LOCUS       AJ311648                1376 bp    DNA     linear   VRT 14-NOV-2006
DEFINITION  Gallus gallus AVR2 gene for putative avidin-related protein 2
            (AVR2), exons 1-4.
ACCESSION   AJ311648
VERSION     AJ311648.1
KEYWORDS    avidin-related protein 2 (AVR2); avr2 gene.
SOURCE      Gallus gallus (chicken)
  ORGANISM  Gallus gallus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
            Phasianidae; Phasianinae; Gallus.
REFERENCE   1  (bases 1 to 1376)
  AUTHORS   Ahlroth M.K.
  JOURNAL   Submitted (09-MAR-2001) to the INSDC. Ahlroth M.K., Department of
            Biological and Environmental Science, University of Jyvaskyla, PO
            Box 35, FIN-40351 Jyvaskyla, FINLAND.
REFERENCE   2
  AUTHORS   Ahlroth M.K., Kola E.H., Ewald D., Masabanda J., Sazanov A.,
            Fries R., Kulomaa M.S.
  TITLE     Characterization and chromosomal localization of the chicken avidin
            gene family
  JOURNAL   Anim. Genet. 31(6), 367-375(2000).
   PUBMED   11167523
REFERENCE   3
  AUTHORS   Keinaenen R.A., Laukkanen M.L., Kulomaa M.S.
  TITLE     Molecular cloning of three structurally related genes for chicken
            avidin
  JOURNAL   J. Steroid Biochem. 30(1-6), 17-21(1988).
   PUBMED   2838690
REFERENCE   4
  AUTHORS   Keinaenen R.A., Wallen M.J., Kristo P.A., Laukkanen M.O.,
            Toimela T.A., Helenius M.A., Kulomaa M.S.
  TITLE     Molecular cloning and nucleotide sequence of chicken avidin-related
            genes 1-5
  JOURNAL   Eur. J. Biochem. 220(2), 615-621(1994).
   PUBMED   8125122
FEATURES             Location/Qualifiers
     source          1..1376
                     /organism="Gallus gallus"
                     /chromosome="Z"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:9031"
     regulatory      160..166
                     /regulatory_class="TATA_box"
     mRNA            join(<235..315,400..604,1031..1151,1239..>1284)
                     /gene="AVR2"
                     /product="putative avidin-related protein 2 (AVR2)"
     sig_peptide     235..306
                     /gene="AVR2"
     CDS             join(235..315,400..604,1031..1151,1239..1284)
                     /gene="AVR2"
                     /product="putative avidin-related protein 2 (AVR2)"
                     /db_xref="GOA:P56732"
                     /db_xref="InterPro:IPR005468"
                     /db_xref="InterPro:IPR005469"
                     /db_xref="InterPro:IPR017889"
                     /db_xref="InterPro:IPR036896"
                     /db_xref="PDB:1WBI"
                     /db_xref="UniProtKB/Swiss-Prot:P56732"
                     /protein_id="CAC34570.1"
                     /translation="MVHATSPLLLLLLLSLALVAPSLSARKCSLTGEWDNDLGSIMTI
                     GAVNDNGEFDGTYITAVADNPGNITLSPLLGIQHKRASQPTFGFTVHWNFSESTSVFV
                     GQCFVDRSGKEVLKTKWLQRLAVDDISDDWIATRVGNNDFTRQHTVEE"
     exon            235..315
                     /gene="AVR2"
                     /number=1
     intron          316..399
                     /gene="AVR2"
                     /number=1
     exon            400..604
                     /gene="AVR2"
                     /number=2
     intron          605..1030
                     /gene="AVR2"
                     /number=2
     exon            1031..1151
                     /gene="AVR2"
                     /number=3
     intron          1152..1238
                     /gene="AVR2"
                     /number=3
     exon            1239..1284
                     /gene="AVR2"
                     /number=4
     regulatory      1347..1352
                     /regulatory_class="polyA_signal_sequence"
BASE COUNT          269 a          448 c          356 g          303 t
ORIGIN      
        1 gaccttacct tgaaaccctt gaattctaga gacccgatcc acctgctggt gagtttgata
       61 ttcgtctctg gtcttcattt tggggttgtg cgttcaactg gaaaacgtga ccccacccag
      121 attgcgtaac acctgggaag aaaagcctgc gccgggagca ataaaaggcg agggagcagg
      181 cgaggagggg tgagtcctgc aaggagcaca cccggctgtc cacctgctgc agagatggtg
      241 cacgcaacct ccccgctgct gctgctgctg ctgctcagcc tggctctggt ggctcccagc
      301 ctctctgcca gaaaggtaac gggatggggc tgggagtggg tgcacctggt gcccaccact
      361 gcctcctgcc cgccactgac tccttcttct tcattgcagt gctcgctgac tggggaatgg
      421 gacaacgacc tgggctccat catgaccatc ggagctgtga acgacaatgg cgagttcgat
      481 ggcacctaca tcacagctgt agcagataat ccaggaaaca tcacgctatc accactgctt
      541 gggatccaac acaaaagagc cagccagccc acttttggct tcactgtcca ttggaacttt
      601 tcaggtgctt ctctcccagc ctccctgcaa tgtccctgct cctctgctgt gcttccctgt
      661 gacaaacccc tttgctttcc tgcccttccc cacgctgtct ccagtgctct cctgcccttc
      721 cctacagtct ccctgacggt ctctcctcct cgctgtggtg tccctgatga tttccagccc
      781 atccctgcaa tcccctcaac aatgccctgc ctcccatgcc cccggtgctg ccccatccct
      841 tcctgtagag ctgctgggct gctgtcacct ccaggtcccc gggtgcaggg gaagtgctgg
      901 ggctgtcccc agagggcaca gagagctcag atgagttgtc ccctgggcag agggaccatg
      961 gcactggcac tgccctgccc tgcgtggggc tcacaacccc actcccctca tctgcccctt
     1021 ttcccaacag agtccaccag tgtctttgtg ggccagtgct tcgtggacag gagcggaaag
     1081 gaggtcctga agaccaaatg gctgcaacgg ttagcagttg atgacattag tgatgactgg
     1141 atagctacca ggtgagccca gggcagaggc acacggtccc gggctgtgac tcaatggctg
     1201 tgcacttccc accttacatc tcctctctct ccccgcaggg tcggcaacaa cgacttcact
     1261 cgccagcaca cagtggaaga gtgaggatgg ccccgcaaag ccagcaacaa tgccggagtg
     1321 ctgacactgc ttgtgatatt cctcccaata aagcttatcg ataccgtcga cctcga
//