LOCUS       AF206662                 957 bp    mRNA    linear   PLN 20-JUL-2000
DEFINITION  Mortierella alpina long chain polyunsaturated fatty acid elongation
            enzyme (GLELO) mRNA, complete cds.
ACCESSION   AF206662
VERSION     AF206662.1
KEYWORDS    .
SOURCE      Mortierella alpina
  ORGANISM  Mortierella alpina
            Eukaryota; Fungi; Fungi incertae sedis; Mucoromycota;
            Mortierellomycotina; Mortierellomycetes; Mortierellales;
            Mortierellaceae; Mortierella.
REFERENCE   1  (bases 1 to 957)
  AUTHORS   Parker-Barnes,J.M., Das,T., Bobik,E., Leonard,A.E., Thurmond,J.M.,
            Chaung,L.T., Huang,Y.S. and Mukerji,P.
  TITLE     Identification and characterization of an enzyme involved in the
            elongation of n-6 and n-3 polyunsaturated fatty acids
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 97 (15), 8284-8289 (2000)
   PUBMED   10899997
REFERENCE   2  (bases 1 to 957)
  AUTHORS   Parker-Barnes,J.M., Das,T., Bobik,E., Leonard,A.E., Thurmond,J.M.,
            Chuang,L., Huang,Y.S. and Mukerji,P.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-NOV-1999) Strategic Discovery Research, Ross Products
            Division, Abbott Laboratories, 3300 Stelzer Road, Columbus, OH
            43219, USA
FEATURES             Location/Qualifiers
     source          1..957
                     /organism="Mortierella alpina"
                     /mol_type="mRNA"
                     /strain="ATCC 32221"
                     /db_xref="ATCC:32221"
                     /db_xref="taxon:64518"
     gene            1..957
                     /gene="GLELO"
     CDS             1..957
                     /gene="GLELO"
                     /function="involved in the conversion of GLA to DGLA"
                     /function="involved in the conversion of stearidonic acid
                     to 20:4n-3"
                     /codon_start=1
                     /product="long chain polyunsaturated fatty acid elongation
                     enzyme"
                     /protein_id="AAF70417.1"
                     /translation="MESIAPFLPSKMPQDLFMDLATAIGVRAAPYVDPLEAALVAQAE
                     KYIPTIVHHTRGFLVAVESPLARELPLMNPFHVLLIVLAYLVTVFVGMQIMKNFERFE
                     VKTFSLLHNFCLVSISAYMCGGILYEAYQANYGLFENAADHTFKGLPMAKMIWLFYFS
                     KIMEFVDTMIMVLKKNNRQISFLHVYHHSSIFTIWWLVTFVAPNGEAYFSAALNSFIH
                     VIMYGYYFLSALGFKQVSFIKFYITRSQMTQFCMMSVQSSWDMYAMKVLGRPGYPFFI
                     TALLWFYMWTMLGLFYNFYRKNAKLAKQAKADAAKEKARKLQ"
BASE COUNT          187 a          273 c          241 g          256 t
ORIGIN      
        1 atggagtcga ttgcgccatt cctcccatca aagatgccgc aagatctgtt tatggacctt
       61 gccaccgcta tcggtgtccg ggccgcgccc tatgtcgatc ctctcgaggc cgcgctggtg
      121 gcccaggccg agaagtacat ccccacgatt gtccatcaca cgcgtgggtt cctggtcgcg
      181 gtggagtcgc ctttggcccg tgagctgccg ttgatgaacc cgttccacgt gctgttgatc
      241 gtgctcgctt atttggtcac ggtctttgtg ggcatgcaga tcatgaagaa ctttgagcgg
      301 ttcgaggtca agacgttttc gctcctgcac aacttttgtc tggtctcgat cagcgcctac
      361 atgtgcggtg ggatcctgta cgaggcttat caggccaact atggactgtt tgagaacgct
      421 gctgatcata ccttcaaggg tcttcctatg gccaagatga tctggctctt ctacttctcc
      481 aagatcatgg agtttgtcga caccatgatc atggtcctca agaagaacaa ccgccagatc
      541 tccttcttgc acgtttacca ccacagctcc atcttcacca tctggtggtt ggtcaccttt
      601 gttgcaccca acggtgaagc ctacttctct gctgcgttga actcgttcat ccatgtgatc
      661 atgtacggct actacttctt gtcggccttg ggcttcaagc aggtgtcgtt catcaagttc
      721 tacatcacgc gctcgcagat gacacagttc tgcatgatgt cggtccagtc ttcctgggac
      781 atgtacgcca tgaaggtcct tggccgcccc ggatacccct tcttcatcac ggctctgctt
      841 tggttctaca tgtggaccat gctcggtctc ttctacaact tttacagaaa gaacgccaag
      901 ttggccaagc aggccaaggc cgacgctgcc aaggagaagg caaggaagtt gcagtaa
//