LOCUS AB086984 2274 bp mRNA linear HUM 07-JAN-2003 DEFINITION Homo sapiens comp mRNA for cartilage oligomeric matrix protein, complete cds. ACCESSION AB086984 VERSION AB086984.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 2274) AUTHORS Hashimoto,Y. and Mori,H. TITLE Direct Submission JOURNAL Submitted (27-JUN-2002) Contact:Hiroshi Mori Osaka City University Medical School, Neuroscience; 1-4-3 Asahimachi, Abenoku, Osaka 545-8585, Japan REFERENCE 2 AUTHORS Hashimoto,Y. and Mori,H. TITLE Human comp cDNA with 5 SNIPs JOURNAL Unpublished COMMENT FEATURES Location/Qualifiers source 1..2274 /cell_type="fibroblast" /db_xref="H-InvDB:HIT000061458" /db_xref="taxon:9606" /mol_type="mRNA" /organism="Homo sapiens" CDS 1..2274 /codon_start=1 /gene="comp" /product="cartilage oligomeric matrix protein" /protein_id="BAC53888.1" /transl_table=1 /translation="MVPDTACVLLLTLAALGASGQGQSPLGSDLGPQMLRELQETNAA LQDVRDWLRQQVREITFLKNTVMECDACGMQQSVRTGLPSVRPLLHCAPGFCFPGVAC IQTESGGRCGPCPAGFTGNGSHCTDVNECNAHPCFPRVRCINTSPGFRCEACPPGYSG PTHQGVGLAFAKANKQVCTDINECETGQHNCVPNSVCINTRGSFQCGPCQPGFVGDQA SGCQRGAQRFCPDGSPSECHEHADCVLERDGSRSCVCRVGWAGNGILCGRDTDLDGFP DEKLRCPEPQCRKDNCVTVPNSGQEDVDRDGIGDACDPDADGDGVPNEKDNCPLVRNP DQRNTDEDKWGDACDNCRSQKNDDQKDTDQDGRGDACDDDIDGDRIRNQADNCPRVPN SDQKDSDGDGIGDACDNCPQKSNPDQADVDHDFVGDACDSDQDQDGDGHQDSRDNCPT VPNSAQEDSDHDGQGDACDDDDDNDGVPDSRDNCRLVPNPGQEDADRDGVGDVCQDDF DADKVVDKIDVCPENAEVTLTDFRAFQTVVLDPEGDAQIDPNWVVLNQGREIVQTMNS DPGLAVGYTAFNGVDFEGTFHVNTVTDDDYAGFIFGYQDSSSFYVVMWKQMEQTYWQA NPFRAVAEPGIQLKAVKSSTGPGEQLRNALWHTGDTESQVRLLWKDPRNVGWKDKKSY RWFLQHRPQVGYIRVRFYEGPELVADSNVVLDTTMRGGRLGVFCFSQENIIWANLRYR CNDTIPEDYETHQLRQA" variation 150 /note="SNIPs of # 1, 2, 3 are localized at the pentamer formation domain" /replace="g" variation 151 /note="SNIPs of # 1, 2, 3 are localized at the pentamer formation domain" /replace="c" variation 152 /note="SNIPs of # 1, 2, 3 are localized at the pentamer formation domain" /replace="t" variation 326 /note="SNIPs of # 4, 5, 6, 7, 8, 9 are localized at the EGF-like repeats" /replace="c" variation 327 /note="SNIPs of # 4, 5, 6, 7, 8, 9 are localized at the EGF-like repeats" /replace="g" variation 669 /note="SNIPs of # 4, 5, 6, 7, 8, 9 are localized at the EGF-like repeats" /replace="g" variation 670 /note="SNIPs of # 4, 5, 6, 7, 8, 9 are localized at the EGF-like repeats" /replace="c" variation 766 /note="SNIPs of # 4, 5, 6, 7, 8, 9 are localized at the EGF-like repeats" /replace="g" variation 767 /note="SNIPs of # 4, 5, 6, 7, 8, 9 are localized at the EGF-like repeats" /replace="c" variation 854 /note="SNIPs of # 10, 11 are localized in a stuffed sequence between the EGF-like repeats and the TSP type3 repeats" /replace="g" variation 855 /note="SNIPs of # 10, 11 are localized in a stuffed sequence between the