LOCUS       AP014863               59815 bp    DNA     circular BCT 23-MAY-2018
DEFINITION  Pseudomonas furukawaii plasmid pKF707 DNA, complete genome.
ACCESSION   AP014863
VERSION     AP014863.1
DBLINK      BioProject:PRJDB3360
            BioSample:SAMD00023458
KEYWORDS    .
SOURCE      Pseudomonas furukawaii
  ORGANISM  Pseudomonas furukawaii
            Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales;
            Pseudomonadaceae; Pseudomonas; Pseudomonas
            oleovorans/pseudoalcaligenes group.
REFERENCE   1  (bases 1 to 59815)
  AUTHORS   Kimura,N. and Suenaga,H.
  TITLE     Direct Submission
  JOURNAL   Submitted (15-MAY-2015) to the DDBJ/EMBL/GenBank databases.
            Contact:Nobutada Kimura
            National Institute of Advanced Industrial Science and Technology,
            Bioproduction Research Institute; Higashi 1-1-1, Tsukuba, Ibaraki
            305-8566, Japan
REFERENCE   2
  AUTHORS   Kimura,N., Watanabe,T., Suenaga,H., Fujihara,H., Futagami,T.,
            Goto,M., Hanada,S. and Hirose,J.
  TITLE     Pseudomonas furukawaii sp. nov., a polychlorinated
            biphenyl-degrading bacterium isolated from biphenyl-contaminated
            soil in Japan
  JOURNAL   Int. J. Syst. Evol. Microbiol. 68, 1429-1435 (2018)
  REMARK    DOI:10.1099/ijsem.0.002670
COMMENT     Please visit our web page
            URL:http://www.ddbj.nig.ac.jp/
            The genome sequencing of strain KF707 was supported by National
            Institute of Technology and Evaluation in Japan
            Strain KF707 (=NBRC 110670) is available from NBRC culture
            collection (http://www.nbrc.nite.go.jp/e/).
            
            ##Genome-Assembly-Data-START##
            Assembly Method       :: Newbler v. 2.6
            Genome Coverage       :: 124x
            Sequencing Technology :: 454 GS FLX; Hiseq1000; Miseq
            ##Genome-Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..59815
                     /db_xref="taxon:1149133"
                     /mol_type="genomic DNA"
                     /organism="Pseudomonas furukawaii"
                     /plasmid="pKF707"
                     /strain="KF707"
     CDS             complement(550..726)
                     /codon_start=1
                     /locus_tag="KF707C_p10"
                     /product="hypothetical protein"
                     /protein_id="BAU77390.1"
                     /transl_table=11
                     /translation="MLELDEGLIVLASLAAERMGIPLPLFVNQALQEKLLRLMDLEQQ
                     RGAGVRKPEGDSEG"
     CDS             1149..2675
                     /codon_start=1
                     /locus_tag="KF707C_p20"
                     /note="TrbG"
                     /product="IncP-type conjugative transfer protein"
                     /protein_id="BAU77391.1"
                     /transl_table=11
                     /translation="MALQGKSAIQAGSLRSSFLRRPHVPPTPSSVAASAALGALPAMG
                     SVPGKPQQHPTRKRPTMPTQRPPKAAALSLALCLFATQGFAAESQQITFNSSPSTIVC
                     AVLHVCDIELQPGEVITDLQAGDRARWSITPAITNVSGAEIHHLVVRPYDVGLETSVV
                     VSTNRRTYHLLLKSDASRYMPRVTFTYPEEAQRKLESRISKELHARQKGLIPETNQYL
                     GDLDFKYKISGDPALKPLRVYNDHLKTNIELPATATANLPTLLVTEAGRANAKSMNYS
                     RQGNRLVVDGVFDAATLVYGSGPTKGSVTIERMEKAGSGRQGTVTAAPMLPPSATAKA
                     SAPAVSVPAPDAPLVVAAPQVERQGGGVTPGAPAAAGSVTARPTPVVAKPAAPVTPPQ
                     QVSAAPAPAATPPLASKPAAPVATPKVWEARTGSTLRATVAAWAAQEKYDVDWLPADL
                     DYPIEAPLRFEGSFESAVSSIFRLYDKADRSFIVDGRRAQKRLIVQENLQKIIKGASQ
                     "
     CDS             2672..4378
                     /codon_start=1
                     /locus_tag="KF707C_p30"
                     /product="conjugative transfer protein PilN in
                     PFGI-1-like cluster"
                     /protein_id="BAU77392.1"
                     /transl_table=11
                     /translation="MKRHAWAFATLALTAAALTGCEIGRINDSMERVDKNADRASALT
                     DALKNQVPAQRESVMFTDDQWVSTKPMVIKAGLPPALDCSVGYNESMSLQQFAQWASA
                     QCSGVPVKVAPDALDNGASFMRASGQGNGQGNGGASAPPPVQAPAESISDLFPGAGGG
                     VATGTASYGMGRRVALTYEGRLSSLLDTATGSLGLSWKYDTTSKTVKIFYLETRTFHV
                     FSFNQGGGFTSVVKSGMTSSAGTSGSGASGMNGGGGGGVSGDSGSQQTTTTELFSTVV
                     DDIENNVRSMLTLNRMAYSRTTGIMSITDRPDVLDRVQSYLDAENASITKNVLFNLEV
                     IQVTLTDKDQYGIDWDLVYKSVNGKLGFGLKNTFPGIDASAVGGSVSILDTADSPWAG
                     SKLLVQALSEQGRVSAKRSPSVTTLNLRTAPMQIGRVNGYLASSQTTQAPDVGATTAL
                     TPGSITSGFNMSLTPFVMPDNKQLLLNAAINMTDTPVFKTIESGNSSIENPDYGLQIF
                     NQSVKLRSGQTLVLSGFDQTTENATKSGTGTASNFLFGGGGTRDTNRDLLVLMITPVI
                     ME"
     CDS             4383..5696
                     /codon_start=1
                     /locus_tag="KF707C_p40"
                     /product="hypothetical protein"
                     /protein_id="BAU77393.1"
                     /transl_table=11
                     /translation="MEPSSDISILRIQGKEFVSGLMWRPLSKPRGYMKEAREIGKEEG
                     MDIVSIRLGLTMIQAGFVKKESGATKGMYSLAAALAGQIKEESWIGAFQVSEDLFALV
                     AVHGGLIVPGCDTVGTKEEIRNLLVEKDSHRVMKFEKVYHPDDFNHRGQQIDIDELLS
                     PSRIKKEYALKQLTFGMTRKELIITGCLFGALVAGGLGYLQWVQYQERLAREEAARQE
                     LAREQARAELEAQTGGPVQAQALEHPWAKMPGSSDFLNGCMGAINSLPLAMGGWTFDS
                     AICTATTLETVFGRAGGSTFDQFVLATQSRFPAPPVLLEGGDRAGLGEEITLGMGGDD
                     ELLSVDEVRSRFTSHLQRLELKAEISEVQVAAPTDPQALPGQENGAVAPAPDWKQFSF
                     TLTTPHAPEIVFSEFHLNGLRLTEIATTRSGSMLSWTVKGDIYAR"
     CDS             5863..6204
                     /codon_start=1
                     /locus_tag="KF707C_p50"
                     /product="hypothetical protein"
                     /protein_id="BAU77394.1"
                     /transl_table=11
                     /translation="MKAGDDPMAQSNSAPPVVASDLPTVTGVSGVSGRLVATFRYPNG
                     GTASASSGTEIAGGFVVSEVSLNRVVLTKGDRRFPLQSGVVTQQPTQQQPLLPGQFPT
                     LSQPPVAIPAQ"
     CDS             6246..7730
                     /codon_start=1
                     /locus_tag="KF707C_p60"
                     /product="general secretion pathway protein E"
                     /protein_id="BAU77395.1"
                     /transl_table=11
                     /translation="MALTAEGERFGNINPELRQLICLTDDDVLHIVDGYEADPFVLAF
                     QDTVRRAGIKAELASVTPEQLKELYQGITSAINLGFGRSSQESASKRQREVVQILKLA
                     TQSGASDIHFFPTPNGHQLRFRVHGELDTIKSFAGGDGLALLSTIYTSMCESVDPNYR
                     PEVSQDGRLQSEFVKECGLFGARIATRPTLNGPWMAVRLLYDSGEVIPLERMGYLDEQ
                     IDLLTRLIHRTEGMVLLSGTTGSGKSTALQTLLSMLLKFNNFAINLATVEDPVEYRIE
                     GANQTPLLGEWADAITNLMRMDPDVLMLGEIRDLLSAIAAFQAANTGHGAWSTVHTST
                     AAACIQRLHDLGVEDSLLMDPSLVKGLVNQSLTRVLCPDCKLPYLENCGRLTRDLQHR
                     IQKRCIPEHVYLKGAGCARCKGRGVVGRTAIAEIILPDLRFMRTFREKGKAEAQAFWV
                     HSLGGITKNAHLIHRINEGIVDPLLGEKDVCQLDEDVMTIGGRQ"
     CDS             7727..8827
                     /codon_start=1
                     /locus_tag="KF707C_p70"
                     /product="hypothetical protein"
                     /protein_id="BAU77396.1"
                     /transl_table=11
                     /translation="MIHDAFASFEEWLVRLQFGGASRIKFYEAMRNLVENQVSANDAL
                     KELYGVWSKNGKTPRAALAIITQDLLVQLANGTRLSKALSRWAPYEEVSLIAAGEQAG
                     RLVAAFDDVERVITAKMEIRGAIASALAYPTFLCIPLSVLLYIISMQVVPKMARFSDP
                     ETWQGSAYLLHLLAYFVTNFGIAFLCLLAAFVVALIYSLPRLCGGPRILLDRAPFFTT
                     YRMVHGSTFLLNLAVMMRANIPTHDALVLLHQYANPWLQERLNGALYGLRQGVNLGVA
                     LENAGHNFPDQEAIQFIRILASREGFANSINKYSERWLQASIKRIKVMAGLSYNVMLI
                     LIGLVMTLVVVGTQELQSGMDRTANQAVQNVR"
     CDS             8847..9383
                     /codon_start=1
                     /locus_tag="KF707C_p80"
                     /product="putative type IV pilin protein"
                     /protein_id="BAU77397.1"
                     /transl_table=11
                     /translation="MYKLSSIKTQFSRKQRGFGALEVMIGLMIGTLVLIGAVVWYQKL
                     SNSSNNGDELENLSSLITSVRHLKTSSGYGANGTNLVPILNNAGGIPDNMGFNAGVPL
                     NAWGGNVTIVSTGLGFTVTYAGLPAENCIFLATKGASSSTMTTRINGGAAITGEVTAA
                     AANTGCNAATNTLAWTAR"
     CDS             9383..10351
                     /codon_start=1
                     /locus_tag="KF707C_p90"
                     /product="conjugative transfer ATPase PilU in PFGI-1-like
                     cluster"
                     /protein_id="BAU77398.1"
                     /transl_table=11
                     /translation="MSQQKGPLTGSDFVDLYIGEDFADVKGLAGASSSRVAAPSDWAE
                     EVDALRDLCKARHQETGIPEFSVIHLDVVYRVTHLDGIGRGGVFVLRKSNAQLRDPRG
                     IGIPKYAVDALLDPTATGLVLITGGMGVGKTTTGASFVVERLKLFGGMALAIEDPTET
                     NINGVHGEGRCIAISASRYNGGYKEHLVRGLRSGVDFFFIGEIRDEETAFEALKAGTN
                     GKLIFATLHASNITTALERMITLASQYSKTAAETLSESLLAVIWQNLEETPKQGGGTF
                     KRFTSSSLVLSGEDAYASKEKIRRNELGGIDGDVERQAARAIWGRD"
     CDS             10390..11748
                     /codon_start=1
                     /locus_tag="KF707C_p100"
                     /product="PilV protein"
                     /protein_id="BAU77399.1"
                     /transl_table=11
                     /translation="MKYQRGFGALEVMICLIIGALATVAGARVYTSYLDRQVNRSAGE
                     QMGIVADAAAKYIKDNYAAITAVATPAAPAVITTAMLRATGYLPAGFSDTNVYGQDYR
                     ILALEPTANKLQTLIVTVNGDVIREMHLLEISKLMGAKGGYISSTNTAVAFGSFGGWQ
                     TALAPYGVAPGAGHLATALFFDDGAMVTDYLYRSAVPGQPQLNRMNTSIDMGNNDLNN
                     TDAVNANTVNANTANVSGNTSTAGETYTGGWFRGRGDGLIYNEKWNGGWYMADPQWMR
                     SYADKGIYTGGAMLGGTLQSTGRTTVGEYLHVAGVATAGVGCAPNGLEARDSTGLPLY
                     CQSGLWKTVGISGGSISFDGTYLGSMSNYNSTGKPMFVSAYGGYGSGGTCGNRYQMSA
                     SVYSVPLGGWIAVAGSSHTYDVGSKSESIGFMVPAGSTYTISSAPYACGAGVIHVSEF
                     VF"
     CDS             complement(12681..13829)
                     /codon_start=1
                     /locus_tag="KF707C_p110"
                     /product="shufflon-specific DNA recombinase"
                     /protein_id="BAU77400.1"
                     /transl_table=11
                     /translation="MTENPTLFEALVHYQKNVSILHKGYEQECYRIARISRSPMAQKP
                     IRDIQSPDIASYRDQRLADLNPKTGKPISPATVRLEMSLLSSLWEIGRIEWGICGANP
                     IKDVRKPKAPPGRERRLLPREERLILRHALQHPNPELFSLVVLAVETAMRQGELLKLD
                     WEHINLRTRVAHLPETKNGSRRDVPLSLRARDALTRLGAKPCGRVFSYTSAGLKSTWK
                     FMLNKLGIKDLHFHDLRHEACSRLFELGTLDIMEIAAISGHKSLTMLKRYTHLRASRL
                     VRKLEGKKRRGHQEALSHLIPYPAAVLADGAGVEVRVLDFDDVVGRGECETTALEAAQ
                     AALLRRLVLSMRDQQEIPPPDQYLEAVDPRTVVMLDPLLPVQGRCRAA"
     CDS             15349..16284
                     /codon_start=1
                     /locus_tag="KF707C_p120"
                     /note="TrbB"
                     /product="conjugative transfer protein"
                     /protein_id="BAU77401.1"
                     /transl_table=11
                     /translation="MIKALQDPLTIEVMLNPDGQLWVERLGEEMQRIGTLPASAAEAA
                     MGTIAACLQTTVSRENPILEGELPLDGSRFEGLIPPVVAQPTFAIRKKASQVFSLEQY
                     LEAGSISKEQYQRICAAVGARQNILVVGGTSSGKTTLSNAIIKKMDELSPDLRLVIIE
                     DTGEIQCSADNAVIMRATAYVSMLQLLRATLRLRPDRILVGEVRGGEALSLLKMWNTG
                     HPGGLATLHANNARAGLTRLEQLVSEATSAPMQHLISEAVDLVIHIAKTANGRKVTGL
                     LEVQDFRNGEYVTEEICPMTPRSHLNEGSKTHELA"
     CDS             16253..16648
                     /codon_start=1
                     /locus_tag="KF707C_p130"
                     /note="TrbC"
                     /product="IncP-type conjugative transfer protein"
                     /protein_id="BAU77402.1"
                     /transl_table=11
                     /translation="MKDQKPMSLRKARNYKLDMLCLFALMLLVTTLASPDAMASATAG
