LOCUS AB115585 439 bp DNA linear INV 30-JAN-2009 DEFINITION Asphondylia baca mitochondrial COI gene forcytochrome oxidaze subunit 1, partial cds, isolate: Asp.baca38(Ampelopsis). ACCESSION AB115585 VERSION AB115585.1 KEYWORDS . SOURCE mitochondrion Asphondylia baca (ampelopsis fruit midge) ORGANISM Asphondylia baca Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Nematocera; Sciaroidea; Cecidomyiidae; Asphondylia. REFERENCE 1 (bases 1 to 439) AUTHORS Uechi,N., Yukawa,J. and Yamaguchi,D. TITLE Direct Submission JOURNAL Submitted (24-JUL-2003) to the DDBJ/EMBL/GenBank databases. Contact:Nami Uechi Kyushu University, Entomological Laboratory, Graduate School of Bioresource and Bioenvironmental Sciences; Hakozaki, Fukuoka, Fukuoka 812-8581, Japan REFERENCE 2 AUTHORS Uechi,N., Yukawa,J. and Yamaguchi,D. TITLE Host Alternation by Gall Midges of the Genus Asphondylia (Diptera: Cecidomyiidae) JOURNAL (in) Evenhuis,N.L., Kaneshiro,K.Y. (Eds.); D. Elmo Hardy Memorial Volume. Contributions to the Systematicsand Evolution of Diptera. Bishop Museum Bulletin in Entomology Number 12: 53-66; Bishop Museum Press, Honolulu, Hawaii (2004) COMMENT FEATURES Location/Qualifiers source 1..439 /db_xref="taxon:240000" /geo_loc_name="Japan: Fukuoka, Hisayama, Ino" /host="Ampelopsis brevipedunculata var. heterophylla (Vitaceae)" /isolate="Asp.baca38(Ampelopsis)" /mol_type="genomic DNA" /note="This region corresponded to the bases 1752-2190 of the genome of Drosophila yakuba Burla (Diptera: Drosophilidae)" /organelle="mitochondrion" /organism="Asphondylia baca" CDS <1..>439 /codon_start=2 /gene="COI" /product="cytochrome oxidaze subunit 1" /protein_id="BAD12038.1" /transl_table=5 /translation="RLNNMSFWLLPPSLTILLMSSIIENGTGTGWTIYPPLSSIIAHN SSSTDLSIFSLHIAGISSILGAINFITTIINMKNKFIKLNELSLFIWSILITTVLLLL SLPVLAGAITMLITDRNLNTSFFDPMGGGDPILYQHLFWFFGHP" BASE COUNT 141 a 64 c 45 g 189 t ORIGIN 1 tcgattaaat aatataagat tttgactttt acctccatca ttaactattt tattaataag 61 aagaattatt gaaaatggaa ctggaacagg atgaactatt tatcctcctt tatcttcaat 121 tattgcccat aatagaagat caacagattt atcaattttt tctcttcata ttgctgggat 181 ctcttctatt ttaggtgcta ttaattttat tactactatt attaatataa aaaataaatt 241 tattaaactt aatgaattat cactttttat ttgatcaatt ttaattacta ctgttctttt 301 acttttatca ttaccagttc ttgcaggagc aatcactata ttaattactg accgaaattt 361 aaatacttca ttttttgatc ctataggagg tggtgatcca attctttatc aacatttatt 421 ttgatttttt ggtcatcca //