EGF-like repeats and the TSP type3 repeats" /replace="c" BASE COUNT 467 a 707 c 749 g 351 t ORIGIN 1 atggtccccg acaccgcctg cgttcttctg ctcaccctgg ctgccctcgg cgcgtccgga 61 cagggccaga gcccgttggg ctcagacctg ggcccgcaga tgcttcggga actgcaggaa 121 accaacgcgg cgctgcagga cgtgcgggac tggctgcggc agcaggtcag ggagatcacg 181 ttcctgaaaa acacggtgat ggagtgtgac gcgtgcggga tgcagcagtc agtacgcacc 241 ggcctaccca gcgtgcggcc cctgctccac tgcgcgcccg gcttctgctt ccccggcgtg 301 gcctgcatcc agacggagag cggcggccgc tgcggcccct gccccgcggg cttcacgggc 361 aacggctcgc actgcaccga cgtcaacgag tgcaacgccc acccctgctt cccccgagtc 421 cgctgtatca acaccagccc ggggttccgc tgcgaggctt gcccgccggg gtacagcggc 481 cccacccacc agggcgtggg gctggctttc gccaaggcca acaagcaggt ttgcacggac 541 atcaacgagt gtgagaccgg gcaacataac tgcgtcccca actccgtgtg catcaacacc 601 cggggctcct tccagtgcgg cccgtgccag cccggcttcg tgggcgacca ggcgtccggc 661 tgccagcgcg gcgcacagcg cttctgcccc gacggctcgc ccagcgagtg ccacgagcat 721 gcagactgcg tcctagagcg cgatggctcg cggtcgtgcg tgtgtcgcgt tggctgggcc 781 ggcaacggga tcctctgtgg tcgcgacact gacctagacg gcttcccgga cgagaagctg 841 cgctgcccgg agccgcagtg ccgtaaggac aactgcgtga ctgtgcccaa ctcagggcag 901 gaggatgtgg accgcgatgg catcggagac gcctgcgatc cggatgccga cggggacggg 961 gtccccaatg aaaaggacaa ctgcccgctg gtgcggaacc cagaccagcg caacacggac 1021 gaggacaagt ggggcgatgc gtgcgacaac tgccggtccc agaagaacga cgaccaaaag 1081 gacacagacc aggacggccg gggcgatgcg tgcgacgacg acatcgacgg cgaccggatc 1141 cgcaaccagg ccgacaactg ccctagggta cccaactcag accagaagga cagtgatggc 1201 gatggtatag gggatgcctg tgacaactgt ccccagaaga gcaacccgga tcaggcggat 1261 gtggaccacg actttgtggg agatgcttgt gacagcgatc aagaccagga tggagacgga 1321 catcaggact ctcgggacaa ctgtcccacg gtgcctaaca gtgcccagga ggactcagac 1381 cacgatggcc agggtgatgc ctgcgacgac gacgacgaca atgacggagt ccctgacagt 1441 cgggacaact gccgcctggt gcctaacccc ggccaggagg acgcggacag ggacggcgtg 1501 ggcgacgtgt gccaggacga ctttgatgca gacaaggtgg tagacaagat cgacgtgtgt 1561 ccggagaacg ctgaagtcac gctcaccgac ttcagggcct tccagacagt cgtgctggac 1621 ccggagggtg acgcgcagat tgaccccaac tgggtggtgc tcaaccaggg aagggagatc 1681 gtgcagacaa tgaacagcga cccaggcctg gctgtgggtt acactgcctt caatggcgtg 1741 gacttcgagg gcacgttcca tgtgaacacg gtcacggatg acgactatgc gggcttcatc 1801 tttggctacc aggacagctc cagcttctac gtggtcatgt ggaagcagat ggagcaaacg 1861 tattggcagg cgaacccctt ccgtgctgtg gccgagcctg gcatccaact caaggctgtg 1921 aagtcttcca caggccccgg ggaacagctg cggaacgctc tgtggcatac aggagacaca 1981 gagtcccagg tgcggctgct gtggaaggac ccgcgaaacg tgggttggaa ggacaagaag 2041 tcctatcgtt ggttcctgca gcaccggccc caagtgggct acatcagggt gcgattctat 2101 gagggccctg agctggtggc cgacagcaac gtggtcttgg acacaaccat gcggggtggc 2161 cgcctggggg tcttctgctt ctcccaggag aacatcatct gggccaacct gcgttaccgc 2221 tgcaatgaca ccatcccaga ggactatgag acccatcagc tgcggcaagc ctag //