                     TLPWDSPLAKLRASITGPVAFTISILGLVGTLSALIWGGELSGVLKSVIVIVMIISII
                     VAANNFLSVMFGVGAEIAAYAPAMVAGIV"
     CDS             16739..16948
                     /codon_start=1
                     /locus_tag="KF707C_p140"
                     /note="TrbD"
                     /product="IncP-type conjugative transfer protein"
                     /protein_id="BAU77403.1"
                     /transl_table=11
                     /translation="MICCVLVFSAFELKAAVVGGIFWVASLYGLRLMAKKDPQMRFVY
                     LRSLKYEAYYPAQSTPFYENAREYK"
     CDS             16945..19413
                     /codon_start=1
                     /locus_tag="KF707C_p150"
                     /note="TrbE"
                     /product="conjugative transfer protein"
                     /protein_id="BAU77404.1"
                     /transl_table=11
                     /translation="MSLLLPRPSSIKPFRSRKPGFSDLLQYAAMPEDGVVTLKYGAYL
                     VSWIYQGEDNASATDTQREIVSAVINRELLKLGSGWMLHTDAIRRPAPKYADEGASAF
                     PDPVTKAIDQERRQTFERLGAMYEGAFIMSVTYQPPLALETKFIDMMFDDDAEIPDEK
                     ARYAKQTADFMSKIKSLEDNLSTVLKMERLRGHRVLQEDGSEVIEDDLLAYLNYCITG
                     NQHPIVLPSCAMYLDSLLGGQEFWAGVVPKIGRRFIQTVAISGLPTQSVPGILTELGE
                     LPCEYRWSTRFIFMDQHEAQSQFDKFRRKWKQKVRGFMDQLLNKQNGAVDEDALSMVA
                     DATGAKAEINSRTVAYGFYTSVVVLMSEDRAEVEESAARIAKMINGRGFAARVETLNT
                     VEAWLGSLPGHGVENIRRPLISTLNLADLMPTSSIWTGSNIAPCPFYRPNSPALMQCA
                     TSGNTPFWLNLHVRDLGHTLIFGPPGSGKSVLLALIQAQFRRYENASIYAFDKGMSAY
                     ALCKGAGGAHYAVAGDNSPSFAPLADLSSPTDLAWAAEWVDDCLKLQGLVTTPNQRNE
                     IARALTNMRDTESRTVTDLVSTLQDVQMRAALHVYTLDGPMGHLLDAERDSLSVNSFN
                     VFEIEELMSLGDRYVLPVLSYLFRRIEKSLKGQPAMIVLDEAWLMLAHPAFKEKIVEW
                     LKVLRKANCIVVMATQSLSDAVKSGILDVLKEAAPTKIYLANGEARDEETAAIYRKLG
                     LNARQIEIVARATPKRHYYYVSEQGRRVFDLALGPLSLAFVGVSDKEAVAKVKALEAT
                     YGADWTHHWLADRGLRLSDYVRAA"
     CDS             19416..20147
                     /codon_start=1
                     /locus_tag="KF707C_p160"
                     /note="TrbF"
                     /product="IncP-type conjugative transfer protein"
                     /protein_id="BAU77405.1"
                     /transl_table=11
                     /translation="MRLFSKKTDTAAADAAVENPYIAARREWNERYGSYITQRNIGFA
                     VGLAGFVVAAIAVGGAVHIGSQSKFIPVYVLVDKLNNALTAGRGDYAQATPQDVVKAQ
                     LARWIEDVRTVTPDKVIKLKQVKGSYALIQDGDPAKTKLDTWFSGQGKNKNNIVEAKE
                     DPFARAASEAVEVQTQGLPLPISPESWQYDWTEIVRDRKGNETDRFNMRVIFTTKQIP
                     PESEEAILVNPSSTFITDFSWSRQF"
     CDS             20157..21110
                     /codon_start=1
                     /locus_tag="KF707C_p170"
                     /note="TrbG"
                     /product="conjugative transfer protein"
                     /protein_id="BAU77406.1"
                     /transl_table=11
                     /translation="MKAIATGLLAALPLICWGQEDYSDLFPTGTSTPEPVISNMYYSP
                     NPALSPQEQAGLGISSKWRSSSSTALKPLERQGGVVTFVFGASQPSVVCAVMQVCDIE
                     LQKGETPNSVNAGDTARWEVTPTISGNGSAATWHIIVKAMDVGLETSLLITTNRRTYH
                     ITLKSHRDQYMARVAFTYPDDSGEEWAAYRKHVESVTQPRAELAAQPRTGSVEYLGDL
                     DFDYRVDGEVRWKPVRVFNDGRKTIIQMPPSMPLEEVPALVVLRGTDSIWPWGKKSEE
                     VMVNYRFQGERYVVDTVFQKAMLITGVGDNQDRVTIERTAE"
     CDS             21107..21523
                     /codon_start=1
                     /locus_tag="KF707C_p180"
                     /note="TrbH"
                     /product="IncP-type conjugative transfer protein"
                     /protein_id="BAU77407.1"
                     /transl_table=11
                     /translation="MKRLIVAMALSALVGCASQQQFGAYAELPPGYREVMARDAVNQM
                     AGLYPPASTRLSMALEPSDSFGQILVERLRLAGYAVQESPATPLIDAKALGYVMDTLD
                     ESTYRVTITVGGESLSRAYFLADHKLSPSGLWARKE"
     CDS             21529..22911
                     /codon_start=1
                     /locus_tag="KF707C_p190"
                     /note="TrbI"
                     /product="conjugative transfer protein"
                     /protein_id="BAU77408.1"
                     /transl_table=11
                     /translation="MSLLSADKSPNGLVTGVRKANRLPLFILATAIGVIALVLAMVAM
                     NRAERAAQIETGADSTGEQKPATPVTSSTAADLAKRYGATGVIEPIAEEEEELVEDTG
                     ELTPPAEKPAAPQKKKEAPVPVASDTNPQGRPLEYQQQLENFNTTKGRLFEAALTSKS
                     RIEIPTANTMPTTAEGGPLSANEQLEQLRLRAANGGGPASYADRAAEVARIQQMRASG
                     GAEAPSDMGGMGGMGDADSERGGSGFNPTSTEDTWLLQDRLQAPLTPYVVRTGFVIPG
                     IMVGGINSDLPGQIKAQVAQNVYDTATGKFCLIPQGSILVGVYDSNIVFGQERVPVAW
                     QRIIYPDGRALNISGMPGADSAGYSGLHDLTDHHLARIFGAAFAMSVISAGFTLSQDD
                     SSGGTDDRPDASSAMSEALGQNLGQTATQMIQKNLAIQPTNIIRPGMRFNVMVSKDIV
                     FDAPYVAFQY"
     CDS             23017..23703
                     /codon_start=1
                     /locus_tag="KF707C_p200"
                     /note="TrbJ"
                     /product="IncP-type conjugative transfer protein"
                     /protein_id="BAU77409.1"
                     /transl_table=11
                     /translation="MYDAGNDIQNTITAIESVTQTAQQLDSLRTQMRQYEDQQLNSET
                     VREFKWDRANETLGSLLTMVDGVSPMLKGSGLEGYLEKFQTIGSHAQTSIACRNDPDC
                     LAGQIATTQQAQADRSEQQMYANQAAMRNVVEQQRLIREDAANLRRLQSIAQDSQGRM
                     AAIQAGNQLLSAQANNLLQLRAILVTQQQMQAAQAQAQSENDAALRERNRQMMRIETK
                     NRGTGNSAKF"
     CDS             23714..23851
                     /codon_start=1
                     /locus_tag="KF707C_p210"
                     /product="hypothetical protein"
                     /protein_id="BAU77410.1"
                     /transl_table=11
                     /translation="MKRYWILAMAVLVLGGVTGCKDDQDSAPQPPAPVKERKTDDAAK
                     F"
     CDS             23898..25460
                     /codon_start=1
                     /locus_tag="KF707C_p220"
                     /note="TrbL"
                     /product="IncP-type conjugative transfer protein"
                     /protein_id="BAU77411.1"
                     /transl_table=11
                     /translation="MNHTLRRCSLIYALLGVVLLAMPEAVFAAVPQENILDGIIARFK
                     DSSATWESRISGYATNLFWALNAISLAWGLGQQALRSADIPDVFSEVFRHIMFTGFHY
                     WLLINGSSFSTYIINSLRQAAGAATGASSALGPSDVIDIGLNIAAKALDNFSALSPID
                     SLGFIFCCIVILICLALIAANMMIMLCAGWVLSYAGILFLGFGGSRWTSDMAINYYRT
                     ILSIGASLFTMTLLIGIGQSFMNDMANSMSADAPLMEMFVCLICAVVLLLLVDKLPQM
                     VAGIVTGSMGGGFQGFGAGTGIAAAGLAVGAIGGMAAAAGAAATSAAGGVSAVKEAAA
                     LADMQMAQADGGLDTSSFDGGGSAGGSGQGGEGGGGGAASSGGQAGSSPSRASAGWIS
                     SFGSNLAKASSAQAMESLGGRVDAAIKNTFGGKVAERLAEQRAELAGGDDQVSEKSSG
                     EEAGGDFGNSIGGSPAGDAAPTSAGGGGMIPEAFEESAFGESDTHGERNKSPDVSDLP
                     PEMQSFVQGKNA"
     CDS             26050..26355
                     /codon_start=1
                     /locus_tag="KF707C_p230"
                     /product="hypothetical protein"
                     /protein_id="BAU77412.1"
                     /transl_table=11
                     /translation="MTEKDNDLYRGVDRTDPPSHPQLKTGWIRPEPPSGYRNLVAFGA
                     YATIEGVRKWVWELDYLDTDTGVFASEDHQFQVEWPWVDDFLPQAADWDSIGIPHLM"
     CDS             complement(26384..26602)
                     /codon_start=1
                     /locus_tag="KF707C_p240"
                     /product="hypothetical protein"
                     /protein_id="BAU77413.1"
                     /transl_table=11
                     /translation="MTPHPRVPLQAALQEFLVAELGDGGGRWPGTVLEALQEALAGVL
                     QELAGFGQGKAGVRQEGGASYMVGNASS"
     CDS             complement(27210..30452)
                     /codon_start=1
                     /EC_number="2.7.7.-"
                     /locus_tag="KF707C_p250"
                     /product="DNA primase"
                     /protein_id="BAU77414.1"
                     /transl_table=11
                     /translation="MSERQQRKPFHEVVADNLIEQLSKGTAPWQRPWAPGTPGTQLPH
                     NPVTGKRYNGINILQLMSQGHSDPRWMTYNQAAAQGWQVRKGSKGTSVQYWKFTDEVE
                     KTDEKGRPVLDDKGQPEKETVMLDRPRVFWATVFNAEQIDGIPERVVLEPTWNKHERA
                     EAIIQASGAQVVHDQSDNAFYRVSTDKIHMPSKAQFPSADNYYATKFHELGHWTGHPS
                     RLDRPVGQNPFGSEEYAKEELRAEIASMILGDELGLGHDPGQHVAYVKSWIKVLQDDP
                     MEIFRAAADAERIQKFVLGFEQQQTQNQGQGQAESVAALVAEKSPLQQLTDLRARGVG
                     LSEALEQSSIMSGPDSRLTEALQEVRGAAAFAGSVPGSAIELLREMSGEALGSSVLLP
                     HDWNGVIQLKALVQDASGNIAWASDSPLEPQLFGVYVQHSDGTHQSLADFNRPADAVK
                     FADRLLLIDAHAQTNVEDRDKRLAGLELARVDARLELAQSMALPGSNPVESWGNLQQH
                     AASNGLKASIELGEGKALARNELPGTFLIRYTDQNDQHTGITTQLNEDGKAKTFVHGK
                     GLHGKGYTAEPEWQQQALDEAIQMQKAERQRREAAMDPKEPATEKTYLSVPFKEKNEA
                     KALGAKWDGKATSWYVPEGQDLALFSKWRQPPQQDKGSELEPGQPEQPVTSAPEKAAR
                     QYLAVPYGEREAAKALGARWDKTAGSWYAGEGADPEKLKRWSPEAVAEQQKMSPQEEF
                     QQACRDAGLKMDGLPKMDGQRYRVALVNDKPGEKSGVYIGHLDGHPAGFIQNHKTGIK
                     QNWKSKGYSLTDEERAKHNAEAAEKLQARERERQAKYEEKAATVSRNLRSLVPPTALT
                     EYQQAKGIAIHQGILTDREGKRTYVPAQDIDGKVWTMQYIREDGSKRFPKDSRKEGCF
                     HVVGGMDALAKAPVIAVGEGYATMSTASESLGFATVAAFDSGNLKNVAAALQQKFPGK
                     PVLFVGDDDHASSLKPNSQGINAGRMKAEAAAKELGGHAVFPTFAPGELEKGLSDFND
                     MATKSVLGREGAERQLKGAVSHVLGQAREAARQLAQQRQQEKQQTAGMTR"
     CDS             complement(30445..30624)
                     /codon_start=1
                     /locus_tag="KF707C_p260"
                     /product="hypothetical protein"
                     /protein_id="BAU77415.1"
                     /transl_table=11
                     /translation="MNATTHEVAVEKLRDAEVPGFEVEMDPDEADLVGAFQEDALSEQ
                     EAKDSTVDLLEVGHE"
     CDS             complement(30621..32684)
                     /codon_start=1
                     /EC_number="5.99.1.2"
                     /locus_tag="KF707C_p270"
                     /product="DNA topoisomerase I"
                     /protein_id="BAU77416.1"
                     /transl_table=11
                     /translation="MASNLMIIESPGKAKKLREILAKVRPGEDWKIEASVGHIRDLPA
                     SGDGDDLITTGVRRSYAPVYELTERGAKVARELKKAVSTAHQVYLATDPDREGESISW
                     HLKEALRLSDPIRITFNEITETAVRKAFGEARSIDMQLVGSQEARRVLDRLVGYLVSP
                     ELRRQTGENLTAGRVQSVAVYLVVLREREIRAFKMTVHYGASLSFAAEGKNTWKVEWD
                     TKAGFTTEASPYVLDRALAERVAALTALEVTSFEESESTRNPPAPFTTSTIQQAASNS
                     LGWKTDRTMKVAQQLYEQGLISYHRTDNPNVSEDSMPKLRAAAAVLGLEVVATRRQFK
                     AKDGAQEGHPAITPTYWDKDEAGETDEQKALYKLIRVRALASQLLPAKYAVRSAVLKA
                     NEQLDGRDVHFKATGRTLTDHGWLKLLAGDDTDDERQEEAPNPLPVLAVGQRVAATSG
                     EVLEKKTKAPPRFTEASLVKALEAEGIGRPATYAAIMKNIIDVRGYVGEQKRFLHPLP
                     PGEQIIERLEGRFSFVQVGFTREMEEDLDRIADGKTTYKPVIQKMHAVLESELQAVRG
                     AVPTAQKPASEHLCPQCQKPLRLIRKSANGPFWGCTGYQEGCKASFEDKGGKPVLAKK
                     QAPTPSIEHTCRAEGCGKGLTRRPAKKRGTYWWGCSGYPACKQTYFDKSGKPDYDAAT
                     KEKTA"
     CDS             complement(33204..34880)
                     /codon_start=1
                     /locus_tag="KF707C_p280"
                     /note="TraG"
                     /product="IncP-type DNA transfer coupling protein"
                     /protein_id="BAU77417.1"
                     /transl_table=11
                     /translation="MILVWAAKWYDEFPREFMYSGSLGVLVGCGFVFAIVIYQVFTRH
                     KVKAEEKMHGTARWAEKRDLEDAGFFDNEGVYVGGWVDSSGTLHYLRHEGPEHILCLA
                     PTRSGKGVGLVIPTLLSWRHSAVITDLKGELWALTAGWRQEHAGNKVLRFEPASATAS
                     VKFNPLDYIRVATENEVGDAQNLATLIVDPDGKGLQDHWQKTSQSLLVGCILHIIYKA
