LOCUS       AF414048                 414 bp    DNA     linear   BCT 26-JUL-2016
DEFINITION  Methanothermococcus thermolithotrophicus strain DSM 2095
            methyl-coenzyme M reductase alpha subunit (mcrA) gene, partial cds.
ACCESSION   AF414048
VERSION     AF414048.1
KEYWORDS    .
SOURCE      Methanothermococcus thermolithotrophicus DSM 2095
  ORGANISM  Methanothermococcus thermolithotrophicus DSM 2095
            Archaea; Euryarchaeota; Methanomada group; Methanococci;
            Methanococcales; Methanococcaceae; Methanothermococcus.
REFERENCE   1  (bases 1 to 414)
  AUTHORS   Luton,P.E., Wayne,J.M., Sharp,R.J. and Riley,P.W.
  TITLE     The mcrA gene as an alternative to 16S rRNA in the phylogenetic
            analysis of methanogen populations in landfill
  JOURNAL   Microbiology (Reading, Engl.) 148 (PT 11), 3521-3530 (2002)
   PUBMED   12427943
REFERENCE   2  (bases 1 to 414)
  AUTHORS   Riley,P.W. and Wayne,J.M.
  TITLE     Direct Submission
  JOURNAL   Submitted (26-AUG-2001) Research Division, Center for Applied
            Microbiology and Research, Porton Down, Salisbury, Wiltshire SP4
            0JG, UK
FEATURES             Location/Qualifiers
     source          1..414
                     /organism="Methanothermococcus thermolithotrophicus DSM
                     2095"
                     /mol_type="genomic DNA"
                     /strain="DSM 2095"
                     /type_material="type strain of Methanococcus
                     thermolithotrophicus"
                     /db_xref="taxon:523845"
     gene            <1..>414
                     /gene="mcrA"
     CDS             <1..>414
                     /gene="mcrA"
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-coenzyme M reductase alpha subunit"
                     /protein_id="AAL29297.1"
                     /translation="YTDDILDDFAYYGYEYVEKKYGINSTKPTMDVVEDIATEVTLYS
                     LEQYDEFPTLLEDHFGGSQRAAVAAAASGISVCMATGNSNAGVNGWYLSQIMHKEYHS
                     RLGFYGYDLQDQCGASNSLSIRNDEASPLELRGPNY"
BASE COUNT          143 a           93 c           83 g           95 t
ORIGIN      
        1 tacaccgacg acatcttaga cgacttcgca tactacggat acgaatacgt agagaagaaa
       61 tacggaataa acagtacaaa accaacaatg gatgttgttg aagacattgc tacagaagtt
      121 acactctact cattagaaca gtacgacgaa ttcccaacat tattagaaga ccacttcgga
      181 ggttcccaaa gagctgctgt tgctgcagct gcttcaggta tctcagtatg tatggctaca
      241 ggaaactcaa acgctggtgt taacggctgg tacttaagcc aaatcatgca caaagaatac
      301 cacagcagac ttggattcta cggatacgac ttacaagacc agtgtggagc ttcaaactca
      361 ctttcaatta gaaacgacga agcttcacca ttggaattaa gaggtccaaa ctac
//