LOCUS       AJ619020                 288 bp    mRNA    linear   HUM 18-DEC-2003
DEFINITION  Homo sapiens partial mRNA for transforming growth factor beta
            receptor 1 (TBETAR 1 gene), short variant.
ACCESSION   AJ619020
VERSION     AJ619020.1
KEYWORDS    alternative splicing; TBETAR 1 gene; transforming growth factor
            beta receptor 1.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 288)
  AUTHORS   Konrad L.
  JOURNAL   Submitted (17-DEC-2003) to the INSDC. Konrad L., Urologie,
            Uniklinikum Lahnberge, Baldingerstr, 35033 Marburg, GERMANY.
REFERENCE   2
  AUTHORS   Konrad L., Voelck-Badouin E.
  TITLE     Alternative splicing of TGF-betas and their receptors
  JOURNAL   Unpublished.
FEATURES             Location/Qualifiers
     source          1..288
                     /db_xref="H-InvDB:HIT000249269"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /geo_loc_name="Germany"
                     /dev_stage="adult"
                     /cell_line="hPCPs"
                     /cell_type="fibroblasts"
                     /tissue_type="prostate"
                     /db_xref="taxon:9606"
     CDS             <1..>288
                     /codon_start=2
                     /gene="TBETAR 1"
                     /product="transforming growth factor beta receptor 1"
                     /function="high-affinity receptor"
                     /note="short variant"
                     /db_xref="GOA:P36897"
                     /db_xref="H-InvDB:HIT000249269.12"
                     /db_xref="HGNC:HGNC:11772"
                     /db_xref="InterPro:IPR000333"
                     /db_xref="InterPro:IPR000472"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR003605"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="PDB:1B6C"
                     /db_xref="PDB:1IAS"
                     /db_xref="PDB:1PY5"
                     /db_xref="PDB:1RW8"
                     /db_xref="PDB:1TBI"
                     /db_xref="PDB:1VJY"
                     /db_xref="PDB:2L5S"
                     /db_xref="PDB:2PJY"
                     /db_xref="PDB:2WOT"
                     /db_xref="PDB:2WOU"
                     /db_xref="PDB:2X7O"
                     /db_xref="PDB:3FAA"
                     /db_xref="PDB:3GXL"
                     /db_xref="PDB:3HMM"
                     /db_xref="PDB:3KCF"
                     /db_xref="PDB:3KFD"
                     /db_xref="PDB:3TZM"
                     /db_xref="PDB:4X0M"
                     /db_xref="PDB:4X2F"
                     /db_xref="PDB:4X2G"
                     /db_xref="PDB:4X2J"
                     /db_xref="PDB:4X2K"
                     /db_xref="PDB:4X2N"
                     /db_xref="PDB:5E8S"
                     /db_xref="PDB:5E8T"
                     /db_xref="PDB:5E8U"
                     /db_xref="PDB:5E8W"
                     /db_xref="PDB:5E8X"
                     /db_xref="PDB:5E8Z"
                     /db_xref="PDB:5E90"
                     /db_xref="PDB:5FRI"
                     /db_xref="PDB:5QIK"
                     /db_xref="PDB:5QIL"
                     /db_xref="PDB:5QIM"
                     /db_xref="PDB:5USQ"
                     /db_xref="PDB:6B8Y"
                     /db_xref="PDB:6MAC"
                     /db_xref="UniProtKB/Swiss-Prot:P36897"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /protein_id="CAF02097.1"
                     /translation="TTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQD
                     HCNKIELPTTVKSSPGLGPVELAAVIAGPVCFVCISLMLMVYICHNRTVIH"
BASE COUNT           79 a           75 c           56 g           78 t
ORIGIN      
        1 gaccacagac aaagttatac acaacagcat gtgtatagct gaaatcgact taattcctcg
       61 agataggccg tttgtatgtg caccctcttc aaaaactggg tctgtgacta caacatattg
      121 ctgcaatcag gaccattgca ataaaataga acttccaact actgtaaagt catcacctgg
      181 ccttggtcct gtggaactgg cagctgtcat tgccggacca gtgtgcttcg tctgcatctc
      241 actcatgttg atggtctata tctgccacaa ccgcactgtc attcacca
//