                     KREGFVASLPAVDDMLADPSRPVSELWEEMTTYPHWNGEVHPLVAASGRDMLDRPEQE
                     GGSVLSTAKSYLSLYRDPVVRRNVESSDFSIKDLMHHDSPVSLYIVTQPNDKDRLKPL
                     IRVVVNMIIRLLADKMDFENGRPVAHYKHRLLMMLDEFPALGKLDIMQESLAFVAGYG
                     LKCYLIVQDTAQLNAAYGRDESITSNCHVRIAYAPNRMDTAQALSTMTGETTVVKESV
                     TESGKRGGRLDNVSRSYQEVKRNLLTPDECLRLPGPKKDATGGIVEAGDMLIFSAGRP
                     AAYGKQILYFMDPAFSARAKIPAPAKSDRLHSARPVDLPVITEQEPEIIV"
     CDS             complement(35075..36925)
                     /codon_start=1
                     /locus_tag="KF707C_p290"
                     /note="TraI"
                     /product="IncP-type DNA relaxase"
                     /protein_id="BAU77418.1"
                     /transl_table=11
                     /translation="MIAKRVPRRRDGKSSFGSLVKYLQDDQGKLERVGDVSVTNCGSE
                     DPQWAVREIEAVQDLNRRAKSDKTYHLVFSFREGEDISPEVLKEIEGELCKGLGYADH
                     QRISVVHRDTDNLHVHVAINKIHPQTHNMIEPYYDHKRLGELCSRIELTYGLERDNHA
                     PSKSAASSKADDLAAKSELETLAGWIRSEALEGISKVGSWQELHGHLAEHGLQIRKKG
                     AGLVFETEDGISVRASSVDRACSLKTLEGRLGSYEESAQRASSIAKKTYRPRPRRSSV
                     DSSHLYARYQKERDAVTTGKRKGLGQLKSEKDRALQAVLEAGKKKRAATKLLKGLGAG
                     AISRRLLYAQIASSQRDDLKKVHEEFARRRKELHEKKPQLSFRDWVAAAAAKGDQEAL
                     AYLRSKTISGLRGNTVAAKQSTAAGPIAGLQVDGVSQAGTITYKAPGGVIRDDGNRLQ
                     LRKEASDETVLLALELAAKRHGNRLTISGDDFFKAKVAHVAARHSLPVVFDDPTIEKA
                     RKAAESLGFEQGRAAVSYIDERNEKHARGFDIMKHRQFASTDAGPLEFAGLRNVEGQQ
                     LALLKRGQEMLVLPVNAATAARLQRQRVGREIHVSAVGAIQVQGSTRSRE"
     CDS             complement(36963..37166)
                     /codon_start=1
                     /locus_tag="KF707C_p300"
                     /product="hypothetical protein"
                     /protein_id="BAU77419.1"
                     /transl_table=11
                     /translation="MLDQQAVVEMSKVNGDIGRLGGLLKMWLTNDERLALFNQQQLQE
                     SIVEALAKIKVLQDELLQVVKRL"
     CDS             38255..38800
                     /codon_start=1
                     /locus_tag="KF707C_p310"
                     /note="TraL"
                     /product="IncP-type DNA transfer protein"
                     /protein_id="BAU77420.1"
                     /transl_table=11
                     /translation="MNGDEIDPRAFDALIELIASHEGDVVVDNGASSFIPLASYMLQN
                     DVAGLLQSMGRQLVIHTLITGGQAILDTLNGFAAIMSQFPSGPEFVVWLNPFFGPIEI
                     DGKPFQKMKVYLENKDKITGIIQMPELKKETFGQDLRDMLQDRLTFDEALASESLPLM
                     VRQRLKMSQRAFYDAIGVVVG"
     CDS             38910..39233
                     /codon_start=1
                     /locus_tag="KF707C_p320"
                     /product="hypothetical protein"
                     /protein_id="BAU77421.1"
                     /transl_table=11
                     /translation="MLRKLNEGQSEALAEFQRTMELSMTTWSEDAREKAQRIVNGALE
                     ASKRVMAQNAEAAAAEFGKVLERKVGEMEVRLNAAREERSSTLVVVSIASGLALVVAV
                     VGLFI"
     CDS             complement(39222..39815)
                     /codon_start=1
                     /EC_number="6.2.1.3"
                     /locus_tag="KF707C_p330"
                     /product="long-chain-fatty-acid-CoA ligase"
                     /protein_id="BAU77422.1"
                     /transl_table=11
                     /translation="MERPTLDRYSELTAERLQDEQATLLDSTTTAREYSRELEAMLEG
                     KHEQVERIEEGLSDLIERAEQALQRQLSARPGLLSLPGTRANWQQGVGQLEQRISTLH
                     GRLDRVREIGSATNVHGSVLRDMAYRKLQAENPDLVRQWEELRERERKAQTEERAKKR
                     DQERAELTENGRAAGVREGKAKDQTLSRVLVQGFSDK"
     CDS             complement(41093..41407)
                     /codon_start=1
                     /locus_tag="KF707C_p340"
                     /product="hypothetical protein"
                     /protein_id="BAU77423.1"
                     /transl_table=11
                     /translation="MNTAPDLEIGSIPENVVLKGLLARWLRIDDFSDDTVAPLALVEA
                     TRNAVEGNPVSPRVVLQLAGGSLQSVNSNILGLEVRVVDYDRNPEAVANTRGLDPIIP
                     LD"
     CDS             complement(41711..42130)
                     /codon_start=1
                     /locus_tag="KF707C_p350"
                     /note="klcA"
                     /product="antirestriction protein"
                     /protein_id="BAU77424.1"
                     /transl_table=11
                     /translation="MSTQATLSPIECRRVPVRLRMSVLPRHFDRQMLNVERNIMNALR
                     ELCDSYNGGYWEYYELSNGGFYMAPNDQDAFCLSCQGNGYEGELSADAAGIVASLFGL
                     CRAANTFQTDNLINHYHWLRDFALAHAEADAIFAAID"
     CDS             44578..44877
                     /codon_start=1
                     /locus_tag="KF707C_p360"
                     /note="FIG022160"
                     /product="hypothetical toxin"
                     /protein_id="BAU77425.1"
                     /transl_table=11
                     /translation="MNSFISTDAFDNWLASLTDKVGKARILQRLDSAMLGNFGDCEPV
                     GEGVSEMRIHYGPGYRVYFTRQGTVVYLLLLGGDKSSQKRDIKLAKKLLAELGKE"
     CDS             44882..45172
                     /codon_start=1
                     /locus_tag="KF707C_p370"
                     /note="FIG045511, to FIG022160: hypothetical toxin"
                     /product="hypothetical antitoxin"
                     /protein_id="BAU77426.1"
                     /transl_table=11
                     /translation="MTTLTPFDVSKHLDDDEVIGAYLSAALEDPNPDAFLLALHNVAK
                     AKGMSQIAKDAGVGRESLYKALAPGAKPRYDTILKLLHALGLQLVVSPSQAA"
     CDS             45318..45506
                     /codon_start=1
                     /locus_tag="KF707C_p380"
                     /product="hypothetical protein"
                     /protein_id="BAU77427.1"
                     /transl_table=11
                     /translation="MISRNLEELAGFALILLIAIEAIAFFSLLTGEDNGGQSDLWWLF
                     KATSMGAAALWSLALLAN"
     CDS             45532..45747
                     /codon_start=1
                     /locus_tag="KF707C_p390"
                     /product="hypothetical protein"
                     /protein_id="BAU77428.1"
                     /transl_table=11
                     /translation="MPSSLLASPRFALAEPGQLLQDARQGLLQRLQHRSRPPATTIPQ
                     LRHQKLLQGRLQRHAGMGGHSWISCSS"
     CDS             complement(46199..46474)
                     /codon_start=1
                     /locus_tag="KF707C_p400"
                     /product="hypothetical protein"
                     /protein_id="BAU77429.1"
                     /transl_table=11
                     /translation="MSVGKLVKENAMKRDIFSELIEGFDALASEGRRQVAGRLAQYEL
                     IIKAAEMMTEAEKRALQEWESTNITGDGEFATSDWPGWASVLDRARH"
     CDS             complement(46529..47686)
                     /codon_start=1
                     /locus_tag="KF707C_p410"
                     /note="ParB"
                     /product="chromosome (plasmid) partitioning protein"
                     /protein_id="BAU77430.1"
                     /transl_table=11
                     /translation="MGSATENESKGKRSLKSLGSLSNLLKDQPEQPRGTPAMFKVTDI
                     RPDPNQIRNGDDSHAEDEEARQKFITEELGPDVKSRGVKSPISLRSDPENPGKWLINH
                     GENRWRATVWAELEEIPAFIDEDYTDYDNAKENTKRLDVSGRQMARFVARKLAGGETK
                     KQIAEGLGISQSLVNQISNLLKMPPCIEQIYDERRCRDLSTIAELMTAYKSHPGEVET
                     WLLEQPDEILRSAVKAFRRDLEEPPKEEPPVVKITEERGHPGSGVQDPHREDSGGSGG
                     EGSGERDPNTVDFLNGRTDSERDEGGRKEPESSTTDDNSGASERKDPPSVDPDKIKRT
                     IVQVRHDERPARILLDRRPPAPGWGFIKYDDDGNEVEVDLAAVQLVALVEG"
     CDS             complement(47686..48348)
                     /codon_start=1
                     /locus_tag="KF707C_p420"
                     /note="ParA"
                     /product="chromosome (plasmid) partitioning protein"
                     /protein_id="BAU77431.1"
                     /transl_table=11
                     /translation="MIDLDTQGNATDTLEEFSSGLTTSNLFLPLTAAQQALTAIPNGE
                     PVITLIAADPGLADLEDLDLGDAGENFRDALSVLAEQGYDLCLIDTPPSLGKALTIAL
                     YVADFFISPIQLKRYSLSGINKMNTAVGAIRQFNPDLQFLGMVPSMLERRKQRQLDNL
                     AQLNEDFPGYVLPEIGLRDSIDEALELGRPVWEIKKTAARVAAKEMRAFTQCVFEKMG
                     VV"
     CDS             48379..48501
                     /codon_start=1
                     /locus_tag="KF707C_p430"
                     /product="hypothetical protein"
                     /protein_id="BAU77432.1"
                     /transl_table=11
                     /translation="MREVDNTCGLANTTFLLRYTQSFHFVPLMAFKAAFSHCFT"
     CDS             complement(48844..49056)
                     /codon_start=1
                     /locus_tag="KF707C_p440"
                     /product="hypothetical protein"
                     /protein_id="BAU77433.1"
                     /transl_table=11
                     /translation="MFLTLVVILHRPLGWFFSVAFTFYALRWLFQDGPAATFAGLVAV
                     AAMVGLVAVKYILISWGARMVKGGRR"
     CDS             complement(50338..50451)
                     /codon_start=1
                     /locus_tag="KF707C_p450"
                     /product="hypothetical protein"
                     /protein_id="BAU77434.1"
                     /transl_table=11
                     /translation="MEKRLYARREVGVTPELAVGAVLGEGARGQLIEDHQE"
     CDS             complement(53752..54465)
                     /codon_start=1
                     /locus_tag="KF707C_p460"
                     /product="hypothetical protein"
                     /protein_id="BAU77435.1"
                     /transl_table=11
                     /translation="MLKARALLVEADAMASKAGFGSIKVMFECWRYNRSHINILEDGA
                     ITKAEKELDAAGWQHLMHESGMRSLMNAEARDSWDKSITNGEFPALTKENIGATFARL
                     HDARQSMFEDGVISVFRRLSWCYKTNQPFKFGKRIIVDYLFSHGYPNHRQTDELDDLM
                     RVMSILDGKPEPDHRNGTYQLISGSKQQGNTAENDYLHIRWYLKGSGHITFKRLDLVD
                     QLNEILAKRFPRVLSRDKK"
     CDS             complement(54584..54805)
                     /codon_start=1
                     /locus_tag="KF707C_p470"
                     /product="hypothetical protein"
                     /protein_id="BAU77436.1"
                     /transl_table=11
                     /translation="MAVAFVSHAPSPGNFAAWEGEVTDLIAEALDASYSDAQGVVEAQ
                     PLCMQLAWSMGMSVQEAAAKILADATSAA"
     CDS             54854..54973
                     /codon_start=1
                     /locus_tag="KF707C_p480"
                     /product="hypothetical protein"
                     /protein_id="BAU77437.1"
                     /transl_table=11
                     /translation="MMLFLAGLDVHKLNIPTADGAIFKTRVISGRRDDVLHRD"
     CDS             complement(55151..55264)
                     /codon_start=1
                     /locus_tag="KF707C_p490"
                     /product="hypothetical protein"
                     /protein_id="BAU77438.1"
                     /transl_table=11
                     /translation="MEKRLYARREVGVTPELAVGAVLGEGARGQLIEDHQE"
     CDS             complement(56638..57375)
                     /codon_start=1
                     /locus_tag="KF707C_p500"
                     /product="hypothetical protein"
                     /protein_id="BAU77439.1"
                     /transl_table=11
                     /translation="MASRKNPLLNLDSEKLMDLLRVYRADDLRAEQRKLTTAGNQLAK
                     LASGPMSALFSPEELASLQQTVALVRSVSQRVEHAKEIKARREEQQARERAEKEKAMH
                     KALDERLPKGFDQPQQCIELVTLTLALQSYRVVFERRTAEEFGERLKQDIARQTAGGY
                     SVQGVFNLLRHDVLQQLRDEMVYRSWDSAPDFVQEVFAKVEARQAEAARNNGQLIDYL
                     QAQLQIEQSGNVERLPVKPKRNTEGRK"
     CDS             complement(57377..57670)
                     /codon_start=1
                     /locus_tag="KF707C_p510"
                     /product="hypothetical protein"
                     /protein_id="BAU77440.1"
                     /transl_table=11
                     /translation="MREAIYPEALELLIKSGTARDFLVRPARQFPGAQRDGWTLAVRQ
