LOCUS AF260244 1020 bp mRNA linear INV 28-JUL-2006 DEFINITION Caenorhabditis elegans stearoyl-CoA desaturase FAT-6 (fat-6) mRNA, complete cds. ACCESSION AF260244 VERSION AF260244.1 KEYWORDS . SOURCE Caenorhabditis elegans ORGANISM Caenorhabditis elegans Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida; Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis. REFERENCE 1 (bases 1 to 1020) AUTHORS Brock,T.J., Browse,J. and Watts,J.L. TITLE Genetic regulation of unsaturated fatty acid composition in C. elegans JOURNAL PLoS Genet. 2 (7), E108 (2006) PUBMED 16839188 REFERENCE 2 (bases 1 to 1020) AUTHORS Watts,J.L. and Browse,J. TITLE A Palmitoyl-CoA-Specific Fatty Acid Desaturase from Caenorhabditis elegans JOURNAL Unpublished REFERENCE 3 (bases 1 to 1020) AUTHORS Watts,J.L. and Browse,J. TITLE Direct Submission JOURNAL Submitted (25-APR-2000) Institute of Biological Chemistry, Washington State University, Clark Hall, Pullman, WA 99610-6340, USA FEATURES Location/Qualifiers source 1..1020 /organism="Caenorhabditis elegans" /mol_type="mRNA" /db_xref="taxon:6239" /chromosome="IV" gene 1..1020 /gene="fat-6" CDS 1..1020 /gene="fat-6" /note="similar to Caenorhabditis elegans VZK8221.1 protein" /codon_start=1 /product="stearoyl-CoA desaturase FAT-6" /protein_id="AAF97550.1" /translation="MTVKTRSNIAKKIEKDGGPETQYLAVDPNEIIQLQEESKKIPYK MEIVWRNVALFAALHFAAAIGLYQLIFEAKWQTVIFTFLLYVFGGFGITAGAHRLWSH KSYKATTPMRIFLMILNNIALQNDVIEWARDHRCHHKWTDTDADPHNTTRGFFFAHMG WLLVRKHPQVKEQGAKLDMSDLLSDPVLVFQRKHYFPLVILCCFILPTIIPVYFWKET AFIAFYTAGTFRYCFTLHATWCINSAAHYFGWKPYDSSITPVENVFTTIAAVGEGGHN FHHTFPQDYRTSEYSLKYNWTRVLIDTAAALGLVYDRKTACDEIIGRQVSNHGCDIQR GKSIM" BASE COUNT 287 a 254 c 205 g 274 t ORIGIN 1 atgacggtaa aaactcgttc aaacatcgca aaaaagattg agaaggacgg cggcccagag 61 acgcaatatc tcgccgtgga tccaaatgaa attattcaac ttcaagagga gagcaagaag 121 atcccatata aaatggaaat tgtgtggcgt aacgtggctc tctttgctgc tcttcacttc 181 gctgcagcca tcggactcta ccagctcatc ttcgaggcaa aatggcaaac cgtgattttc 241 acattccttc tgtatgtgtt cggaggattt ggaataaccg ccggagctca tcgtctctgg 301 tcccacaaat catacaaagc aacaactcca atgagaatct tcttgatgat cttgaacaat 361 attgctcttc aaaatgacgt catcgaatgg gctcgtgatc atcgttgcca tcacaagtgg 421 actgataccg atgctgatcc acataacacc actcgtggat tcttcttcgc tcatatggga 481 tggcttcttg tgcgtaagca tccacaagtt aaggaacaag gagccaagct tgacatgtct 541 gatctcttga gtgacccagt tctcgtcttc cagagaaaac attacttccc acttgtcatc 601 ttgtgctgct tcattcttcc aacaattatc ccagtttact tctggaagga gactgcattc 661 attgccttct acacagctgg aacattccgt tattgcttca cacttcatgc tacatggtgc 721 atcaacagcg ctgctcacta tttcggatgg aagccatacg attcctcaat taccccagtc 781 gaaaacgtct tcaccacaat tgctgccgtc ggagagggag gtcacaactt ccatcacaca 841 ttcccacaag actacagaac atctgaatac tcattgaaat acaattggac acgtgtcctt 901 attgatactg cagctgctct tggacttgtc tacgaccgga aaactgcttg tgatgagatt 961 atcggccggc aggtatccaa tcatggatgt gatattcaac gaggaaaatc aatcatgtaa //