LOCUS       AF019905                 402 bp    DNA     linear   BCT 28-OCT-1999
DEFINITION  Micrococcus luteus major cold-shock protein (cspA) gene, complete
            cds.
ACCESSION   AF019905
VERSION     AF019905.1
KEYWORDS    .
SOURCE      Micrococcus luteus NCTC 2665
  ORGANISM  Micrococcus luteus NCTC 2665
            Bacteria; Actinomycetota; Actinomycetes; Micrococcales;
            Micrococcaceae; Micrococcus.
REFERENCE   1  (bases 1 to 402)
  AUTHORS   Neuhaus,K., Francis,K.P., Rapposch,S., Gorg,A. and Scherer,S.
  TITLE     Pathogenic Yersinia species carry a novel, cold-inducible major
            cold shock protein tandem gene duplication producing both
            bicistronic and monocistronic mRNA
  JOURNAL   J. Bacteriol. 181 (20), 6449-6455 (1999)
   PUBMED   10515936
REFERENCE   2  (bases 1 to 402)
  AUTHORS   Francis,K.P. and Stewart,G.S.A.B.
  TITLE     Gene Duplication: a mechanism for the evolution of bacterial major
            cold-shock protein families?
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 402)
  AUTHORS   Francis,K.P.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-AUG-1997) Applied Biochemistry and Food Science,
            University of Nottingham, Sutton Bonington Campus, Loughborough,
            Leicestershire LE12 5RD, England
FEATURES             Location/Qualifiers
     source          1..402
                     /organism="Micrococcus luteus NCTC 2665"
                     /mol_type="genomic DNA"
                     /strain="NCTC 2665"
                     /type_material="type strain of Micrococcus luteus"
                     /db_xref="taxon:465515"
     gene            135..338
                     /gene="cspA"
     CDS             135..338
                     /gene="cspA"
                     /note="CspA"
                     /codon_start=1
                     /transl_table=11
                     /product="major cold-shock protein"
                     /protein_id="AAB70836.1"
                     /translation="MAVGTVKWFNAEKGYGFIAPEDNSADVFVHFSAIQGNGFKELQE
                     NDRVEFETQDGPKGLQAANVTKL"
BASE COUNT           72 a          144 c          123 g           63 t
ORIGIN      
        1 cgtcagcccg gcatcgccgg cgtcgatgag tgttgggcaa gcggttcagt ctcgccgctt
       61 cacccgcgtc ccacatccgg gccgcggtcc aacaccgcca ccgcaccgcg ggggcacatc
      121 gaaaggacac catcatggct gtcggtactg tcaagtggtt caacgctgag aagggctacg
      181 gcttcatcgc ccccgaggac aactccgcgg acgtgttcgt gcacttctcc gccatccagg
      241 gcaacggctt caaggagctc caggagaacg accgcgtcga gttcgagacc caggacggcc
      301 ccaagggcct ccaggccgcc aacgtgacga agctctgatc ttcgcctgac gcacggcttc
      361 cgacgccccc ggtccacacg gaccgggggc gtcgtcgtgt gt
//