                     GAYWLPVRSKREPIRVWARLDTLERYANELGITAFTVELSGSEPSTNPSSGRS"
     CDS             complement(57675..57827)
                     /codon_start=1
                     /locus_tag="KF707C_p520"
                     /product="hypothetical protein"
                     /protein_id="BAU77441.1"
                     /transl_table=11
                     /translation="MTWKTPLPWLFAATLMFGLSGCVQDAQDPAPASAAKADVANRSA
                     SDAAKF"
     CDS             complement(58009..58257)
                     /codon_start=1
                     /locus_tag="KF707C_p530"
                     /product="hypothetical protein"
                     /protein_id="BAU77442.1"
                     /transl_table=11
                     /translation="MTEYTDEDMAAVGRALMQAIAQHAPPGWHPADCPSEIVADLAGQ
                     LTEAREALGLALPILERFAEKAGGTATEARDKARAVLA"
     CDS             complement(58272..58514)
                     /codon_start=1
                     /locus_tag="KF707C_p540"
                     /product="hypothetical protein"
                     /protein_id="BAU77443.1"
                     /transl_table=11
                     /translation="MSIELNKPQTLANARKKIAQLSDARHQGDLTYQYAVASGWLSAL
                     RLEGLIDSSTFTELSAELNASHREIGATLADGPANH"
BASE COUNT        11771 a        18670 c        17504 g        11870 t
ORIGIN      
        1 atcgtttagt cctcttcttc ctcaagatat tcatttggct gtttgataac ttctttgaac
       61 tcctgggcat ctttaattag ccgcccatat tcccaaagaa gattatccaa ttttctatcg
      121 agttcagctg cccgactact tatcgaatca acagcacacg tcaacttccg acgcttatct
      181 tcgcgatgta ctttatcgcg cgcttccttc tgcttttccg gattaacacc tacatgaata
      241 taaccacgct tacccgtttc atccgaagga cgattcataa acatggtttt gccatctgct
      301 ttgaaatgaa tatgtgcatg aatgcaaccc atattcacaa gaaggtcacg atgatcgcga
      361 gcagctttaa ttgcgtcgac aatttgctga cgcgccgaat caacagaact tccagtagca
      421 ggaacaatga cggattcaac tccattgaaa gccgaagaat agatgctgcg catcaggcgc
      481 cctccttgat gtgtatagct atagtttagc tatacataat cagagaagca actgatttag
      541 cagctaaatc taaccctcac tgtcaccctc cggttttcgc acccctgcgc cgcgctgttg
      601 ctctagatcc atgagcctga gcagcttctc ctgcagtgcc tgattaacaa acaatgggag
      661 cgggatcccc attcgctccg cagccaaact ggccaggacg atcagcccct catccagctc
      721 cagcattccc agttttcgtc cctcaacaat tttgcgcggc attattggcc ccccttcgat
      781 ttaccgaagg attatgccta ttacttggag aggtggcgat ctcccatcat cgactcgcta
      841 gcaagggccc tgatggcttg ctagcattgc ccgccattgc agggtgcgga cttgaatgta
      901 caaccagaac ttttcagaga acgtcaactg gctcctaggc gccagagact ggtccaagac
      961 cgaattacac aagcgcgcat cagtttccct ggcgtttgtc tccgacatca ccgcaggaaa
     1021 aggaaaccca tctgtcgatg tcatggagaa gatttcaggg gccctaggtg tcccattgcc
     1081 actattgctc ttgcctaacg ccgaccttcg atatatcgta gagcttttag aagctctaca
     1141 gaaaggtcat ggcgttgcag ggaaaatcag cgatacaggc aggaagcctc cggagtagct
     1201 ttctccgtcg cccccacgta cctccaactc cctcctcagt agcagcttcc gccgcgctcg
     1261 gcgcgcttcc cgcaatgggc agtgtgccgg gcaaaccgca gcaacacccc acccggaagc
     1321 gtcccacaat gcccactcaa agacccccaa aggcggcggc gctttcgctc gccctttgcc
     1381 tctttgcgac tcaaggattc gcggcagagt cgcagcagat caccttcaac agctcaccct
     1441 ccacgattgt ctgcgccgta ctccatgtgt gcgacatcga actccaacca ggagaagtaa
     1501 ttaccgatct gcaggctggc gaccgagccc gctggagtat cacgccagca attaccaatg
     1561 tttctggtgc ggagatccac catctcgttg ttcgccccta cgatgttggt ctggaaacat
     1621 cggtagttgt cagcaccaac cggcggacat atcacctcct gctcaaatcg gatgcctccc
     1681 ggtatatgcc gcgcgtgacc tttacctatc cggaagaggc tcagcgaaaa cttgagtcca
     1741 ggatctccaa ggaactccat gctcgccaaa aaggcttgat tcctgagact aatcagtacc
     1801 tgggcgactt ggactttaag tacaagatca gcggcgaccc ggctttgaaa cctctcaggg
     1861 tctacaacga ccatctgaaa accaacatcg aacttccagc aaccgccacc gcgaatcttc
     1921 ctacgctcct ggtcaccgag gccggccgcg caaacgccaa atcaatgaac tattcccgtc
     1981 agggcaaccg actggttgtt gatggcgtgt tcgatgcagc caccctcgtc tatggcagcg
     2041 gccccacgaa aggcagcgtc accatcgagc ggatggaaaa ggccggcagt gggcgtcagg
     2101 gcacggtcac agcggcccct atgctgccgc cgagcgcaac cgccaaggcg agcgcgccgg
     2161 cagtgtccgt tcctgcccca gatgctccgc tcgttgtggc ggcgccacag gtcgaacgcc
     2221 agggaggagg ggtcacacca ggtgccccgg cagcagctgg tagcgtaact gcgcgcccca
     2281 ctccagttgt tgccaaacct gcagcgcccg tcacccctcc gcagcaagtc tcggcagcgc
     2341 ctgctccggc cgccactccg cccctggcgt ccaaacctgc agcgcctgtc gctaccccga
     2401 aagtctggga ggcgcgcacc ggctccacgc tgcgcgcaac ggtggccgcc tgggctgcac
     2461 aagagaaata cgacgtcgac tggctcccgg ccgatctgga ctaccccatc gaagcccctc
     2521 tgcgctttga gggcagcttt gagtccgcgg tcagttccat tttccgcctc tacgacaagg
     2581 cagacaggtc tttcatcgtc gatggccgcc gagcgcagaa acgcctgatc gttcaggaaa
     2641 accttcagaa gatcatcaag ggagcctccc aatgaaacgc catgcttggg cattcgcaac
     2701 gctcgccctg accgcagctg ctctaaccgg ctgcgagatc ggtcgcatca acgactcgat
     2761 ggagcgggtc gacaagaacg ctgaccgggc gagcgcgctc accgacgcac tgaaaaacca
     2821 agtcccggcg caacgtgagt cggtgatgtt cactgatgat caatgggtca gcactaaacc
     2881 tatggtgatc aaggccggtc tgccgccggc cttggactgc agcgttggat acaacgaatc
     2941 catgtcactg cagcagttcg ctcaatgggc gagcgcgcag tgcagcggcg tgccagtaaa
     3001 ggttgctcca gacgccctgg acaacggcgc gtcgttcatg cgggcgagcg gtcaggggaa
     3061 cggccagggg aatggcgggg cttccgcccc gccacctgtt caggcgccgg ccgaatcgat
     3121 ttccgatctt ttcccaggcg ctggtggggg agtggcaaca ggcactgcca gctatggcat
     3181 ggggcgacgg gtagcgctga cctatgaggg tcgcctttcc agtctgctgg acaccgcgac
     3241 cgggagcctt gggctctcct ggaagtacga cacaactagc aagacggtca aaatcttcta
     3301 cctggagact cgtaccttcc acgtcttctc cttcaaccag ggaggcggct tcacgtcggt
     3361 ggttaagtcg gggatgacca gcagcgcagg cacttccggc agcggtgcgt ccggcatgaa
     3421 cggcgggggc ggcggcggtg tttccggcga ctcgggaagc cagcaaacaa ccactaccga
     3481 actcttttcg acggtggttg acgacatcga gaacaacgtc cgcagcatgc tgacgctcaa
     3541 ccggatggcg tactcgcgca ccaccggcat catgagcatc actgaccgcc cggatgtcct
     3601 ggaccgcgtg cagtcgtatc tggatgccga gaacgcgagc atcacgaaga atgttctctt
     3661 caacctggag gtcatccagg tgaccctcac ggacaaggac cagtacggca tcgactggga
     3721 tctggtctac aagtccgtca acggaaaact cgggttcggt ctgaagaaca ctttccccgg
     3781 tatcgacgca tctgctgtcg ggggatctgt aagcatcctg gataccgccg actctccctg
     3841 ggcgggctct aagttgctcg tgcaagcgct ctcggagcag gggcgggtat cggccaagcg
     3901 cagtccctcc gttacgacgc tgaaccttcg gactgcgccc atgcagattg gccgtgtgaa
     3961 cggctatctg gcatccagcc aaaccacgca agccccagac gtaggcgcca ccacagctct
     4021 gactcccggc tccatcacct cgggcttcaa tatgtcgctg accccctttg tcatgcccga
     4081 caacaagcag ctgctgctca atgctgccat caacatgacc gacacccccg ttttcaagac
     4141 gattgagagc gggaatagct ccatcgagaa cccggactac ggcctgcaga ttttcaacca
     4201 gagcgtgaag ctgcgcagcg ggcaaaccct tgtcctgagc gggttcgatc agaccacgga
     4261 gaatgccacc aagagcggga cgggtacggc cagcaacttc ctttttggcg gtggcgggac
     4321 tcgcgacacg aatcgcgacc tgctcgttct gatgatcacg cccgtgatca tggagtgatc
     4381 agatggagcc gagtagcgac atcagcatcc tccgcatcca gggcaaggag ttcgtttccg
     4441 gcctgatgtg gcgtccgctt tccaagccgc gtggctacat gaaggaagct cgggaaatcg
     4501 gcaaagaaga ggggatggac atcgtatcca tccgcctcgg cctgacgatg atccaagccg
     4561 gtttcgtgaa gaaggagagc ggcgcgacaa agggcatgta cagcctcgcg gcggcgttgg
     4621 ctgggcagat caaggaagaa tcctggattg gtgcgttcca ggtgtccgag gacctatttg
     4681 ccctggtggc cgtccacggc ggcctaattg ttcctggctg cgacacggtg ggaaccaagg
     4741 aggagatccg caacctcctg gtggagaaag acagccaccg ggtgatgaag tttgaaaagg
     4801 tctatcaccc ggacgatttc aaccatcgcg gccagcaaat cgacattgat gagctgctgt
     4861 cacccagtcg catcaagaag gaatatgcgc tcaaacagct gacgttcggg atgacccgaa
     4921 aggagctgat catcacgggc tgcctgttcg gagcattggt cgcagggggc ctcggttacc
     4981 tgcagtgggt gcagtaccag gagcgattgg cccgcgaaga agcggcccgc caggaactgg
     5041 cccgcgagca agctcgggcc gaactggaag cgcagaccgg gggcccagtg caagcacaag
     5101 ccctggagca tccgtgggcg aagatgcccg gctcgtccga cttcctgaac ggctgcatgg
     5161 gcgcgatcaa ctcgctccct ctcgccatgg gcggatggac cttcgattcc gcaatctgca
     5221 ccgcgaccac gcttgaaacg gtgttcggca gggcaggggg cagcaccttt gatcaatttg
     5281 tcttggccac ccaaagccgg ttcccagctc ctccagtgct gctggagggc ggcgaccgcg
     5341 caggcctggg cgaagagatc acgctaggca tgggcgggga tgacgaactg ctgtcggttg
     5401 atgaggtgcg ctcccgattc acctctcacc tgcagcgact ggagctgaaa gcggagatca
     5461 gcgaagtgca ggtcgctgcg ccgaccgacc cgcaagccct gcctggacaa gagaacgggg
     5521 cagtcgctcc ggctcctgac tggaaacagt tcagtttcac cctgaccacc ccgcacgcgc
     5581 cggagattgt tttctccgag ttccacctga acggcctgcg ccttaccgaa atcgccacca
     5641 cccgctctgg ctccatgctc agctggaccg tcaagggaga catctatgcc cgctaattcc
     5701 cgctttatct gcaccctgcc actcctggtc gccatggcgg ctgtggctga ggaaagtcct
     5761 ttgccgacgg taggcgacct gtctcgcgtt caagccgaaa cgatcatgta tgaggccaaa
     5821 tccaagcgcg ctgccgctaa ggcctccatg caggagaacc aaatgaaagc cggggatgat
     5881 ccgatggctc aaagcaactc ggcaccgccc gtggtggcat cggatctgcc cacggttaca
     5941 ggggtttccg gggtttccgg ccgtctggtg gccacgttcc gctaccccaa cggcggcacc
     6001 gcgtccgcaa gctctggcac cgagattgcg ggcggcttcg tcgtgtctga ggtgagcctg
     6061 aatcgtgtgg tgttgaccaa gggtgatcgg cgtttcccgc tgcagagtgg cgttgttacc
     6121 cagcagccga cccagcagca gccgctactg ccggggcagt tcccaaccct ctcgcaaccg
     6181 ccagttgcca tcccggcaca gtagaggttt ctatgaccag cgcacctgca gcagcagtcc
     6241 cccgcgtggc cctgacagcc gaaggggagc ggttcgggaa catcaacccg gaactgcgcc
     6301 aactgatatg cctgaccgac gacgacgtgt tgcacatcgt tgatggatat gaagctgacc
     6361 ctttcgtcct ggcgttccaa gacacagtac gacgcgcggg catcaaggca gaactggcct
     6421 ccgtgacgcc tgagcagctg aaagagctgt accagggcat caccagtgcc atcaatctcg
     6481 gctttggccg tagcagtcag gaaagtgcgt ctaaacgcca gagggaagtg gtccagatcc
     6541 tgaaactggc cacgcagagc ggcgctagcg acattcactt tttcccgacc cccaatggcc
     6601 accagctccg cttccgggtt catggcgagc tggacaccat caagtcgttc gcgggcggtg
     6661 acggcttggc gcttctgtcg acgatctaca cctccatgtg tgaatcggtc gatccgaact
     6721 atcgccccga ggtgagccag gacggccgcc tgcagagtga gttcgtgaaa gagtgcggat
     6781 tgttcggtgc ccggatcgca acccgtccga cgttgaacgg cccctggatg gcggtccgcc
     6841 tgctgtacga cagcggcgaa gtcatccccc tggagcgcat gggctacctg gacgaacaga
     6901 tcgacctgct gactcgcctc atccatcgga ccgaggggat ggtcctactt tccgggacca
     6961 ccggctccgg caagtcgacg gcactgcaga cgctcctgtc gatgttgctc aagttcaaca
     7021 atttcgccat taacctcgcc acggtggagg atccggtgga gtaccggatt gaaggcgcca
     7081 atcagacccc gctgctgggc gaatgggccg acgcaatcac taacctgatg cgtatggatc
     7141 ccgatgtctt gatgctggga gagatccgtg acctgctctc cgccatcgct gcattccagg
     7201 ctgccaacac cgggcacggg gcatggtcga ctgtccacac cagcacggcg gcggcgtgca
     7261 tccaacgcct ccacgacctg ggcgtagaag acagcctgct gatggacccg tctctggtga
     7321 agggactggt aaatcagtcc cttacccgcg ttctctgccc agattgcaag ctgccgtact
     7381 tggaaaactg cggacgcctc acccgtgacc ttcagcatcg aattcaaaag cggtgcatcc
     7441 ctgagcatgt ctacctgaaa ggggccggct gtgcccgctg caaaggtcgc ggcgtcgtcg
     7501 gtcgcacggc catcgcggag atcattctgc cggatctccg tttcatgcgg acgttccggg
     7561 agaaggggaa ggcagaggca caagccttct gggttcacag cctgggggga ataaccaaga
     7621 acgctcatct gatccatcgc atcaacgaag gcattgtgga cccgctcctg ggcgagaagg
     7681 acgtatgcca actggatgag gacgtgatga ccattggggg ccgccaatga ttcatgacgc
     7741 cttcgccagt tttgaagaat ggctggtccg cctgcagttc ggcggcgcaa gcaggatcaa
     7801 attctatgaa gccatgcgca acctggtcga aaaccaggtt agcgcgaacg atgccctgaa
     7861 agagctgtat ggcgtctgga gcaagaacgg caaaacgccg cgagcagcgc tggccatcat
     7921 cacccaagac ctcctggtgc agttggccaa cggcacaagg ctgagcaaag ccctgtcccg
     7981 ctgggccccc tatgaagaag tttctctgat tgctgcaggc gagcaggccg ggcgactggt
     8041 cgcggcattc gacgacgtgg agcgcgtcat caccgccaag atggagatcc ggggtgctat
     8101 cgcctccgcg ttggcctacc cgacgttcct ctgcatcccg ctctcggtgc tgctgtacat
     8161 catctcgatg caagtcgtgc cgaagatggc gcgtttctct gaccccgaga cgtggcaggg
     8221 gtcagcctac ctgctccatc tcctggcgta cttcgtaacg aacttcggga ttgccttcct
     8281 gtgccttctc gcggcgttcg tcgtagcgct gatctactca ctgccccgac tgtgcggcgg
     8341 tccccggatc ctgctagacc gcgctccgtt ctttacgacc tatcggatgg ttcatggctc
