LOCUS       AJ278709                 440 bp    mRNA    linear   INV 25-JUL-2000
DEFINITION  Drosophila melanogaster mRNA for putative transcription factor
            (CG14283 gene).
ACCESSION   AJ278709
VERSION     AJ278709.1
KEYWORDS    CG14283 gene; transcription factor.
SOURCE      Drosophila melanogaster (fruit fly)
  ORGANISM  Drosophila melanogaster
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Holometabola; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
REFERENCE   1  (bases 1 to 440)
  AUTHORS   Tselykh T.V.
  JOURNAL   Submitted (21-JUL-2000) to the INSDC. Tselykh T.V., Developmental
            Biology Program, Institute of Biotechnology, PB 56 (Viikinkaari 9),
            FIN-00014 University of Helsinki, FINLAND.
REFERENCE   2
  AUTHORS   Tselykh T.V., Roos C., Heino T.I.
  TITLE     Identification and molecular characterisation of a novel putative
            transcription factor conserved from Drosohila to human
  JOURNAL   Unpublished.
COMMENT     related Drosoohila genomic sequence AE003725
FEATURES             Location/Qualifiers
     source          1..440
                     /organism="Drosophila melanogaster"
                     /mol_type="mRNA"
                     /dev_stage="embryonic"
                     /db_xref="taxon:7227"
     5'UTR           1..64
                     /note="CG14283"
     CDS             65..388
                     /product="putative transcription factor"
                     /note="CG14283"
                     /db_xref="GOA:Q9VE04"
                     /db_xref="InterPro:IPR018615"
                     /db_xref="UniProtKB/Swiss-Prot:Q9VE04"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /protein_id="CAB99479.1"
                     /translation="MLLKQLPQAVQQIRCISSATTAVTRLHRSVYCRLYPTVVVQPDG
                     STINIRYHEPRKIIKLPLDLSTLTDAERRARLEARKPRKKVKIMEEVEDNFNAKKYMK
                     YIKKK"
     polyA_site      433
                     /note="CG14283"
                     /experiment="experimental evidence, no additional details
                     recorded"
BASE COUNT          136 a          102 c          104 g           98 t
ORIGIN      
        1 ggcagcaaaa acacgattta agtgtagctc ttatttagtg taaatattgt gattatcaat
       61 taaaatgttg ctgaaacagt tgccccaggc tgttcagcag atacgctgca tctcatcggc
      121 cacgacggcg gttaccaggc tgcatcgctc ggtttactgc cggctatatc ccacagttgt
      181 ggtgcaaccc gatggatcca cgataaacat ccgctatcac gagcccagga agattatcaa
      241 gcttcccttg gatctgagca ccttaaccga tgcggagcgc agagcgagat tggaggcccg
      301 caagccgcgc aagaaggtca agatcatgga ggaggtggag gacaacttca acgccaagaa
      361 gtacatgaag tacatcaaaa agaagtagcc gcattttatt cactatttgt taaataaaac
      421 acgaaagccc gttaaaaaaa
//