LOCUS AB169016 1922 bp mRNA linear PRI 06-OCT-2006 DEFINITION Macaca fascicularis testis cDNA, clone: QtsA-16612, similar to human serologically defined colon cancer antigen 10(SDCCAG10), mRNA, RefSeq: NM_005869.1. ACCESSION AB169016 VERSION AB169016.1 KEYWORDS FLI_CDNA; oligo capping; fis (full insert sequence). SOURCE Macaca fascicularis (crab-eating macaque) ORGANISM Macaca fascicularis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Cercopithecidae; Cercopithecinae; Macaca. REFERENCE 1 (bases 1 to 1922) AUTHORS Hashimoto,K., Kusuda,J. and Sugano,S. TITLE Direct Submission JOURNAL Submitted (18-MAR-2004) Contact:Katsuyuki Hashimoto National Institute of Infectious Diseases, Division of Genetic Resources; 23-1, Toyama 1-chome, Shinjuku-ku, Tokyo 162-8640, Japan URL :http://www.nih.go.jp/yoken/genebank/ REFERENCE 2 AUTHORS CONSRTM International consortium for macaque cDNA sequencing and analysis TITLE DNA sequences of macaque genes expressed in brain or testis and its evolutionary implications JOURNAL Unpublished REFERENCE 3 AUTHORS Osada,N., Hirata,M., Tanuma,R., Kusuda,J., Hida,M., Suzuki,Y., Sugano,S., Gojobori,T., Shen,C.-K.J., Wu,C.I. and Hashimoto,K. TITLE Substitution Rate and Structural Divergence of 5'UTR Evolution: Comparative Analysis Between Human and Cynomolgus Monkey cDNAs JOURNAL Mol. Biol. Evol. 22 (10), 1976-1982 (2005) COMMENT The International consortium for macaque cDNA sequencing and analysis consists of: Department of Virology and Human Genome Center, Institute of Medical Science, The University of Tokyo, Tokyo, Japan; Division of Genetic Resources, National Institute of Infectious Diseases of Japan, Tokyo, Japan; National Health Research Institute, Taipei, Taiwan; Institute of Molecular Biology, Academia Sinica, Taipei, Taiwan; Department of Ecology & Evolution, University of Chicago, Chicago, IL, USA; Center for Information Biology, National Institute of Genetics of Japan, Mishima, Japan. Clone distribution: clone distribution information can be found at: http://www.nih.go.jp/yoken/genebank/ Lab host: TOP10 Vector: pME18S-FL3 (Acc.No. AB009864) R. Site1: DraIII (CACTGTGTG) R. Site2: DraIII (CACCATGTG) Description: 1st strand cDNA was primed with an oligo(dT) primer [ATGTGGCCTTTTTTTTTTTTTTTTT]; double-stranded cDNA was synthesized using specific 5' and 3' primers and amplified by PCR. The PCR product was digested with SfiI and size selection was performed to exclude fragments <1.5kb.The SfiI-digested PCR product was cloned into distinct DraIII sites of pME18S-FL3. XhoI sites just outside the DraIII sites can be used to isolate the cDNA insert. Libraries were constructed by oligo-capping method. Libraries were made from: QccE: cerebellum cortex QnpA: parietal lobe QtrA: temporal lobe right QflA: frontal lobe left QmoA: medulla oblongata QbsA: brain stem QorA: occipital lobe right QtsA: testis Custom primers were used for 5' and 3'-end sequencing. The full-insert sequencing was done by primer-walking method using ABI DNA sequencer. FEATURES Location/Qualifiers source 1..1922 /clone="QtsA-16612" /db_xref="taxon:9541" /dev_stage="adult" /mol_type="mRNA" /note="clone_lib: macaque cDNA library QtsA" /organism="Macaca fascicularis" /sex="male" CDS 218..1639 /note="Homo sapiens serologically defined colon cancer antigen 10(SDCCAG10), mRNA, RefSeq: NM_005869.1" /protein_id="BAE01111.1" /translation="MSNIYIQEPPTNGKVLLKTTAGDIDIELWSKEAPKACRNFIQLC LEAYYDNTIFHRVVPGFIVQGGDPTGTGSGGESIYGAPFKDEFHSRLRFNRRGLVAMA NAGSHDNGSQFFFTLGRADELNNKHTIFGKVTGDTVYNMLRLSEVDIDDEERPHNPHK IKSCEVLFNPFDDIIPREIKRPKKEKPEEEVKKLKPKGTKNFSLLSFGEEAEEEEEEV NRVSQSMKGKSKSSHDLLKDDPHLSSVPVVESEKGDAAGDLDDDGEDESAEYDEYVDG DEKNLMRERIAKKLKKDTSANVKSAGEGEVEKKSVSRSEELRKEARQLKRELLAAKQK KVENEAKQAEKRSEEEEATPDGAVAEYRREKQKYEALRKQQSKKGTSREDQTLALLNQ FKSKLTQAIAETPENDIPETEVEDDEGWMSHVLQFEDKSRKVKDASMQDSDTFEIYDP RNPVNKRRREESKKLMREKKERR" BASE COUNT 695 a 312 c 465 g 450 t ORIGIN 1 aacggtgctc gggtccggta acaacatggc ggcgtccgtg aggggctcct ttaggcaagg 61 gtagtgtttg gtgtccccgt cttgcgtgat attgacaaac tgaagttttc ctgcatcact 121 cgacttaaga aagagtgtac tcctaggcgg acagctttag tgaccggccg tccgctctaa 181 tccctcataa ggagcagagt cctttgtact gaccaggatg agcaacatct acatccagga 241 gcctcccacg aatgggaagg ttttattgaa aactacagct ggagatattg acatagagtt 301 gtggtccaaa gaagctccta aagcttgcag aaattttatc caactttgtt tggaagctta 361 ttatgacaat accatttttc atagagttgt gcctggtttt atagtccaag gcggagatcc 421 tactggcaca gggagtggtg gagagtctat ctatggagca ccattcaaag atgaatttca 481 ttcacggttg cgttttaatc ggagaggcct ggttgccatg gcaaatgctg gttctcatga 541 taatggcagc cagtttttct tcacactggg tcgagcggat gaacttaaca ataagcatac 601 catctttgga aaggtcacag gggatacagt atataacatg ttgcgactgt cagaagtaga 661 cattgatgat gaagaaagac cacataatcc acacaaaata aaaagctgtg aggttttgtt 721 taatcctttt gatgacatca ttccaaggga aattaaaagg ccgaaaaaag agaaaccaga 781 ggaggaagta aagaaattga aacccaaagg cacaaaaaat tttagtttac tttcatttgg 841 agaggaagct gaggaagaag aggaggaagt aaatcgagtt agtcagagca tgaagggcaa 901 aagcaaaagt agtcatgact tgcttaagga tgatccacat ctcagttctg ttccagttgt 961 agaaagtgaa aaaggtgatg cagcgggaga tttagatgat gatggagaag atgaaagtgc 1021 agagtatgat gaatatgttg atggtgatga aaagaacctg atgagagaaa gaattgccaa 1081 aaagttaaaa aaggacacaa gcgcgaatgt taaatcagct ggagaaggag aagtggagaa 1141 gaaatcagtc agccgcagcg aagagctcag aaaagaagca agacaattaa aacgggaact 1201 cttagcagca aaacaaaaaa aagtagaaaa tgaagcaaaa caagcagaaa aaagaagtga 1261 agaggaagag gccactccag atggtgctgt tgccgaatac agaagagaaa agcaaaagta 1321 tgaagctttg aggaagcaac agtcaaagaa gggaacttcc cgggaagatc agacccttgc 1381 actgctgaac cagtttaaat ctaaacttac tcaagcaatt gctgaaacgc ctgaaaatga 1441 cattcctgaa acagaagtag aagatgatga aggatggatg tcacatgtac ttcagtttga 1501 ggataaaagc agaaaagtga aagatgcaag catgcaagac tcagatacat ttgaaatcta 1561 tgatcctcgg aatccagtga ataaaagaag gagggaagaa agcaaaaagc tgatgagaga 1621 gaaaaaagaa agaagataaa atgagaataa tgataaccag aacttgctgg aaatgtgcct 1681 gcaatggcct tgtaacagcc attgttccca acagcatcac ttaggggtgt gaaaagaagt 1741 atttttgaac ctgttgtctg gttttgaaaa acaattatct tgttttgcaa attgtggaat 1801 gatgtaagca aatgcttttg gttactggta catgcgtttt ttcctagctg accttttata 1861 ttgctaaatc tgaaataaaa taactttcct tccaaaaaaa aaaaaaaaaa aaaaaaaaaa 1921 aa //