     8401 aacattcctg ctcaacctcg cagtgatgat gcgggcaaac atccccaccc acgatgccct
     8461 ggtcctactg catcagtacg ctaacccgtg gctccaggag cggctgaatg gcgctctgta
     8521 tggtcttcgg cagggtgtca acctgggcgt ggccctggaa aacgcgggtc ataacttccc
     8581 cgaccaggaa gcgattcagt tcatccgcat cctggcttct cgtgaaggct tcgccaattc
     8641 catcaacaag tattcggagc gctggctgca ggccagcatc aagcgaatca aggtaatggc
     8701 cgggctctcc tacaacgtga tgctgatcct catcgggctg gtgatgactc tggtagttgt
     8761 cggcacccaa gaactgcagt ccggcatgga ccgcaccgca aaccaagctg ttcaaaacgt
     8821 tcgctaaacc acagaaggga aacaccatgt acaaactgtc ctccatcaaa actcagttct
     8881 cccgtaaaca gcgcggcttc ggcgccctgg aggtgatgat tggcctcatg atcggtacgc
     8941 tcgttctgat cggcgccgtg gtctggtatc agaagctgag caacagttcc aacaatgggg
     9001 atgaactgga aaacctgtcc tcgctgatca ccagcgtccg ccatctgaag accagcagcg
     9061 ggtatggcgc caacggcact aacctcgtac cgatcctgaa caacgctggc gggatcccgg
     9121 acaacatggg tttcaacgct ggcgtcccgc ttaacgcctg gggcggtaac gtaaccatcg
     9181 tctccaccgg cctcggcttc acggttacct acgcgggtct gccggccgag aactgcattt
     9241 tcctggctac caaaggggcg agcagctcca ccatgaccac ccgcatcaac ggcggcgcgg
     9301 ccatcactgg tgaagtgact gcagctgcgg ccaacaccgg ctgcaacgct gcgaccaaca
     9361 ccctggcttg gaccgcccgc taatgagcca gcagaaaggc ccactgaccg gcagtgattt
     9421 cgtggacctg tacatcggcg aagatttcgc cgatgtcaaa ggccttgcgg gggcgtcaag
     9481 ctcccgcgtg gccgctccca gtgactgggc cgaagaagtc gatgccctgc gggatctctg
     9541 caaggcacgg caccaggaaa ccggcattcc cgagttctcg gtaattcatc tggatgtggt
     9601 ttaccgggtc acgcacctgg atggaattgg aaggggaggg gtctttgtcc tccgaaagtc
     9661 gaatgcacag ctgcgggatc cccgagggat tgggatcccg aagtatgcgg tcgatgcgct
     9721 cctggatccg accgcgaccg gcctcgtgct gatcactggc gggatggggg tcggcaagac
     9781 caccaccggg gcttccttcg tggtggagcg tctgaagctc tttgggggta tggcactggc
     9841 cattgaggat cccactgaaa ccaacatcaa cggggtccac ggtgaaggcc gctgcatcgc
     9901 catcagcgcc tcgcgataca acggtggcta caaagagcat ctggtgcggg gcctgcggtc
     9961 cggggtcgat ttcttcttta tcggggagat ccgcgacgaa gaaacggcct ttgaagcact
    10021 gaaggccgga accaacggaa aacttatctt cgcaacgctg cacgccagca atatcacaac
    10081 ggccctggaa cggatgatca cgctggcctc ccagtacagc aagaccgctg ccgagactct
    10141 ttccgaaagc ctcctcgctg tcatctggca gaacctggag gaaaccccga aacaaggtgg
    10201 cggcaccttc aagcgcttca cgtccagctc cctcgtcttg tcgggcgagg acgcttatgc
    10261 gagcaaggag aagatccggc ggaacgagct gggcggcata gacggcgatg tagaacggca
    10321 agcggctcgc gctatctggg gccgggacta gcagggattt agcggctaaa tccaggagga
    10381 gactgacaga tgaagtacca acgaggtttt ggggcattgg aggtaatgat ctgcctgatc
    10441 atcggcgccc tggccaccgt cgcaggggcc agggtctaca ccagttacct ggatcgtcag
    10501 gtaaaccgga gcgctggcga gcaaatgggg atcgtggccg acgccgctgc caagtacatc
    10561 aaggacaact atgcagcgat caccgcagtc gccaccccag ccgccccggc cgtgatcaca
    10621 acggcgatgc tgcgcgcgac gggctacctt cccgccggat tcagcgatac caacgtctac
    10681 ggccaggatt accggatcct tgcgctggag ccgaccgcga acaagctcca aaccctcatc
    10741 gttaccgtga acggagatgt catcagggaa atgcacctgc tggaaatctc caaactgatg
    10801 ggtgccaagg gcggctatat ctcctcgact aacacggcag tggcgttcgg tagtttcggc
    10861 ggttggcaga ccgctctggc tccctacggc gttgctccag gtgcaggcca cctcgcgaca
    10921 gctttgttct tcgacgatgg cgccatggtc actgactacc tgtaccggag cgctgttcct
    10981 gggcagcccc agctgaaccg catgaacacc agcatcgaca tggggaacaa cgacctcaac
    11041 aacaccgatg ctgtgaacgc caataccgtg aatgccaata ccgcgaacgt gagtggcaac
    11101 acctcgaccg ctggggaaac ctacaccgga ggatggtttc gtggacgcgg cgacggcctg
    11161 atctacaacg agaaatggaa tgggggttgg tacatggccg acccgcagtg gatgcgctct
    11221 tacgccgaca aaggcatcta cacgggcggc gcaatgcttg gcggcaccct ccaatccacc
    11281 ggccgaacca ccgtaggtga gtatctgcat gtcgcagggg ttgcgaccgc aggagtgggc
    11341 tgcgctccga acggactgga agctcgcgac tccacgggct tgccactata ttgccaatcc
    11401 ggtctttgga agaccgtggg catttcaggc ggaagcataa gtttcgatgg gacttacttg
    11461 gggtcaatgt cgaactacaa ctcgacaggg aagcccatgt ttgtgagcgc ctacgggggg
    11521 tatggctctg gcggcacttg cggcaacaga tatcagatga gtgcttccgt ctattcggtg
    11581 cctctcggtg gctggatagc cgtcgccggc tcttctcata cctatgatgt gggcagcaaa
    11641 tctgagtcca tcgggttcat ggtgcctgcc ggcagtacat acaccatttc ctccgcgcct
    11701 tacgcctgcg gtgctggcgt gatccatgta agtgagttcg ttttctagat ggacacgcat
    11761 aaaaaggccc ctataaaggg gcttttttat gcgctgtaga cggagcagat ccattcctca
    11821 agttccaatg cagatagctc gcagggactg tccgcgaccg aacgtactac ccaccgtggt
    11881 gccgtaccaa tagccatctg cagcgatata gattctgccg ttgtactcgt ccacgttgtt
    11941 gagcgaaccg gtggctaaac ctgatgagta gcagaagccg actgaagagt gtaccaacag
    12001 gacagtcgtg ctgtacggga tgaaccactc cccgagatac ctgaagccgc ctcctgcctt
    12061 tgtccacata ccggattggc aatgcagagc gttccagggc catgcccacc tccttcctgg
    12121 cgtccccccg ctttgccctg gccgagcccg gccaactcct gcaggacgcc cgccagggcc
    12181 gcctgcagcg gaacgcgggg atgggggtca ctcctggatc tcctgcagca gctgaccgcg
    12241 tgaccggccc cgtcggcgcc gacggccagg gtcactcctg gacggccagc tgcagatccg
    12301 cgcgtaaccc ctgcagcggt cacgccggca gctccgcgga cacggcccgg ggtgacctgt
    12361 cgggatagcg ttccgccctc ggggttgcgt tccgcctgcg gcggtttggc ggcagcgccg
    12421 ccactgccgg cacgccggcc cggttgaacg ccaggggagg ggagtggggt cacaccaggt
    12481 gcgccgccgg cgccgatcgc tgtgaccgac acccgccggg gccagcgcct gcagccgatc
    12541 caccggcacg gtcacaccag gtgcgcgagc tcgacatggc catgtgaccg ccagcggccc
    12601 ggccgccagg gtcactcctg gacgacatcg aggacgcgga tccgtgaccg accggctaac
    12661 acttcagcgg aaaaaaagta tcaagctgcc cgacaccgcc cctggaccgg cagcaatggg
    12721 tcaagcatga ccactgttcg cggatccacc gcttcaaggt actgatcagg tggggggatt
    12781 tcctgctggt ccctcatcga gagcactagc cgtctgagca gggcagcctg tgccgcctcc
    12841 aacgctgtcg tttcacactc cccgcgtccg acaacatcgt caaagtccaa aacccggacc
    12901 tccacgcccg ctccgtcggc aagaacggcc gcagggtagg ggattaggtg actcagcgcc
    12961 tcttgatggc cgcgccgctt cttgccttcc agcttgcgca ccagtcgtga agcccgcagg
    13021 tgtgtgtatc gcttcagcat cgtcagcgac ttgtgaccgg agatggccgc aatctccatg
    13081 atgtccaagg ttcccaactc aaagagccgg ctgcaggcct cgtgccgcag atcgtggaaa
    13141 tgcaggtctt tgatgccgag cttgttgagc atgaacttcc aggtcgattt gaggcccgca
    13201 ctggtgtaac tgaagactct accgcagggc ttggccccaa gtctggtgag ggcatcgcgc
    13261 gccctgagac ttagcggaac atcgcgacgg gatccgttct tggtttccgg taggtgtgcc
    13321 acgcgagtcc gaagattgat gtgctcccag tccaatttga gcagttcccc ttgtcgcata
    13381 gcggtttcaa ctgccagcac aaccagggaa aagagttcag ggttcgggtg ctggagagca
    13441 tgtcggagta tcagtctctc ttcgcggggc agcaggcgcc gctcccgccc cggcggggct
    13501 ttgggtttgc ggacatcctt gatcgggtta gccccacaga tcccccattc gatccgccct
    13561 atctcccaga gactggatag aagggacatt tccaggcgaa cggtcgccgg ggagatgggc
    13621 ttgccagtct tcgggtttag gtcggccagt cgctggtcgc ggtaactggc gatgtccggg
    13681 ctttgaatgt cccggatggg tttctgggcc atcggggacc ggctgattcg cgcaatccga
    13741 tagcactcct gctcatagcc tttgtggagg atggatacgt tcttttggta gtgcacaagc
    13801 gcttcaaaaa gtgtggggtt ttcggtcatg ggccttatcc aaatccgccc tccgaaccag
    13861 atcaattgca atgactgccc ccccgccgag aatgacactc agcgtcggca gaacctgcgt
    13921 tcaggcggag aaagaggggc ggtgagaact cgctgctata cgcgcaattt tctcatgctg
    13981 gcctttgatc ggatcaccag gaaaaacaac ttcggtatat cgaaggtttt tcactagaat
    14041 acgcccacga ctctcaatgg acgggacttg tcatgcctgc actttggttc ctgctggcca
    14101 tactggcatt caccagcatc atgtttggat acgaccagaa ttcacagaac gacactctta
    14161 acgatgggga gttggcggca gtcgccggca acatgctcgt ttatcgaaat tctgtatcgg
    14221 catacgccag cgcgaatcct gccgtgacag gcgccatcag tgacgcaact ctcggcctcc
    14281 ccaactggta tcggcgccac cagtcaatcg gaaatttcat cagtggcggg cggagctatg
    14341 tgttctacat ggcgaacgat ctgccagggc tggaaggcct cctgtatgag cggacgcaat
    14401 ccttagccac tggaatcaac agcggtggcg tgttgctcag cccgagtcgg ggcaataccg
    14461 ggatcactct tccggcccag gttccagatc gtgcagtggt actcgtccaa tgaagcgcct
    14521 tgcacttgct gcactgacag cggccaccct gcacgcgcac gctgaaacgc cgccgccggc
    14581 ctatcagcga gcggcccagt tcggcggtat ccccgccgat ttgctgtacg cgattgccaa
    14641 ggcggaaagc aatttccgga tcaagatcgg cacctatcca tggccctgga cgctgaacgt
    14701 aaacggggcg gcgaaatact tccgcacacg cgaagaggcc tgcggcgcaa tcctgcaggg
    14761 tctggatgaa tttgggccgt acaaagtcga catcggcctg acgcagcaga actggggctg
    14821 ggttgggtcg aaatactacc gccacccctg cgatgccctg gcacccaacg acaacttgca
    14881 cacggcggca gtcgtgatcc gcgagtgcta tgaccgggag cgagactgga tcctggctgc
    14941 cggctgttac caccgtccag caggcggaga gccggcccgg aagtaccggg aaggggtgcg
    15001 gacgaaactg gaccagatca cagcagggcg ctgacaggtg acaccaggtg ggcgtgcagc
    15061 tcccgccccc gtgaccctcc ctggcgtcct gatcggcgct catcgaaaga ctcgatgagc
    15121 gatagcttga cgccattatg ccgccggtcg gtataatggc actttgccgc acatcccccg
    15181 cctcttacct tgccattcgt cggccttcga tatatcgtag gaaactgttc aaatcctact
    15241 tagaaaggcc ccgaattgca ggacgcaact caccccgccc ccgcgcgctt gctcactcaa
    15301 accgagcaac gtcagcacga aaaactcacc cgagaacttg gtccagtagt gatcaaggcc
    15361 ctccaagatc cgctcaccat cgaagtcatg ctgaaccctg acggacagct ctgggtggag
    15421 cgtctgggtg aggagatgca acgcattggc accctgcctg cgtcggccgc tgaagctgca
    15481 atgggcacca tcgcggcctg cctgcagacg acggtttccc gcgagaatcc catcctggaa
    15541 ggtgaactgc cgctggacgg gagccgcttt gaggggctga tccccccagt ggtggcgcaa
    15601 ccgaccttcg ccattcggaa gaaggccagt caggttttca gtcttgagca gtacctggaa
    15661 gcaggctcca tttccaagga gcagtaccag cggatctgcg ccgccgtcgg cgcgcggcaa
    15721 aacatcctgg tcgtcggcgg cacgtcgtca ggcaagacca cactgtccaa cgccatcatc
    15781 aagaagatgg atgaactctc ccccgatctc cgcttggtga tcattgaaga cacgggcgag
    15841 atccaatgtt cagcggacaa cgccgtcatc atgcgtgcga cggcatacgt ctccatgctc
    15901 caactccttc gcgccacatt gcgcctgcgc cctgaccgca tcctggtcgg tgaagtccga
    15961 ggcggcgaag cgctatccct cctgaagatg tggaacaccg gccaccctgg cggccttgcc
    16021 actcttcacg ccaacaacgc tcgcgcaggc ctgacaaggc ttgagcagct tgtatccgag
    16081 gccacctccg caccgatgca acacctgatc agtgaagcgg tggatctcgt gattcacatc
    16141 gccaagacag ccaatggccg caaggtcact ggactgcttg aagtccagga cttcaggaac
    16201 ggcgagtacg taaccgaaga aatctgcccc atgaccccga ggagtcacct caatgaagga
    16261 tcaaaaaccc atgagcttgc gtaaagcacg caactacaaa ctggacatgc tctgcctgtt
    16321 cgccctgatg ctgctggtca ctaccctggc atcgccggat gccatggcat ccgctactgc
    16381 cggcacgctg ccttgggaca gcccgctggc caagctgcgc gcgtccatca ctggcccggt
    16441 cgcattcacc atctccatcc tcggcttggt aggcaccctc tcggcactga tctggggcgg
    16501 tgaactcagc ggcgtcctga agtcggtgat cgtcatcgtg atgatcattt ccatcatcgt
    16561 ggcggctaac aacttcctca gcgtgatgtt cggcgtaggc gccgagatcg ccgcctacgc
    16621 accggccatg gttgcaggga tcgtctaaat ggcattgcgc acgatcccca ttcgacaagt
    16681 cggaagccgg ataaacctag tcctcggcgg ggatcgtgag ctggtcctta cctcgctgat
    16741 gatctgctgc gtcctggtct tctcggcttt tgaactcaag gccgccgttg tcggcggaat
    16801 cttctgggtg gccagcctct acggtcttcg cctgatggcg aagaaagatc cgcagatgcg
    16861 gttcgtgtac ctgcgaagcc tcaagtacga ggcctattac ccagctcaat ccacaccgtt
    16921 ctacgagaac gccagggagt acaaatgagc ctgctccttc caaggcccag cagcatcaag
    16981 ccgttccgtt cgcgcaagcc tgggttttcc gatctcctgc agtacgccgc catgcccgaa
    17041 gacggcgtgg tgacgctgaa gtacggcgcc tatctcgtct cctggatcta tcagggtgaa
    17101 gacaacgcga gtgcaacaga cacccaacgc gagatcgtta gcgcggtgat caaccgcgaa
    17161 ctgttgaagc tcggcagtgg ctggatgctc catacagatg caattcgccg gccggcgccc
    17221 aagtacgccg acgaaggcgc gagcgcgttc ccggaccctg tgacgaaggc aatcgaccag
    17281 gagcgtcgtc agacctttga acgcctggga gcgatgtatg agggcgcctt catcatgtcg
    17341 gtgacctacc agccgccgtt ggccctggaa accaagttca tcgacatgat gtttgacgat
    17401 gacgcggaga tcccggacga aaaagcccgc tacgccaagc agaccgccga cttcatgagc
    17461 aagatcaagt cgctggagga caacctatcg acagtcctca agatggagcg gctgcggggc
    17521 caccgcgtgc tgcaggagga tggcagcgaa gtgatcgaag acgatctgct ggcctacctg
    17581 aactactgca tcaccggcaa tcagcatccc atcgtcctgc cttcctgtgc catgtacctg
    17641 gactcgttgc tgggagggca ggaattctgg gcaggcgtcg tccccaagat cggtcgccgc
    17701 ttcattcaga ccgtggcaat ttccgggctc cccactcaat cagtaccggg gatcctgacc
    17761 gaactgggag aactcccgtg cgaatatcgc tggtccacgc gcttcatctt catggaccag
    17821 cacgaagctc agagccagtt cgacaagttc cgccgcaaat ggaagcagaa ggtccggggt
