LOCUS       AF033336                 423 bp    mRNA    linear   VRT 17-SEP-1998
DEFINITION  Gallus gallus beta-defensin prepropeptide (GAL2) mRNA, complete
            cds.
ACCESSION   AF033336
VERSION     AF033336.1
KEYWORDS    .
SOURCE      Gallus gallus (chicken)
  ORGANISM  Gallus gallus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
            Phasianidae; Phasianinae; Gallus.
REFERENCE   1  (bases 1 to 423)
  AUTHORS   Brockus,C.W., Jackwood,M.W. and Harmon,B.G.
  TITLE     Characterization of beta-defensin prepropeptide mRNA from chicken
            and turkey bone marrow
  JOURNAL   Anim. Genet. 29 (4), 283-289 (1998)
   PUBMED   9745666
REFERENCE   2  (bases 1 to 423)
  AUTHORS   Brockus,C.W., Harmon,B.G. and Jackwood,M.W.
  TITLE     Direct Submission
  JOURNAL   Submitted (07-NOV-1997) Veterinary Pathology, University of
            Georgia, College of Veterinary Medicine, Athens, GA 30602, USA
FEATURES             Location/Qualifiers
     source          1..423
                     /organism="Gallus gallus"
                     /mol_type="mRNA"
                     /db_xref="taxon:9031"
     gene            1..423
                     /gene="GAL2"
     CDS             28..222
                     /gene="GAL2"
                     /codon_start=1
                     /product="beta-defensin prepropeptide"
                     /protein_id="AAC36052.1"
                     /translation="MRILYLLFSLLFLALQVSPGLSSPRRDMLFCKGGSCHFGGCPSH
                     LIKVGSCFGFRSCCKWPWNA"
     mat_peptide     112..219
                     /gene="GAL2"
                     /product="beta-defensin"
                     /function="antimicrobial peptide"
BASE COUNT          106 a          105 c           87 g          125 t
ORIGIN      
        1 tatccgcagc tcagcagatc tgcagccatg aggattcttt acctgctttt ctctctcctc
       61 ttcctggcac tccaggtttc tccagggttg tcttcgcccc ggcgggacat gctgttctgt
      121 aaaggagggt cctgccactt tggagggtgt cccagccatc taatcaaagt cggaagctgc
      181 ttcgggttcc gttcctgctg caaatggcct tggaatgcat aaacacttca tgagtccatc
      241 aagagctttg aaaatttctt ccaggcatgt gctttaaatg ctacagcaaa gcctcagcag
      301 caagaagacc cctctcatgt gttaatgcaa tatgttttgt gttgtagagt aaatacaaat
      361 atcttctgca ctgcctttct tcctcttgaa taaattgtca ttgcatagca aaaaaaaaaa
      421 aaa
//