LOCUS       AJ242484                 196 bp    mRNA    linear   PLN 15-APR-2005
DEFINITION  Arabidopsis thaliana mRNA for partial FKBP like protein, (fkbpb
            gene).
ACCESSION   AJ242484
VERSION     AJ242484.1
KEYWORDS    FKBP protein; fkbpb gene.
SOURCE      Arabidopsis thaliana (thale cress)
  ORGANISM  Arabidopsis thaliana
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Camelineae; Arabidopsis.
REFERENCE   1  (bases 1 to 196)
  AUTHORS   Billion K.
  JOURNAL   Submitted (17-MAY-1999) to the INSDC. Billion K., Botanisches
            Institut in der MPG, Universitaet zu Koeln, Carl-von-Linne-Weg 10,
            50829 Koeln, GERMANY.
REFERENCE   2
  AUTHORS   Kolukisaoglu U., Billion K., Eckhoff A., Moeller A., Saal B.,
            Wanke D., Schulz B.
  TITLE     Structure and evolution of FKBP-like genes in Arabidopsis
  JOURNAL   Unpublished.
FEATURES             Location/Qualifiers
     source          1..196
                     /organism="Arabidopsis thaliana"
                     /mol_type="mRNA"
                     /db_xref="taxon:3702"
     CDS             <1..>196
                     /codon_start=2
                     /gene="fkbpb"
                     /product="FKBP-l ke gene"
                     /EC_number="5.2.1.8"
                     /db_xref="GOA:Q9FLB3"
                     /db_xref="InterPro:IPR001179"
                     /db_xref="UniProtKB/Swiss-Prot:Q9FLB3"
                     /protein_id="CAB64724.1"
                     /translation="FDSTVGKSRYKFRLDAGKVIKGLDVGLNGMLVGGKRKLTIPPEM
                     GYGAEGAGSIPPDSWLVFDVE"
BASE COUNT           47 a           34 c           55 g           60 t
ORIGIN      
        1 tttcgattcc accgttggaa aatcacgtta taagtttcgt ctagatgctg gaaaagtcat
       61 taagggattg gatgttggcc ttaatggaat gcttgttggt ggcaaaagaa agcttacaat
      121 tcctccagaa atggggtatg gtgcggaagg tgctggtagc attccccctg actcttggct
      181 ggtctttgat gtcgag
//