    17881 ttcatggacc aactgctgaa caagcaaaat ggcgcggtgg atgaggacgc cctgagcatg
    17941 gtggccgacg ccaccggggc caaggccgag atcaactccc gcacagtcgc ctatggcttc
    18001 tataccagcg tcgttgtgct gatgagtgaa gaccgggcgg aagtcgagga gagcgcagca
    18061 cgcatcgcca agatgatcaa tggccgtggc tttgcagccc gcgtggaaac actcaacacc
    18121 gttgaggcat ggcttgggag ccttcctggt cacggggtgg agaacatccg ccggccattg
    18181 atcagcacct tgaacctcgc ggacctgatg cccacctcca gcatctggac cggctccaac
    18241 atagctccat gcccgttcta tcggccgaac tctccggccc tcatgcaatg cgccacctcg
    18301 ggcaataccc cgttctggct gaatctgcat gtacgggatc ttggccatac cctgattttc
    18361 ggcccgccgg gctcgggtaa gtcggtactc ctggcactca ttcaggccca gttccgccgc
    18421 tatgagaatg cgagcatcta cgccttcgac aagggcatga gcgcatacgc gctgtgcaaa
    18481 ggggcaggcg gcgcgcatta cgccgtcgcg ggcgacaaca gcccatcctt cgcacccttg
    18541 gccgaccttt ccagtcctac ggatctggcc tgggccgccg aatgggtgga cgactgcctg
    18601 aagttgcagg gcctcgtgac caccccaaac cagcgcaacg agatcgctcg tgcgctgacg
    18661 aatatgcgtg acaccgaatc gcgcaccgtc acggatctgg ttagcactct gcaggacgtt
    18721 caaatgcgtg ccgcgctgca tgtgtacacc cttgacggtc cgatgggtca tctgctcgat
    18781 gccgagcggg actccctttc ggtcaatagc ttcaacgtct ttgagatcga ggagttgatg
    18841 agccttggag accgctacgt cctccccgtg ctctcctacc tgttccgccg cattgagaaa
    18901 tccttgaagg gccaacccgc gatgatcgtc ctggacgaag cgtggctgat gctcgcccat
    18961 ccggccttca aggaaaaaat cgtcgagtgg ctgaaggtac tgcggaaagc taactgcatc
    19021 gtggtcatgg caacccagag cctcagcgat gccgtgaagt ccggcatcct ggacgttctg
    19081 aaggaagccg ccccaaccaa gatctacctc gccaacggcg aagcgcggga cgaagaaacg
    19141 gcggcgatct atcgcaagct gggtctgaac gcccggcaga tcgaaatcgt ggccagggcc
    19201 actcccaagc ggcactacta ctacgtttcc gagcaaggac gccgggtctt cgacctcgcg
    19261 cttggccccc tttccctggc gttcgtcggc gtttccgaca aagaggcggt ggccaaggtc
    19321 aaggccctgg aggccaccta cggcgccgac tggacacatc actggctcgc ggatcgcggc
    19381 cttcgactct ctgactatgt gagggctgcc tgattatgcg cctcttctcc aaaaagacgg
    19441 acactgctgc cgcagacgca gcggtagaaa acccctacat cgccgcccgc cgtgagtgga
    19501 acgagcgtta tggctcgtac atcacccagc gcaacatcgg ctttgctgtc ggcttggccg
    19561 ggttcgtcgt cgcggccatc gccgttggcg gcgccgtcca catcggcagc caatcgaagt
    19621 tcatcccggt gtatgtcctg gtcgacaagc tgaataacgc gctgactgcc ggccggggcg
    19681 actatgccca ggctacgccg caagacgtgg ttaaagcgca gttggcccgt tggattgagg
    19741 acgttcgcac ggtgaccccg gacaaggtga tcaagctgaa gcaggtcaag gggagctacg
    19801 ccctcatcca ggatggggac ccagcgaaaa ccaaactgga tacctggttc tccgggcaag
    19861 gcaagaacaa gaacaacatc gtcgaagcta aagaagaccc cttcgcgcgg gccgccagtg
    19921 aagcggttga ggttcagaca caaggtctgc cgctacccat ctccccggaa agctggcagt
    19981 acgattggac ggaaatcgtt cgggatcgga aaggcaacga gacggaccgc ttcaacatgc
    20041 gggtcatctt cactacgaag cagatccccc cggaaagcga agaagcgatt ttggtgaatc
    20101 cgtccagcac gttcatcact gatttctctt ggtcgcgaca gttctaaggg ggacctatga
    20161 aagcgattgc tactggcctc ctggccgcac tgccgttgat ctgctggggg caagaggatt
    20221 actccgacct gttcccgact ggcacctcta ccccggagcc ggtgatctcc aatatgtact
    20281 acagccccaa tccggcgctg agcccgcaag agcaagccgg cctcggcata tccagcaaat
    20341 ggcggtcgtc cagctcgacc gcgctaaaac cgttggaacg ccagggaggg gtggtcacct
    20401 tcgtgttcgg ggcctcgcag ccgagcgtcg tctgcgcggt gatgcaggtt tgcgacatcg
    20461 agctgcagaa aggcgagacg ccgaacagcg tgaacgcagg cgataccgcc cgctgggaag
    20521 tcactccgac catttccggg aacggcagcg cggcgacgtg gcacatcatc gtcaaggcca
    20581 tggatgttgg cctggagact tcgctgctga tcacgacgaa ccgccggacg taccacatca
    20641 cgctgaaatc gcaccgcgac caatacatgg cgcgggtggc cttcacctac cccgacgact
    20701 ccggcgagga gtgggccgcg tatcgcaagc acgtcgagtc ggtcacccag ccgcgcgcgg
    20761 agctagccgc ccaaccacgg accggctcgg tggagtacct gggcgacctg gactttgact
    20821 atcgcgttga cggtgaggtg cgctggaagc cggtccgagt gttcaacgac ggacgcaaga
    20881 cgatcattca aatgccccca tccatgcccc tggaggaagt cccggcgctg gtggtactgc
    20941 gtggcaccga cagtatctgg ccatggggca agaagtcgga ggaggtgatg gtcaactaca
    21001 gattccaagg agagcgctac gtcgtggata ccgtgtttca gaaggcgatg ctgattactg
    21061 gtgtgggcga caaccaggac cgagtgacca ttgagaggac tgccgaatga aacgcctgat
    21121 cgttgccatg gcgctgtcgg cgctggtggg ctgcgcaagt cagcagcagt tcggcgcata
    21181 cgcggaactg ccgccgggat accgggaggt catggcgcgg gacgctgtga atcagatggc
    21241 gggcctgtat ccgccggcca gcacccgcct gagcatggct cttgagccct cggatagctt
    21301 cgggcaaatc ctggtggaac gcctccggct cgcgggctat gccgtccagg agtcgccggc
    21361 taccccgctg attgacgcga aggcgctcgg gtacgtgatg gacaccctgg acgaaagcac
    21421 ctaccgcgtc accatcacag tcggcggtga gtctttgagc cgcgcgtatt tcctggccga
    21481 ccacaagctg tcccccagcg gcttgtgggc ccgcaaggag tagcgcctat gtctcttctt
    21541 agcgctgaca agtcgcccaa tggattggtc actggcgtcc gaaaagccaa caggcttccg
    21601 ctgttcatac tcgcgactgc gattggagtg atcgcccttg tcctcgcgat ggtggcaatg
    21661 aatcgcgcag agcgggccgc acagatcgaa accggcgcag atagcaccgg ggagcagaag
    21721 ccggccaccc ctgtgacctc ttcgactgct gcggatctcg ccaaacgcta cggcgctacc
    21781 ggcgtgattg agccaattgc agaagaggag gaggagctgg tcgaagacac gggggaactg
    21841 acgcccccgg cggagaaacc ggccgcgcca cagaagaaga aggaagcccc ggtccctgta
    21901 gccagcgata ccaatccgca ggggcgtccg ctggagtatc agcagcagct ggagaacttc
    21961 aacaccacga aaggacgcct ctttgaagcg gccctgactt ccaagagtcg gatcgaaatt
    22021 ccgacggcca acacgatgcc gaccactgcc gagggcggcc cattgagcgc gaatgagcaa
    22081 ctggagcagc tgcgcctgcg ggctgcgaac ggtggcggtc ccgcgagcta tgcagaccgg
    22141 gcggcagagg tagcgcggat ccaacaaatg agggccagcg ggggggcgga ggcaccgagt
    22201 gacatgggcg gcatgggcgg catgggcgac gcagatagtg aacggggcgg gagcggcttc
    22261 aacccgacca gcacagaaga cacttggctc ctgcaggacc gtctgcaggc gccgctgact
    22321 ccgtatgtgg tccgcacggg cttcgtgatt ccgggaatca tggttggggg gatcaacagc
    22381 gatctgccgg ggcagatcaa agcccaggtc gcccagaacg tctacgacac tgcgacaggc
    22441 aagttctgct tgatcccgca aggctcgatc ctggtcggcg tctacgacag caacatcgtc
    22501 tttggccagg agcgagtccc cgtggcatgg cagcggatca tctacccgga tggtcgcgcc
    22561 ctgaacatca gcgggatgcc aggggccgac tcggcaggct actccggcct tcacgatctc
    22621 actgaccacc accttgcgcg catcttcggc gcggcgttcg ccatgtcggt gatttcggcc
    22681 ggattcaccc tgagccaaga cgacagcagc ggcgggacgg acgacagacc agacgccagc
    22741 agcgcaatga gcgaggcgct tggccagaac ctgggccaaa ccgcaactca gatgattcag
    22801 aagaatctgg cgattcagcc aaccaacata atccggcccg gtatgcgctt caacgtgatg
    22861 gtcagcaagg acatcgtttt cgacgcgccc tacgtggcgt tccaatactg agggagtcag
    22921 tagatgaaga tcacacgagg tttagcagct aaatccgtcc ttctatgggc gctctggggt
    22981 gatgtagcac tggccgctgg cggagtcggg atccccgtgt atgacgccgg caacgatatc
    23041 caaaacacca ttactgcgat tgagtccgtg acccaaacgg cgcagcagct ggattcactg
    23101 cgtactcaga tgcggcagta cgaagaccag cagctgaact ccgaaacggt cagggagttc
    23161 aagtgggacc gggcaaacga aacgctgggc agcctgctca caatggttga tggggtgtcg
    23221 cccatgctca aggggtcagg cctggaaggc tacctggaga agttccagac catcggcagt
    23281 cacgctcaga cctccatcgc ctgccgcaat gatccggact gccttgccgg acagatcgcg
    23341 actacacagc aagcccaggc tgatcgctcc gagcaacaga tgtacgcaaa ccaagcggcg
    23401 atgcgcaacg tcgtggagca gcagcgactg atccgagaag acgcggcgaa cttgcgccgg
    23461 ctccagagca tcgcccagga ctcgcaaggc cgcatggccg cgattcaagc gggcaaccag
    23521 ttactcagcg cccaggcgaa caacctcctg caactgagag ccatcctggt cacgcaacag
    23581 cagatgcagg cggcccaagc ccaggcgcaa tccgaaaacg atgccgcact gcgggaacgc
    23641 aaccgccaga tgatgcggat cgaaaccaaa aaccggggaa ccggaaattc agcaaagttc
    23701 tgaggaggac acgatgaagc gttattggat cctggctatg gccgtactgg tactgggggg
    23761 cgtgactggt tgcaaggacg accaggacag cgcgccccag ccgccggccc cagtgaaaga
    23821 gcggaaaacg gacgacgccg cgaagttcta aacgaccggg tggagccatc cggcgccacc
    23881 tccaaggaag cccccctatg aatcacaccc tgcgccgctg ctcgctgatc tacgcactgt
    23941 tgggcgttgt gttactggcc atgcccgaag cggtgtttgc cgcagtgcct caagaaaaca
    24001 tcctggacgg gatcattgct cgcttcaaag actcgtcggc aacgtgggag tccaggatct
    24061 ccggctatgc caccaatctc ttctgggcgc tgaacgcgat cagtcttgcc tggggcctgg
    24121 gtcagcaggc gctgcggtcc gctgatattc cggacgtgtt ttcagaagtc ttccggcaca
    24181 tcatgttcac cggctttcac tactggctgc tgatcaacgg ctccagcttc tccacctaca
    24241 tcatcaactc gctgcggcaa gctgcagggg cggctacagg agcaagttct gcgctcggcc
    24301 catccgatgt catcgacatc ggcctgaaca tcgccgcgaa ggccctggac aacttcagcg
    24361 cgctgagccc gattgacagc ctcgggttca tcttctgctg catcgtgatc ctgatctgtc
    24421 tggccctaat cgccgccaac atgatgatca tgctctgtgc cggttgggtg ctgagctacg
    24481 ccggcatcct gttcctcggc ttcggcggca gtcgctggac cagcgacatg gccatcaatt
    24541 actaccgcac catcctgagc atcggcgcga gcctattcac catgacattg ctgatcggca
    24601 ttggtcagtc gttcatgaac gacatggcca attcgatgtc agccgacgcg ccgctgatgg
    24661 aaatgtttgt ttgcctgatc tgcgctgtcg tgctgctgct cctggtggac aaactccccc
    24721 agatggtcgc gggcatcgtc acgggttcga tgggcggtgg tttccagggc tttggcgccg
    24781 gcaccgggat tgctgctgcc ggcctcgctg ttggcgccat cggcgggatg gctgcagcgg
    24841 caggcgcagc tgccaccagc gcagcgggcg gagtcagcgc ggtgaaagaa gcggctgcac
    24901 tggctgacat gcagatggcc caggccgatg gcggcctgga cacctccagt ttcgacggcg
    24961 gcggctcggc cggtggctcc ggccaaggcg gagaaggcgg gggcggcggt gcggcctctt
    25021 ctggtggcca agccggcagt tcgccatcgc gcgcctctgc ggggtggatc tccagttttg
    25081 ggagcaatct ggcaaaggcc tccagtgccc aggccatgga aagtcttggc ggtcgcgtag
    25141 acgccgcaat caaaaacacc tttggcggca aagtcgcaga acggctcgca gagcagcggg
    25201 cggaactcgc gggcggagac gatcaagtct ctgagaaaag tagcggcgag gaggctggcg
    25261 gagacttcgg gaacagcatc ggtggcagtc cggccggcga tgccgcgccg accagtgcag
    25321 ggggcggcgg catgattcca gaggcctttg aagaaagcgc ttttggtgag agcgacactc
    25381 acggtgagcg taataagtcg cccgatgtgt ctgatcttcc gccagagatg cagagcttcg
    25441 tccaggggaa aaacgcatga acctgaagcg aaccattgcc gctttcgcgg tcgtttgggc
    25501 agtcggcacc tctcctgcca gttatgcggg agatccctgc aagacggtta tctgcatgtg
    25561 gggactcttc tccggaactg gcgtcagcgg cggatgcaaa ggcgcggtcg ctgactactt
    25621 cagcatcgtt cgctacagga agaagaagat caactggaac gcaacgtctg acgctcgcag
    25681 ccagtttctg aacagttgcc caagcgcgga tcgcgggttc accagggcca tcaacggtcg
    25741 attcgggaag tcttcagggt gaacaggagc gccgctgctc gcaaggagat cccgcagcaa
    25801 gcgctgcggg ccttctatgc cctcaaggca caggccgggg ggtccgtctt gcattgcgcc
    25861 ggcgaggttc tgccgacgcg ggccgaggcg ctgcaagccc tctctgataa cgaaccctgg
    25921 accaacagaa tcatccgcgc gatgaggcag agcggcggaa cgatcacggt agaaaacgcc
    25981 agcatggaat ggcttgaaca actcgcctca cacgactggc cataggccaa aaactcatgg
    26041 agatcaaaga tgactgagaa ggacaacgac ctgtatcgcg gagtagatcg caccgaccct
    26101 ccgtcacacc cccaactcaa gaccggctgg atacgccctg agccgcccag tggctaccgg
    26161 aacctagtcg cctttggcgc ctacgccacc atcgaaggcg tgaggaagtg ggtttgggaa
    26221 ctggactacc tggacaccga caccggggta ttcgcctccg aggatcatca gttccaggtg
    26281 gagtggccat gggtcgacga cttcctaccg caagccgctg actgggactc catcgggatc
    26341 ccccatctca tgtaatgcct cggtcacacc tggtggtcct cgatcagctg ctcgcgttac
    26401 ctaccatgta ggaagcgcct ccctcctggc gtacccccgc tttgccctgg ccgaacccgg
    26461 ccaactcctg caggacgccc gccagggcct cctgcagcgc ctccagcacc gttcccggcc
    26521 accggccacc accatccccc aactccgcca ccagaaactc ctgcagggcc gcctgcagcg
    26581 gcacgcgggg atggggggtc actcctggat ctcctgcagc agctgaccgc gtgaccggcc
    26641 ccgtcggcgc cgacggccag ggtcactcct ggacgggatc gaggacgcgg atccgtgacc
    26701 gaatagggga gggtgacaaa ttgtcggggt agcgttccgc accgtcgggg tagcgttccg
    26761 cctgcagctg caggcggtca ctcctggacg gccagctgca gatccgcgcg taacccctgc
    26821 agcggtcacg ccggcagctc cgcggacacg gcccggggtg acctgtcggg atagcgttcc
    26881 gccctcgggg ttgcgttccg cctgcggcgg tttggcggca gcgccgccac tgccggcacg
    26941 ccggcccggt tgaacgccag gggaggggac tggggtcaca ccaggtgcgc cgccggcgcc
    27001 gatcgctgtg accgacaccc gccggggcca gcgcctgcag ccgatccacc ggcacggtca
    27061 caccaggtgc gcgagctcga catggccatg tgaccgccag cggcccggcc gccagggtca
    27121 ctcctggacg acatcgagga cgcggatccg tgaccgaccg gcaacaaaaa agcccccgag
    27181 ggggcttttc tgccggccgc aagggctgct tagcgggtca ttcctgctgt ttgctgcttc
    27241 tcctgctgcc gctgctgcgc gagctggcgg gctgcctcac gagcctgacc cagaacgtgc
    27301 gataccgcgc ctttcagttg ccgctccgcg ccttctcgac ctaggacact tttggtggcc
