCAL0240"
                     /product="30S ribosomal protein S3"
                     /db_xref="EnsemblGenomes-Gn:BCAL0240"
                     /db_xref="EnsemblGenomes-Tr:CAR50551"
                     /db_xref="GOA:B4E5C6"
                     /db_xref="InterPro:IPR001351"
                     /db_xref="InterPro:IPR004044"
                     /db_xref="InterPro:IPR004087"
                     /db_xref="InterPro:IPR005704"
                     /db_xref="InterPro:IPR009019"
                     /db_xref="InterPro:IPR015946"
                     /db_xref="InterPro:IPR018280"
                     /db_xref="InterPro:IPR036419"
                     /db_xref="UniProtKB/Swiss-Prot:B4E5C6"
                     /protein_id="CAR50551.1"
                     /translation="MGQKIHPTGFRLAVSRNWASRWYANNNNFAAMLQEDIGVREYLK
                     KKLKNASVGRVVIERPAKNARITIYSSRPGVVIGKKGEDIEQLKTELQRRMGVPVHVN
                     IEEIRKPETDAQLIADSITQQLERRIMFRRAMKRAMQNAMRLGAQGIKIMSAGRLNGI
                     EIARTEWYREGRVPLHTLRADIDYATSEAKTTYGIIGVKVWVYKGDTLGRNDAPVVEE
                     VAEDKRPRRNARPGDRRPRRDGEGGAPGARRGAPRRGAGKPEDGKTGE"
     misc_feature    278283..278468
                     /gene="rpsC"
                     /locus_tag="BCAL0240"
                     /note="HMMPfam hit to PF00417, Ribosomal protein S3,
                     N-terminal domai, score 1.3e-26"
                     /inference="protein motif:HMMPfam:PF00417"
     misc_feature    278469..278633
                     /gene="rpsC"
                     /locus_tag="BCAL0240"
                     /note="HMMPfam hit to PF07650, KH domain, score 3.2e-22"
                     /inference="protein motif:HMMPfam:PF07650"
     misc_feature    278637..278888
                     /gene="rpsC"
                     /locus_tag="BCAL0240"
                     /note="HMMPfam hit to PF00189, Ribosomal protein S3,
                     C-terminal domai, score 1.4e-51"
                     /inference="protein motif:HMMPfam:PF00189"
     misc_feature    278769..278873
                     /note="PS00548 Ribosomal protein S3 signature."
                     /inference="protein motif:Prosite:PS00548"
     misc_feature    279051..279074
                     /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
                     /inference="protein motif:Prosite:PS00017"
     CDS             279086..279502
                     /transl_table=11
                     /gene="rplP"
                     /locus_tag="BCAL0241"
                     /product="50S ribosomal protein L16"
                     /db_xref="EnsemblGenomes-Gn:BCAL0241"
                     /db_xref="EnsemblGenomes-Tr:CAR50552"
                     /db_xref="GOA:B4E5C7"
                     /db_xref="InterPro:IPR000114"
                     /db_xref="InterPro:IPR016180"
                     /db_xref="InterPro:IPR020798"
                     /db_xref="InterPro:IPR036920"
                     /db_xref="UniProtKB/Swiss-Prot:B4E5C7"
                     /protein_id="CAR50552.1"
                     /translation="MLQPKRRKYRKEQKGRNTGKATRGNAVSFGEFGLKAIGRGRLTA
                     RQIEAARRAMTRHIKRGGRIWIRIFPDKPISQKPAEVRMGNGKGNPEYYVAEIQPGKM
                     LYEMDGVTEELAREAFRLAAAKLPLKTAFIVRQLGA"
     misc_feature    279086..279481
                     /gene="rplP"
                     /locus_tag="BCAL0241"
                     /note="HMMPfam hit to PF00252, Ribosomal protein L16,
                     score 2.6e-86"
                     /inference="protein motif:HMMPfam:PF00252"
     misc_feature    279260..279295
                     /note="PS00586 Ribosomal protein L16 signature 1."
                     /inference="protein motif:Prosite:PS00586"
     CDS             279512..279706
                     /transl_table=11
                     /gene="rpmC"
                     /locus_tag="BCAL0242"
                     /product="50S ribosomal protein L29"
                     /db_xref="EnsemblGenomes-Gn:BCAL0242"
                     /db_xref="EnsemblGenomes-Tr:CAR50553"
                     /db_xref="GOA:B4E5C8"
                     /db_xref="InterPro:IPR001854"
                     /db_xref="InterPro:IPR018254"
                     /db_xref="InterPro:IPR036049"
                     /db_xref="UniProtKB/Swiss-Prot:B4E5C8"
                     /protein_id="CAR50553.1"
                     /translation="MKASELLQKDQAALNKELADLLKAQFGLRMQLATQQLTNTSQLK
                     KVRRDIARVRTVMTQKANQK"
     misc_feature    279518..279691
                     /gene="rpmC"
                     /locus_tag="BCAL0242"
                     /note="HMMPfam hit to PF00831, Ribosomal L29