LOCUS AL121735 1213 bp mRNA linear HUM 24-SEP-2008 DEFINITION Isoform of human GTP-binding protein G25K. ACCESSION AL121735 VERSION AL121735.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1213) AUTHORS Rhodes S., Huckle E. JOURNAL Submitted (04-OCT-1999) to the INSDC. E-mail contact: humquery@sanger.ac.uk COMMENT This cDNA sequence was assembled from public domain ESTs and single pass sequencing reads from expressed DNA templates, aligned to the genomic DNA sequence from the bacterial clone 224A6 (AL031281). The EST sequences listed match this sequence with an identity of at least 95% between the coordinates shown. Further information can be found at http://www.sanger.ac.uk/HGP/Chr1/ Non-experimentally determined gene with isoforms dJ224A6.C2.1(HS224A62A), dJ224A6.C2.3(HS224A62C) and dJ224A6.C2.4(HS224A62D) Sanger Centre name : dJ224A6.C1.2.2 FEATURES Location/Qualifiers source 1..1213 /db_xref="H-InvDB:HIT000250276" /organism="Homo sapiens" /chromosome="1" /map="1p35.1-36.23" /mol_type="mRNA" /db_xref="taxon:9606" exon 1..54 /number=1 misc_feature 12..252 /note="matches EST D54120" misc_feature 16..569 /note="matches EST AA424269 from clone 760101" misc_feature 17..272 /note="matches EST AA380865" misc_feature 28..306 /note="matches EST AA134643 from clone 532058" misc_feature join(38..502,502..556) /note="matches EST AI280348 from clone IMAGE:1879967" misc_feature 39..351 /note="matches EST AA362118" misc_feature 40..593 /note="matches EST AL037750 from clone DKFZp564C087" misc_feature 46..433 /note="matches EST T23834 from clone b4HB3MA-Cot8-HAP-Ft-286" misc_feature 47..401 /note="matches EST D53086" misc_feature 49..391 /note="matches EST H73472 from clone 214563" misc_feature 50..306 /note="matches EST W79849 from clone 346498" misc_feature 50..446 /note="matches EST H16069 from clone 48569" misc_feature 51..391 /note="matches EST H05221 from clone 45208" misc_feature 52..341 /note="matches EST AA043002 from clone 486843" misc_feature 52..512 /note="matches EST AA101993 from clone 489759" misc_feature 54..454 /note="matches EST AA405745 from clone 742989" misc_feature complement(join(54..85,146..243,242..390)) /note="matches EST AA405996 from clone 742991" misc_feature join(54..279,418..558) /note="matches EST AA054501 from clone 489364" exon 55..209 /number=2 misc_feature 55..446 /note="matches EST R15868 from clone 53015" misc_feature join(57..535,533..575) /note="matches EST AA053878 from clone 380569" misc_feature join(59..569,569..589) /note="matches EST AL048769 from clone DKFZp566N013" misc_feature 59..535 /note="matches EST AA434195 from clone 770280" misc_feature 66..472 /note="matches EST C89016 from clone 01B00056NC10" misc_feature 66..580 /note="matches EST AA041660 from clone 475213" misc_feature 70..555 /note="matches EST AA452681 from clone 788465" misc_feature join(100..562,561..595) /note="matches EST T27915" CDS 105..680 /product="hypothetical protein" /db_xref="GOA:P60953" /db_xref="H-InvDB:HIT000250276.14" /db_xref="HGNC:HGNC:1736" /db_xref="InterPro:IPR001806" /db_xref="InterPro:IPR003578" /db_xref="InterPro:IPR005225" /db_xref="InterPro:IPR027417" /db_xref="InterPro:IPR037874" /db_xref="PDB:1A4R" /db_xref="PDB:1AJE" /db_xref="PDB:1AM4" /db_xref="PDB:1AN0" /db_xref="PDB:1CEE" /db_xref="PDB:1CF4" /db_xref="PDB:1DOA" /db_xref="PDB:1E0A" /db_xref="PDB:1EES" /db_xref="PDB:1GRN" /db_xref="PDB:1GZS" /db_xref="PDB:1KI1" /db_xref="PDB:1KZ7" /db_xref="PDB:1KZG" /db_xref="PDB:1NF3" /db_xref="PDB:2ASE" /db_xref="PDB:2DFK" /db_xref="PDB:2KB0" /db_xref="PDB:2NGR" /db_xref="PDB:2ODB" /db_xref="PDB:2QRZ" /db_xref="PDB:2WM9" /db_xref="PDB:2WMN" /db_xref="PDB:2WMO" /db_xref="PDB:3GCG" /db_xref="PDB:3QBV" /db_xref="PDB:3VHL" /db_xref="PDB:4DID" /db_xref="PDB:4ITR" /db_xref="PDB:4JS0" /db_xref="PDB:4YC7" /db_xref="PDB:4YDH" /db_xref="PDB:5CJP" /db_xref="PDB:5FI1" /db_xref="PDB:5HZK" /db_xref="PDB:5UPK" /db_xref="PDB:5UPL" /db_xref="PDB:6AJ4" /db_xref="PDB:6AJL" /db_xref="UniProtKB/Swiss-Prot:P60953" /protein_id="CAB57326.1" /translation="MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTV MIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEIT HHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSAL TQKGLKNVFDEAILAALEPPEPKKSRRCVLL" misc_feature 141..561 /note="matches EST AA272519 from clone 737098" exon 210..282 /number=3 misc_feature complement(211..930) /note="matches EST AI937197 from clone IMAGE:2467500" misc_feature 225..584 /note="matches EST W16245 from clone 334178" misc_feature complement(248..779) /note="matches EST AA777840 