    27361 atgtcattga agtcgctcaa acccttctcc agctcaccag gggcaaaggt ggggaagaca
    27421 gcatgtccgc ccagttcctt cgctgccgct tccgccttca tacgaccggc gttgatgcct
    27481 tgcgaattgg gcttgagaga actggcgtgg tcgtcgtccc caacgaaaag gaccggcttg
    27541 ccaggaaact tctgctgcag tgctgcggcg acgtttttga gatttccgga gtcgaaggct
    27601 gcgacggtgg cgaacccgag actttccgac gcggtactca tagttgcgta accctcgcca
    27661 acggcgatga cgggcgcctt cgctagcgcg tccatcccgc cgacaacatg gaaacaaccc
    27721 tccttccgac tgtccttcgg gaatcgcttg ctgccatcct cgcggatgta ctgcatcgtc
    27781 cagaccttgc cgtcgatgtc ctgggccggc acataggttc gtttgccttc tcggtcggtc
    27841 agaatcccct ggtggatggc gatccccttc gcctgctggt actcggtgag ggcggtaggc
    27901 ggtacaagcg accgaaggtt gcgactgacc gtagcggcct tctcctcgta cttcgcctgc
    27961 cgctctcgtt cgcgggcctg cagtttctcg gcggcctccg cattgtgttt ggcgcgttcc
    28021 tcgtcggtca ggctgtagcc cttgctcttc cagttctgct tgatgccggt cttgtggttc
    28081 tggatgaagc cggccgggtg cccatcaagg tggccaatgt agacgccact cttctcgccc
    28141 ggcttgtcgt tgaccagggc aacgcgatag cgctggccat ccatcttggg gagtccgtcc
    28201 atcttcaggc cggcatcgcg acaggcctgc tgaaactcct cctgggggct catcttctgc
    28261 tgctccgcca cggcctctgg ggaccagcgt ttcagcttct cagggtcagc gccctcgccc
    28321 gcgtaccagc tgccagcggt cttgtcccag cgggcgccca aggccttggc cgcctcgcgc
    28381 tccccataag ggacggcgag atactgacgg gctgccttct ccggggccga agtgacaggc
    28441 tgttccggct ggcccggctc cagttcggac cccttgtcct gctgaggcgg ctgtcgccac
    28501 ttgctgaaca aggcaaggtc ttggccttcc ggcacatacc aggaggtcgc cttaccatcc
    28561 cacttcgcac caagcgcctt ggcctcgttc ttctccttga acgggactga taggtaggtc
    28621 ttctcggtag ccggctcttt agggtccatc gctgcctccc gtcgctgccg ctcggccttc
    28681 tgcatttgaa tcgcttcatc aagcgcctgc tgctgccact ccggctcagc tgtgtagcct
    28741 ttaccgtgca ggcccttacc gtgaacgaag gttttggctt tgccatcctc gttgagctgg
    28801 gtggtaatac cagtgtgctg gtcgttctga tcggtgtagc ggatcaggaa ggttcccggc
    28861 agctcattac gcgcgagagc cttaccctcg cccagttcga tggacgcctt caagccgtta
    28921 ctggctgcgt gctgctgaag gtttccccag ctttcaacgg ggttggagcc gggcagcgcc
    28981 atgctctggg caagctccaa ccgggcatcc acacgagcca gctccaggcc ggcgagtcgc
    29041 ttatccctgt cttccacgtt cgtctgcgcg tgagcgtcga tcaatagcag gcggtcagca
    29101 aacttgacgg catcggccgg acggttgaaa tcggccaggg actgatgcgt gccgtcactg
    29161 tgttggacat acaccccaaa caactgaggc tccagagggc tatcgctggc ccaggcgata
    29221 ttgccggagg cgtcctgcac caaggctttg agctggatga cgccattcca gtcatgcggc
    29281 agaagaacgc tggatcccaa cgcttcgccc gacatttccc tcaacagttc gatagcgctt
    29341 ccaggcacgc tgccagcgaa ggcggctgcg ccgcgaacct cctgcagagc ttccgtgagc
    29401 cgcgaatctg gcccactcat gatcgaggac tgttccaggg cttccgacag cccaacaccg
    29461 cgagcgcgca gatcagtaag ttgctgcaga ggcgacttct ccgcgaccag ggccgcgaca
    29521 ctttccgcct gcccttggcc ttggttctgc gtctgctgct gttcaaagcc gagaacgaat
    29581 ttctggatac gttcggcgtc ggctgcagcg cggaatattt ccatcgggtc atcctgcagc
    29641 accttgatcc agctcttgac gtaggcgacg tgctggccgg gatcgtggcc aaggcccagc
    29701 tcgtcaccca ggatcatgct cgcgatctcc gcacgcaact cttccttggc gtactcctcc
    29761 gacccgaagg ggttctgccc aacagggcgg tccaggcggg agggatgccc agtccaatgc
    29821 cccagttcat gaaacttggt ggcgtagtaa ttatccgccg agggaaactg cgctttcgag
    29881 ggcatatgga ttttgtccgt gctgacccgg tagaaagcgt tgtccgactg gtcgtggacc
    29941 acctgggcac cagaggcctg aataattgcc tccgcgcgct cgtgtttgtt ccaggtcggc
    30001 tccaggacaa ctcgttcggg gatgccgtcg atctgctcag cattgaaaac ggtcgcccag
    30061 aagacgcggg gacgatccag catcaccgtt tccttctccg gctggccctt gtcatccagg
    30121 accgggcgcc ctttttcgtc ggtcttctcc acctcgtccg tgaacttcca gtattgaacg
    30181 gatgtgccct tggatccctt gcggacctgc cagccttggg ctgctgcttg gttgtaggtc
    30241 atccagcgcg ggtcggagtg accctgactc atcaactgca ggatgttgat cccgttgtac
    30301 cgtttcccag tgactgggtt gtgaggcagt tgcgttcccg gcgtgccggg cgcccatggc
    30361 cgctgccagg gtgccgtccc cttggagagc tgttcgatta ggttatctgc aaccacctcg
    30421 tggaagggct tgcgctgttg ccgctcactc atggccgacc tccagcagat ccacggtgct
    30481 gtcctttgcc tcttgctcgc tcaaggcgtc ctcctggaag gccccgacca gatccgcttc
    30541 gtcggggtcc atctccacct caaagcctgg aacctctgcg tcccgcagct tctctactgc
    30601 gacttcgtga gtggtagcgt tcatgctgtt ttctccttgg ttgctgcgtc gtagtcgggc
    30661 ttacccgact tgtcgaagta ggtctgcttg caagccggat agcccgagca tccccaccag
    30721 tacgtccccc tcttctttgc tgggcgacgg gtaagtccct tgccgcagcc ctcggcgcgg
    30781 caggtgtgtt cgattgaggg ggtcggcgcc tgcttcttcg ccaggacggg cttgcccccc
    30841 ttgtcttcaa agctggcctt acagccctcc tgatagcccg tgcaacccca gaaggggcca
    30901 ttagcgctct tacggatcag gcgcaggggc ttctggcact gggggcacag gtgttcagag
    30961 gcgggcttct gggcagttgg gacggcgccc cgaacagctt ggagttcgga ttccaggacg
    31021 gcgtgcattt tctgaatgac cggcttgtag gtcgtcttgc cgtccgcaat gcgatccaag
    31081 tcttcttcca tctcccgcgt aaagccgacc tggacaaagg aaaatcggcc ttccaatcgt
    31141 tcgatgatct gctctcctgg aggaagtgga tgcaggaagc gcttctgctc cccgacatag
    31201 ccccgcacgt cgatgatgtt cttcatgatc gctgcgtagg ttgcgggccg tccgatacct
    31261 tcggcttcca gcgccttcac caaacttgcc tccgtgaatc gcggtggcgc tttggttttc
    31321 ttttccagca cctcgcccga ggtcgccgcg acccgctggc ctactgcgag aactgggagc
    31381 ggattgggag cctcctcctg gcgttcatca tcggtgtcgt cgcccgctag cagcttgagc
    31441 cagccgtggt cagttagggt tctgccggtt gctttgaaat gcacgtccct cccgtccaac
    31501 tgctcattgg ccttcagcac agccgaccga accgcatact ttgcaggcag cagctgagac
    31561 gcgagcgcac ggacgcgaat caacttgtag agggctttct gctcgtcggt ttcccccgcc
    31621 tcgtccttat cccagtaggt cggggtgata gcagggtgtc cttcctgcgc tccgtcctta
    31681 gccttgaact gacgccgggt cgccacgacc tccaaaccca gaacggcggc agcggcgcgc
    31741 agcttcggca tggagtcttc cgagacgttt gggttgtccg tgcggtggta actaataagc
    31801 ccctgctcat agagctgctg agccaccttc atcgttcgat cagttttcca gcccaacgag
    31861 ttgcttgctg cctgctggat ggttgaggtg gtgaacggcg ctggagggtt gcgggtggac
    31921 tcggattcct caaacgaagt cacttcaagg gccgtcaggg cagcgacccg ctctgccagg
    31981 gcgcggtcga ggacataggg gctggcttcc gtggtgaacc ctgctttggt gtcccactca
    32041 accttccaag tgttcttccc ttccgccgca aaggatagag atgcgccgta atggacggtc
    32101 atcttgaagg cgcggatctc gcgctcgcga agtacgacca agtacacggc caccgactgc
    32161 acacggccgg cagtcaagtt ctcgccggtc tgccgccgga gttccgggct aaccaagtaa
    32221 ccaacaaggc gatccagcac tcggcgggct tcctgagagc caactaactg catatcaatg
    32281 gagcgcgcct ctccaaacgc cttgcgcaca gcagtttcag tgatttcgtt gaacgtgatc
    32341 cggatcggat cagacagcct cagggcttcc ttcaggtgcc aactaatgct ttcaccttcg
    32401 cggtcagggt cggttgcaag gtaaacctgg tgggcggtcg agactgcttt tttcagttcg
    32461 cgcgcaacct tcgccccccg ctcagtgagt tcgtagacgg gggcatagct gcgccgaaca
    32521 cctgtggtga tcagatcgtc gccatccccg ctggcgggca gatcacgaat atgaccaacg
    32581 ctcgcttcaa tcttccagtc ctctcctggt cgaacttttg ccaggatctc gcgcagcttc
    32641 ttcgcctttc cgggcgactc gatgatcatc agattcgatg ccatttccgt ttccttacca
    32701 tgtccagacg ggccgcagaa cggccctgat ttgagagtgt tcgattgggc cgaagtagcg
    32761 gctgtcaaag gagttggcgg tgtcgccgac aatcagcacc tgccctggtg cgagcgttac
    32821 cggggcttca aagaaaggca gtagtgccct tccccggctg tcagctgcaa ctgctttgct
    32881 gttcgggagc agctgcccat tcaccctcaa cccgagcgcg ccgttctcca cggttgcgcc
    32941 ctgcaggcca gcaacgcgct tgatgactcg ctgatagttg ccggggcaat cccagctcgc
    33001 cccgaggtag ccgcgttgct gggccgcgct ggtcgctgca gaaacgggcg ggcaggccag
    33061 gacaacggcc cccggtgcca ccggctcctg gacgacgcga tagaagccga ccgggagact
    33121 gtgggtggtg ttgacccgca ggcctgccat gaacgcgacc ggcagcgcgg caaccgcgat
    33181 cagcgcgccc agggccgcgc gcttcatacg atgatctccg gctcttgctc ggtgatcact
    33241 ggaaggtcta ccgggcgggc tgaatggaga cggtcggatt tggcaggcgc agggattttc
    33301 gcccttgccg agaaagccgg atccatgaag tacaggatct gcttgccgta ggccgccgga
    33361 cgacctgcac tgaagatgag catgtcaccc gcttcgacaa tgcccccggt ggcgtccttc
    33421 ttcggccccg gcaggcgcag gcactcgtca ggagtcagga ggttccgctt cacctcctgg
    33481 taactgcggg aaacattgtc cagcctgcct ccgcgcttcc cgctctcggt gacgctctcc
    33541 ttcactacgg tggtttcgcc ggtcatggtg gacagggcct gcgcggtgtc catccggttg
    33601 ggggcgtagg cgattcggac gtgacagttc gatgtgatcg actcgtcgcg gccatatgcg
    33661 gcgttcaact gcgcggtgtc ctggacgatc aggtagcact tcaggccgta gcccgctacg
    33721 aacgccaacg actcctgcat gatgtccagc tttccgagcg cggggaactc gtccagcatc
    33781 atcaacagac ggtgcttgta atgggccacc gggcgcccgt tctcaaagtc catcttgtcc
    33841 gccaacagcc ggataatcat attgacgact acccggatca gcggctttag ccggtccttg
    33901 tcgttgggct gggtgacgat gtagagactg acaggcgagt cgtggtgcat caggtctttg
    33961 atgctgaagt cggacgactc gacgtttcga cggaccaccg gatcccgata gagggacagg
    34021 tacgatttcg ccgtggacag taccgaaccg ccctcttgct ccggacggtc cagcatgtcc
    34081 cggccactgg cggcgaccag gggatgaact tccccgttcc aatgggggta cgtcgtcatc
    34141 tcttcccaga gttcgctgac gggtcggctg gggtctgcca gcatgtcgtc cacggcgggt
    34201 aagctggcga caaagccctc gcgtttagcc ttgtagatga tgtgcaggat gcaccccacc
    34261 aggagcgact gcgaggtctt ctgccagtgg tcctgcagcc ccttgccgtc cggatccacg
    34321 atcagggttg caaggttctg ggcatcgcca acctcgttct cggtagccac gcggatatag
    34381 tccagcgggt tgaacttgac gctagccgtg gctgaggccg gctcaaagcg cagcaccttg
    34441 ttgcccgcgt gttcctgccg ccaaccggcg gtcagggccc agagctcacc cttgaggtcg
    34501 gtgatgacgg cgctgtgtct ccaggacaat agcgtcggga tcaccagccc cacacccttc
    34561 cccgaacgag tcggcgcaag gcaaaggata tgctccgggc cctcgtgcct gaggtagtgc
    34621 agagtgccgc tggagtcgac ccagcccccg acgtagacac cttcgttatc gaagaagccg
    34681 gcgtcttcca gatcacgttt ctctgcccag cgcgccgtcc cgtgcatctt ctcctcggcc
    34741 ttcaccttgt gccgggtgaa gacttggtag atcacgatgg cgaagacgaa tccgcatcca
    34801 accagcaccc caagcgaacc ggagtacatg aactcccgag ggaattcgtc gtaccacttc
    34861 gccgcccaca ccaggatcat ccacggccaa taggcgtgat gaaatccagc tccaagcgtg
    34921 tcctggtagt tgaacagcca agcgaagtgc tgcgttgccg cgctcagtga caagagcagc
    34981 aagacagtca gcaacgcggc tttctgcaag tgccccgccc taccctcttt ctttaccgtg
    35041 ttggtctgtg gaccgatctg gtggttatcc ccactcattc cctactcctt gtagatcctt
    35101 gaacctgaat tgctccgact gctgatacgt ggatctcccg acccacgcgc tgccgctgaa
    35161 gccttgctgc agtggcagcg ttcactggca gaaccagcat ttcctgcccc cgcttcagca
    35221 gggctagctg ctggccctcg acattccgca ggccggcgaa ctccaacggc ccggcatccg
    35281 tactggcaaa ttgccggtgc ttcattatat cgaagcctcg cgcgtgtttc tcgttccgtt
    35341 catctatgta ggaaacagcc gccctcccct gctcgaagcc cagcgattcc gcagccttac
    35401 gcgccttctc aatagtcgga tcatcgaaga ccaccggcag ggaatggcga gccgcgacat
    35461 gggccacctt cgctttaaag aagtcgtcac cggagatggt taagcggttg ccatgccgct
    35521 ttgcggccag ctccagggca agaagaacgg tttcgtcgga tgcttctttg cggagctgca
    35581 ggcgattccc gtcgtcccga atcactccgc ctggagcttt gtaggtgatc gtcccggctt
    35641 ggcttacgcc atcgacctgt agtccggcaa tcggaccagc cgccgtggac tgcttcgccg
    35701 cgacggtgtt gccgcgtagg ccgctgatcg tcttggagcg gagataggca agggcttcct
    35761 ggtctccctt ggcggcagcg gcggccaccc agtcgcggaa gctcaactgc ggcttcttct
    35821 cgtgaagctc tttccttctg cgagcgaact cttcgtgaac cttcttcaga tcgtcgcgct
    35881 gcgaactggc gatctgggcg tagagcagcc ggcggctaat tgctccagcc ccaagcccct
    35941 tcagtagctt ggtcgccgcg cgtttcttct taccggcctc caggacggcc tgcagcgccc
    36001 tgtccttctc ggacttgagc tgccccagcc ccttgcgctt gccggtggtt acagcatccc
    36061 tttccttctg ataccgcgca tagagatggg aggagtcgac gctgctacgc cgtgggcgcg
    36121 ggcggtaggt cttcttcgcg atagagctgg cccgctgcgc ggactcttcg tagctgccca
    36181 accgaccttc cagggtcttg agcgagcagg cgcgatctac gctgctcgcg cgaacggata
    36241 tgccgtcctc ggtttcaaag accagccccg cccccttctt gcggatctgc agtccatgct
    36301 cggcaaggtg cccatgcagt tcctgccagc tcccaacctt ggagattccc tccagggcct
    36361 ccgaacggat ccagcctgcc agcgtttcca gctccgattt agcagctaaa tcgtccgcct
    36421 tagaggaagc tgccgacttg cttggtgcgt ggttgtcgcg ctccaagccg taggtcagtt
    36481 cgatgcggga acatagctcc ccgagccgtt tgtggtcgta gtacggctca atcatgttgt
    36541 gcgtctgggg gtgaatcttg ttaatcgcga cgtggacatg caggttgtcc gtgtcccgat
    36601 gcacaacact gatgcgctgg tgatcggcat agccgagccc cttgcacagc tcgccctcga
    36661 tttccttcag cacctcgggc gatatgtcct ccccctcccg gaaactgaaa accaggtggt
    36721 aggtcttgtc cgacttcgcg cgacggttca gatcctggac ggcctcaatt tcccgaacag
    36781 cccattgcgg atcttcgctg ccgcagttcg tgaccgacac atcgcccacc cgttccagct
