LOCUS       EU966367                2028 bp    mRNA    linear   PLN 10-DEC-2008
DEFINITION  Zea mays clone 293906 ubiquinone biosynthesis protein ubiB mRNA,
            complete cds.
ACCESSION   EU966367
VERSION     EU966367.1
KEYWORDS    FLI_CDNA.
SOURCE      Zea mays
  ORGANISM  Zea mays
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; PACMAD
            clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae;
            Zea.
REFERENCE   1  (bases 1 to 2028)
  AUTHORS   Alexandrov,N.N., Brover,V.V., Freidin,S., Troukhan,M.E.,
            Tatarinova,T.V., Zhang,H., Swaller,T.J., Lu,Y.P., Bouck,J.,
            Flavell,R.B. and Feldmann,K.A.
  TITLE     Insights into corn genes derived from large-scale cDNA sequencing
  JOURNAL   Plant Mol. Biol. 69 (1-2), 179-194 (2009)
   PUBMED   18937034
REFERENCE   2  (bases 1 to 2028)
  AUTHORS   Alexandrov,N.N., Brover,V.V., Freidin,S., Troukhan,M.E.,
            Tatarinova,T.V., Zhang,H., Swaller,T.J., Lu,Y.-P., Bouck,J.,
            Flavell,R.B. and Feldmann,K.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-AUG-2008) Ceres, Inc., 1535 Rancho Conejo Blvd.,
            Thousand Oaks, CA 91320, USA
FEATURES             Location/Qualifiers
     source          1..2028
                     /organism="Zea mays"
                     /mol_type="mRNA"
                     /db_xref="taxon:4577"
                     /clone="293906"
     CDS             124..1779
                     /note="similar to NP_001059219.1"
                     /codon_start=1
                     /product="ubiquinone biosynthesis protein ubiB"
                     /protein_id="ACG38485.1"
                     /translation="MASAAARGAAVRSPLLVHHRVPLVHPSGGGSLRVGWPGIAPGRE
                     GRRRVAPVGARVFARYSQAQDFSTRLQDRAGELPKLVEDLTQTSISTGPRGAFRMAQG
                     IQAVLGVGGEWLNDLSKTANTSASAGIPSQMQLGLLSPLYLRRLFERMGATYIKLGQF
                     VASAPTFFPAEYVEEFQKCFDQAPAVPYDVIESILREELQRPLDSVYEYIDPVPIASA
                     SIAQVHGARLKSSQKDVVIKVLKPGIEDTLVADLNFIYVVARVLEFLNPELQRTSLVG
                     IVKDIKESMLEEVDFRKEAANIQAFQGYIDAMGFDRQAKAPFVYQHCSTKRVLTMERL
                     YGVPLTDLDSIRSLVPDPELTLVTALNVWFGSLISCESFHADVHAGNLWLLRDGRIGF
                     IDFGIVGRISPRTWAAMEVFLASFATEDYDAMASALSEMGATGNDINTNEFAKDLRKI
                     FSSIQDLDTEIIVATARTPDATAVSANVVLDERQMNALFLDLVRVSESYGLKFPREFA
                     LLMKQLLYFDRYTRLLAPSMNMLRDERINISTNRQPRRTDRFQ"
BASE COUNT          496 a          473 c          521 g          538 t
ORIGIN      
        1 acttggctcg ctcgctcgca cgcacgcact gacaacctgg gtggccgcca ccgcacaccc
       61 tcttcgcctc tcgctccccg tcgtcggtga gccgcgcccg tccagccgcc caccctctca
      121 ccgatggctt cggcggccgc gaggggcgcc gcggtgcgct cccctctcct cgtccaccac
      181 cgcgtccccc tggtacatcc cagcggggga ggctcgctcc gggtcggctg gcccgggatt
      241 gcgcccggac gggaggggcg gcggcgggtg gccccggttg gggctagggt tttcgcgcgc
      301 tactcccagg cccaggactt ctccacacgc ctccaagata gagctggtga gctgcctaag
      361 ttagtcgagg accttaccca gacatcgatt agcacagggc ctcgaggtgc tttcaggatg
      421 gcccaaggga tccaagctgt gcttggggtc ggcggggagt ggctgaatga cctttcaaag
      481 acagccaata catcagcatc agcaggaatt ccatctcaga tgcagcttgg tttgctttct
      541 ccactttacc ttagaaggct ttttgagcgc atgggtgcca cttatatcaa gttaggccag
      601 tttgtagcat ctgcgccaac tttttttcct gcagaatatg ttgaggaatt ccagaaatgc
      661 tttgaccaag caccagctgt cccatatgac gtgattgaat caatattacg tgaggagctg
      721 cagcggccat tagatagtgt gtatgaatac attgatccgg tgccaatagc ctctgcctca
      781 atagcacagg ttcatggggc taggttgaag agctctcaga aagatgtggt gattaaagtt
      841 ctaaagcctg gtattgaaga tactttggtt gctgatctga attttatcta tgttgttgca
      901 cgtgttttag agttcttgaa ccctgaacta caaaggacat cactggtagg cattgtaaag
      961 gatataaaag aatcaatgct tgaggaagtt gactttagaa aagaggctgc aaatattcag
     1021 gcatttcagg gatacattga tgcaatgggg tttgacaggc aggcaaaagc cccatttgtg
     1081 tatcagcact gtagtacaaa acgtgtattg actatggaaa gattgtatgg agttccgctt
     1141 actgatcttg attctataag atctcttgtt cctgatcctg agttgacttt agtcactgcc
     1201 cttaatgtct ggtttggaag cttaatttca tgtgaatcct tccatgctga tgtacatgct
     1261 gggaatctat ggttgctccg tgatgggcga attggtttta ttgattttgg gattgttggt
     1321 cgaatatctc caagaacttg ggcagctatg gaggtctttt tggcttcttt tgcaactgag
     1381 gattatgatg ctatggcctc tgccctctct gaaatgggtg ctacagggaa tgatataaat
     1441 actaatgaat ttgcaaagga cctgcgaaag atattctcat cgatacagga cctggatact
     1501 gaaatcatag tggcaacagc aaggacccct gatgctacag cagtatctgc taatgttgtc
     1561 cttgatgaga ggcagatgaa tgctctattt cttgatctgg tcagggtgag cgagtcttac
     1621 gggctgaagt ttcctcggga gtttgctctt ctcatgaagc agctgctgta ttttgatcgc
     1681 tacacaagac tgctggctcc cagcatgaac atgctgcgag acgagaggat caacatctcc
     1741 accaatcgac aaccaagaag aactgataga tttcagtgaa gccacgtcgt tagtcaccgg
     1801 ccacgtacta gaggagtcgt gatgggcgat aatagcaagc tcatgtgacc caatactgta
     1861 tatagttttg ccagaccagc atagaaatga accacacgct agaaattgta cactcaatcg
     1921 tattctggga ttgagcgtta tatcgtacta gtaacatgta aaggctgtat cccacggcta
     1981 aagtaaattt cagatgaact gcttttgtct cgaaaaaaaa aaaaaaaa
//