from clone 448712" misc_feature complement(join(251..271,269..296,310..930)) /note="matches EST AI421848 from clone IMAGE:2103192" misc_feature complement(join(259..378,384..409,407..572)) /note="matches EST AA699668 from clone 446871" misc_feature complement(268..928) /note="matches EST AI692933 from clone IMAGE:2338788" misc_feature complement(join(268..590,642..929)) /note="matches EST AI829093 from clone IMAGE:2405113" misc_feature complement(280..783) /note="matches EST AI952237 from clone IMAGE:2547056" exon 283..392 /number=4 misc_feature complement(295..779) /note="matches EST AI148395 from clone IMAGE:1709613" misc_feature complement(304..561) /note="matches EST AI581884 from clone IMAGE:2173957" misc_feature 329..660 /note="matches EST AI788304 from clone IMAGE:1973005" misc_feature 329..664 /note="matches EST AI956373 from clone IMAGE:2136309" misc_feature 329..665 /note="matches EST AI315838 from clone IMAGE:1923065" misc_feature join(329..664,781..806) /note="matches EST AI789078 from clone IMAGE:1972466" misc_feature complement(334..535) /note="matches EST AU016167 from clone J0721E05" misc_feature complement(join(356..416,413..474,470..930)) /note="matches EST AI203516 from clone IMAGE:1732397" misc_feature join(372..627,624..656) /note="matches EST AA033571 from clone 471162" misc_feature complement(join(384..414,442..611,608..930)) /note="matches EST H97495 from clone 251935" exon 393..590 /number=5 misc_feature complement(396..930) /note="matches EST AI122642 from clone IMAGE:1693852" misc_feature complement(418..930) /note="matches EST AI127477 from clone IMAGE:1708267" misc_feature complement(421..931) /note="matches EST AI076212 from clone IMAGE:1670672" misc_feature join(422..664,665..777) /note="matches EST W07693 from clone 300925" misc_feature complement(440..930) /note="matches EST AI283633 from clone IMAGE:1864505" misc_feature 450..583 /note="matches EST W58841 from clone 371707" misc_feature 450..534 /note="matches EST AA612466 from clone 1064595" misc_feature complement(452..940) /note="matches EST AI138687 from clone IMAGE:1710422" misc_feature complement(458..936) /note="matches EST AI092444 from clone IMAGE:1683429" misc_feature complement(502..930) /note="matches EST AI122672 from clone IMAGE:1693875" misc_feature complement(508..930) /note="matches EST AI184314 from clone IMAGE:1731855" misc_feature complement(532..940) /note="matches EST AI299273 from clone IMAGE:1901019" misc_feature join(533..664,905..955) /note="matches EST N31551 from clone 266055" misc_feature join(560..584,583..611) /note="matches EST AA028191 from clone 469877" misc_feature complement(572..935) /note="matches EST AI309937 from clone IMAGE:1913986" misc_feature complement(582..940) /note="matches EST AI823949 from clone IMAGE:2403462" exon 591..1213 /number=6 misc_feature complement(616..933) /note="matches EST AI672641 from clone IMAGE:2345033" misc_feature complement(632..932) /note="matches EST T84051 from clone 114179" misc_feature complement(756..930) /note="matches EST AI913161 from clone IMAGE:2297671" BASE COUNT 322 a 240 c 270 g 381 t ORIGIN 1 ggcagccgag gagaccccgc gcagtgctgc caacgccccg gtggagaagc tgaggtcatc 61 atcagatttg aaatatttaa agtggataca aaactatttc agcaatgcag acaattaagt 121 gtgttgttgt gggcgatggt gctgttggta aaacatgtct cctgatatcc tacacaacaa 181 acaaatttcc atcggaatat gtaccgactg tttttgacaa ctatgcagtc acagttatga 241 ttggtggaga accatatact cttggacttt ttgatactgc agggcaagag gattatgaca 301 gattacgacc gctgagttat ccacaaacag atgtatttct agtctgtttt tcagtggtct 361 ctccatcttc atttgaaaac gtgaaagaaa agtgggtgcc tgagataact caccactgtc 421 caaagactcc tttcttgctt gttgggactc aaattgatct cagagatgac ccctctacta 481 ttgagaaact tgccaagaac aaacagaagc ctatcactcc agagactgct gaaaagctgg 541 cccgtgacct gaaggctgtc aagtatgtgg agtgttctgc acttacacag aaaggcctaa 601 agaatgtatt tgacgaagca atattggctg ccctggagcc tccagaaccg aagaagagcc 661 gcaggtgtgt gctgctatga acatctctcc agagcccttt ctgcacagct ggtgtcggca 721 tcatactaaa agcaatgttt aaatcaaact aaagattaaa aattaaaatt cgtttttgca 781 ataatgacaa atgccctgca cctacccaca tgcactcgtg tgagacaagg cccataggta 841 tggccccccc cttccccctc ccagtactag ttaattttga gtaattgtat tgtcagaaaa 901 gtgattagta ctattttttt ttgttgtttc aaaaaaaaaa tttttgtgtg tgtgtgtttt 961 tttttttttt ttttttgttg tttaaaagca aggcatgctt gtggatgact ctgtaacaga 1021 ctaattggaa ttgttgaagc tgctccctgg ttccactctg gagagtaatc tgggacatct 1081 tagtgttttg ttttgttttt ttccctcctc ttttttttgg gggggagtgt gtgtggggtt 1141 tgttttttag tcttgttttt ttaattcatt aaccagtggt tagcccttaa ggggaggagg 1201 acggattgat tcc //