    36841 ttccctggtc gtcctgcagg tacttaacca gggagccgaa actgctctta ccgtcgcggc
    36901 gccggggcac tcgtttcgcg atcatccctc gcctcctggc gttgaattag ctcctgattc
    36961 actcacagcc gcttcaccac ctggagcagt tcatcctgga gaaccttgat cttcgccagg
    37021 gcctccacaa tcgactcctg gagctgttgc tgattgaaga gggccaagcg ttcgtcgttg
    37081 gtcagccaca tcttcaacag gccgccgaga cgcccgatat caccgttcac cttcgacatc
    37141 tccacaacgg cctgctgatc cagcacgccg cgcacctcta tcccaagccc gacgtttctt
    37201 agatatgccg aagtgctaag cccaactctt cgggcgttct cttcgattgc ctctttctct
    37261 gcaggcagaa cccggacctt gatcaaaggg ctgttcttcc tggtcacatt cgtcatctca
    37321 agctcgctcc aaacccaata ggcggtagcc gttcaccctc ggagagcagg acccccgttg
    37381 agcacgtagt gcgaataagg ggatggtgaa atgggtccac ctcgcttgcg aggtgggccc
    37441 acttcacaca tcctgcccga aaaagaagtt taacgccggg ggcggtcggg tgccatccaa
    37501 atgccatcct gatgcaccag aagcgcacct aggctgcatc aagatgaaag atgcaggaaa
    37561 agtgcataaa aaaggcacgt tagcagcctg ctagcgtcgt atgaggcaca cgagatacac
    37621 tcgggtgcat caatggtgca gaaaagtgac gtgttcagat ggcaaacctt tctgagcgac
    37681 ttgcggagcg cgcaaaaaaa accgcgaccg agaagggacg tggccggtcc gccttcctcg
    37741 cgttgaagcc ggagatccag cacgccctgg accaaggctg gagcgccaag gagatttggt
    37801 ccttgctgct ggaggaggac aagattgcga taagctactc tgtgttcctt cgatatatca
    37861 gagcgaacgg tatgaggggc ggtgaggtgt cttcagatct cccgcagccc cctgccgttg
    37921 ctccatcgcc accatcgcag gaagtggcgc cggcttcgct ccaggagcaa ccaacggcca
    37981 gtcgtgagcg acctactcaa tcgggtttat cagggactgg cagcagcaac ttcaaactcg
    38041 atagcaaacc cgacaaaggg agtcttgtgt aatggcagtc cacaaagtgc atatggttct
    38101 gcagggcaaa ggcggtgtgg cgaaaacctt cgcctctgtg atgctcgcgc agcagatcgg
    38161 ttcgcggggg aatctcccgc tctgcgctga caccgatccg gtgaatgcaa cctttaccgg
    38221 gttcgcggcg ctcaacgtcc aacgcatcga aataatgaac ggggatgaga ttgatccgcg
    38281 tgctttcgac gccctgatcg aactcattgc gagccatgag ggggatgttg tggtggataa
    38341 cggcgcttcg tcgttcatcc cgctggccag ttacatgctt cagaacgatg tagccggcct
    38401 gctccagagc atgggccgcc agctggtcat tcacacgctc atcacggggg gccaagccat
    38461 cctggacacc ctaaacggct tcgcggccat catgagccag ttccccagcg gtcccgagtt
    38521 cgttgtttgg ctcaacccct tctttggccc catcgagatc gacggaaagc ccttccagaa
    38581 gatgaaggtg tacctggaga acaaggacaa gatcaccggc atcatccaga tgcctgaact
    38641 gaagaaagaa acctttggcc aggatctgcg cgacatgctc caggaccggc tgaccttcga
    38701 tgaagcgctg gcctcggaga gcctgccgct gatggttcgc cagcgcctga aaatgtctca
    38761 gcgggccttc tatgacgcca ttggcgtggt ggtcggctga catggcggca gaccttcagg
    38821 atgagctgat tcgcgaactc gcggccaagc atggtgttgt gcttggccgt gacgatccaa
    38881 tcttgatgct aacgacgatt caggagcaca tgctgcgcaa gttgaacgaa ggccagagcg
    38941 aagccttggc tgagtttcaa cggaccatgg agctgagcat gactacatgg tccgaggatg
    39001 ctcgggagaa ggcacaacgg atcgtcaatg gcgcgcttga agcatcgaag cgggtcatgg
    39061 cgcaaaatgc tgaggccgct gcggccgagt ttggcaaggt cctggagcga aaggttggcg
    39121 agatggaagt caggctgaac gctgcgaggg aggagcggtc ctccaccctc gtggtcgttt
    39181 ccatagccag cggcttagcg ctggtggtcg cggtggtcgg cctatttatc tgaaaaccct
    39241 tggaccagca cgcggctcag cgtctggtcc ttcgctttcc cctcccgcac cccagcagcc
    39301 cttccattct ccgtcagttc tgcacgttcc tggtcccgct tcttggccct ctcttctgtc
    39361 tgggctttgc gttcccgctc ccggagttct tcccactgcc ggaccagatc cgggttctcc
    39421 gcctggagct ttcggtaggc catatctcgc agcacactcc catggacgtt ggttgcgctg
    39481 ccgatctccc gaacccggtc cagtcgtcca tgcagagtgc tgatacgctg ctccagttgc
    39541 ccgactcctt gctgccagtt cgcccgcgtg ccgggcagtg acaggaggcc tgggcgagct
    39601 gacaattgcc gttgaagtgc ctgctcggcg cgctcgatca agtccgaaag cccctcctca
    39661 atccgctcga cctgctcatg tttcccctca agcatggcct caagctcgcg gctgtactcc
    39721 cgcgccgtag tagtgctgtc cagcagagtc gcctgctcgt cctggagccg ttcggctgtc
    39781 agctctgagt accgatccag ggttggtcgt tccatgttcc ctccgagatt tagcagctaa
    39841 atccatggcc agttctgtta ggtcacagaa agcactgacc tggtggcgat agttgtgact
    39901 gtaggggagg ctactgctcg tcctttcgcc agatgacgcc aagtccagcc tcatagcaaa
    39961 ggatcgccca ggacgtgtaa gggatcggag tcccctcggc ccagcgcctc acttgccgtg
    40021 caagcacgcc tagtgtctgc gccaagtgcg ttttgttatc ccctgccatt gctatggcct
    40081 gctggacttc ggcggcgctg ggcacctgcc agtcctgaga gtgggggcgg aggcattccg
    40141 ccctgatgct gtgtttggtc atggttcgct ctgcttgttg gtccgacgct caatcgggct
    40201 ggggttcagc attggctcgg cggattcgcg tctgccagtt cgacggcaat cccgtgccac
    40261 acggacggcg gtattgtgtt ttgcatctcc gccggctggg ccacctcgcc ccggcaaact
    40321 gagcgggcgt actcccgaac agccaccatg gcaaaggagt gggcaagcga cccgtactgg
    40381 gaggcctcca gcagatctac aagggccgga ggccgtttgt gatcaacggc ctccgcagtt
    40441 cggtttagct ctaggtgagc agagagattg aagctgcgta gccacaatgg ccccgcgccg
    40501 tttcgcagct gccgcagcaa tgcgccgtcg gggagtgttt cgtcggtgcc catcgcccag
    40561 tggttggcga gctttgcctt ccagtttcgg ccgctcccct tcgcaaatcg cgccacggca
    40621 tccagctgcg ctggcgttag gcagtcgttt tcttgcggtg ttgccatcgg aattctccgg
    40681 taaatgaccc ttggcgttct gcccggcctt gcattcatta taggtcttta agacctatac
    40741 agacaaccac tatccagcta actcccggcc tgatcccaga tcattccaag gcccgccttc
    40801 cagcaaagga ggcaccagca ggcgtatgga atttccttct cgccagttgt ccagcggttg
    40861 agtcccctcc tggaaacgcc caggaactca ccaccctccc cactgcgaaa gcctgcagcc
    40921 tggagcatga tctgtatctc ttccctggtc ggttcagtcc accccttgtc gaaagacaac
    40981 agacagcttt tacgaacatc agacacatcc atcgcactaa ccccgcgcaa acaaaacggg
    41041 ctgccccatg cagcccgttt ggttcagatc attattctcc acccctgaac gctcagtcca
    41101 agggaatgat cggatccagt ccacgagtgt ttgctacggc ctccggattg cggtcgtaat
    41161 cgacgactcg gacctccagt ccaagtatgt tggaattcac ggactggaga ctgccgccag
    41221 cgagctgcag aacaacacgc gggctcaccg ggttgccctc gacagcgttc cgggtcgcct
    41281 cgaccaatgc caacggggct acggtgtcat cgctgaaatc gtcaatcctc agccagcggg
    41341 cgagcagccc cttgaggacc acgttctcag ggatagagcc aatctcaagg tcaggtgcag
    41401 tgttcatcag aattctccga aggtgccggg acaatccacc ggctgaacaa gggcccggaa
    41461 ctccgggccc gatttctcaa actcaacgct ccagcagcgc caggacagtc gcgcggactc
    41521 gcggatggca cttccctaga tagtgcccca gttgacggct cggcaggctg tgcagcatgt
    41581 gcagcggggt tgagcggaca cactcgtagg cggctttaga catttcagaa ttctccgata
    41641 gagaggccca tcgttcgtcg ggcctggatg gcgtggcgtg ctggcacgcc acgctagttg
    41701 attaaggggg ttagtcgatt gccgcgaaga tcgcgtcggc ctcagcatgg gctagggcaa
    41761 agtcgcgcag ccagtggtaa tggttgatga ggttgtcagt ttggaaagtg ttagcggcac
    41821 ggcagagccc gaacaggctc gccacgatgc cagctgcatc cgcgctcagc tcaccttcat
    41881 aaccattgcc ctggcacgac aggcagaagg cgtcctggtc gttcggagcc atgtagaagc
    41941 cgccattcga cagttcgtag tattcccagt agccgccatt gtaggaatcg cacagctcgc
    42001 gcagcgcgtt catgatgttg cgctcaacat tcaacatctg gcggtcgaag tggcgcggca
    42061 gaacactcat acgcagtcgg acagggacgc ggcggcattc gatgggtgac agggtggctt
    42121 gagtggacat tccagaattc tccggtaggg ggcccagcgt tcgtcgggcc tgcgggagta
    42181 ttatcggtct ttaagaccta gctgtcaaca caataagtca ctcctggtgc tcctcgatca
    42241 gctgcccgcg tgacccctcg cccagcaggg cgccgccggc tcgcacctgg gccaccgcca
    42301 ccccctcctg gcgtccaacc gcttttccat cgcctccaac cgtcggcgcc gacggccagg
    42361 gtcactcctg gacgggatcg aggacgcgga tccgtgaccg aacaggggag ggtgacaaat
    42421 tgtcgggata gcgttccgcc ctcggggttg tgttccgcct gcggcggttc ggcgaccgcg
    42481 ccgccactgc cggcacgtcg gccgggttga acgccagggg aggggagtgg ggtcacacca
    42541 ggtgcgcgag ctcgacatgg ccatgtgacc gccagcggcc cggccgacag ggttactcct
    42601 gggcgagatc gcgaagccgc cccctcctgg cgttcaaccg ctctttggcc gggaaccggc
    42661 ctaggcttga aggttgcggg ttcaaggggg cgcagccccc ttgctagggt tcggggcgag
    42721 agccccgttg tccgcgccgt gccgaaggca cgaagtgcgc gggcgtagtt tggtgtgcga
    42781 agcacaccct atgccgcgcc gcgccaaagg cgcgaagtgc gcgggcgtta tctgggtgga
    42841 gcgtagcgac accctcttct gattctttta aaagcggact gattaagggc cgacacttaa
    42901 atttgatcta gccgacactt aactaaaata tccaccggcc gcgagggctc tgagcgcctg
    42961 acgcctcttg cgtgggctgg ttgggtcgtg gaacggggct gaaagggggc gcaagggcgc
    43021 caaaacaggc ggcaggagtg ctagaggggg cgttggaggg gcgatcaggc agggggtagc
    43081 cttggcggtg tctcagccag cgatcttctt gctcagtatc gcctctgcga tctggcggca
    43141 cgtcgcgcta tctcttccag gatcttcctg cttcagcgct agaaccagat cggtaaacat
    43201 tcgcccgtaa gactctgagt caatcggcag ggcattttgc ttgggtgggg ccccgatgcg
    43261 cggcaggccc gcgccactac ctcgcccgat aacaagcatt cggcctatag ccagcgcgct
    43321 cctggaccac tgaccaagat tgcctccttg cttctttgct cgcttggcca gccgctcgct
    43381 agctctctgg cgttcgtgct tcagccactt caggaggccg aatgcaccaa acagcaaatt
    43441 gttcacagcc ttgacggccg ccaatccgcg ataggtgccg tcttcctgca gctgcctggg
    43501 ctgagcgacc gtaaggatat tgctccgctt gagatccgct acagctcgct ccatgcgacg
    43561 cagccccatt ccggtaaaag cagccagata ctcaagggtc agagactgga agccggcagc
    43621 cgtgggaatt ccgcagcgca gggacgttag atcggtgaat tcaaggattg atgtcagggc
    43681 aaggatgcac gcctctcgcc gctcgctgcg ctgctgccgc tggctgcgat tggctgcgtt
    43741 caaggagggt aggcgtgatg gcgagcggta atactggcgc acagcttcct gcaggcgctg
    43801 cagaatgcgg ggccgatttt taagggtcgt cggtttcgcc agctggaggc gtggggcatc
    43861 agggttatgc ccgcagaagt ttccgccgga gttcgtccgt gggacgtatg gccgcttttc
    43921 tatctgcatt gcccgaggcc tgttcggcag cgggcgagcg atagacggca ttttttaaag
    43981 ttgcgcgcat gcgcagtgaa agccataatc tgctcaccaa gtgttgaaca ggtcgcgccc
    44041 gccaagaccg cctgttcact ttttgatcca gaaagcccgg ttaccagccg ggctttttgg
    44101 tttctgcttt tctgctttat gccacttgca aagtcacctt cctgaagccg acacgctctg
    44161 catcggcgcg cacagactca aggctcttgt aaatcttctg ccgatcagtt ctggcgacag
    44221 tcatgtgttc aagcaaacca tcccggcgct cgaccatcag aacccaggcg ccgctctcca
    44281 taggagcggg tgcaatgatt gcctccgaca aggcgccgac ctcgaaaagc ctccgcatcg
    44341 cttgtaggtc catcgctgac atcatgccct ctgacaattg cttagttgtt caccgaagag
    44401 aatatggcgg cgtgcatgaa aaagcaaatt catgcacatg gttttgccat tcggtgcggc
    44461 ggcagcatta tgccagcatg tcctggcaac aaaaagccct tcgacggaaa accggcgtca
    44521 aggaaaatcc ataagaatct tcttgcgcta tgtatccggt cggatacaat aggcagcatg
    44581 aactccttca ttagcaccga cgctttcgac aactggctgg ccagcctgac cgacaaggtt
    44641 ggaaaggccc gcatcctgca gcgactcgac tcggcaatgc tcggcaactt cggtgactgc
    44701 gagccggtgg gggaaggcgt cagcgagatg cgaatccatt acggccccgg ctaccgggtg
    44761 tacttcaccc gccagggcac agtcgtttat ctgcttctgc tcggcggcga taagtcgtcc
    44821 cagaagcgcg acattaaact ggccaagaaa ctgctcgcag aacttggcaa ggagtgaggc
    44881 gatgaccacc ctaaccccct tcgatgtatc caaacacctc gacgatgatg aggtgatcgg
    44941 tgcctatttg agtgctgccc tggaggatcc gaatcccgac gccttcctcc ttgctctgca
    45001 caacgtggcg aaggctaaag gcatgtcaca gatcgcgaag gacgctggcg taggacgcga
    45061 aagtctctac aaggcactgg ccccaggtgc aaagccgaga tacgacacca tcctgaagct
    45121 gctgcatgcg cttggccttc agttggtcgt cagtccgagt caggccgcct aacccgttcg
    45181 ctccattgca cccgccctgc ctcagaggaa gagatatggc cacaccacaa cctaaaagga
    45241 ttgagcacga ttgggcagga ctgtgccaac agacagcccg cgtcgggctc gttctgctgc
    45301 cacttgcgat ctgctacgtg atctctcgca acctagagga gctggcgggg ttcgccctga
    45361 tcctgctcat agccatcgaa gccattgcct tcttcagtct gttgacggga gaagacaacg
    45421 gcggccagag cgacctatgg tggctgttca aagcgacaag catgggcgct gccgcactct
    45481 ggtcactcgc cttgctggca aactagacct cccaacaaac cggccagggc catgcccagc
    45541 tccctcctgg cgtccccccg ctttgccctg gccgaacccg gccaactcct gcaggacgcc
    45601 cgccagggcc tcctgcagcg cctccagcac cgttcccggc caccggccac caccatcccc
    45661 caactccgcc accagaaact cctgcagggc cgcctgcagc ggcacgcggg gatggggggt
    45721 cactcctgga tctcctgcag cagctgaccg cgtgaccggc cccgtcggcg ccgacggcca
    45781 gggtcactcc tggacgggat cgaggacgcg gatccgtgac cgaatagggg agggtgacaa
    45841 attgtcgggg tagcgttccg caccgtcggg gtagcgttcc gcctgcagct gcaggcggtc
    45901 actcctggac ggccagctgc agatccgcgc gtaacccctg cagcggtcac gccggcagct
    45961 ccgcggacac ggcccggggt gacctgtcgg gatagcgttc cgccctcggg gttgcgttcc
    46021 gcctgcggcg gtttggcggc agcgccgcca ctgccggcac gccggcccgg ttgaacgcca
    46081 ggggagggga ctggggtcac accaggtgca ggccctggac gtggccatgt gaccggaact
    46141 cgtccgggcg gggtcgtgtg tcactcctag gcggcgtgct tctgatctgc ctaacccgtc
    46201 aatgcctagc ccggtcgagg accgaagccc agcccggcca gtcgcttgtg gcgaactcgc
    46261 cgtcaccagt gatattggta ctctcccatt cctgaagtgc ccgcttctcg gcctcagtca
    46321 tcatctcggc ggccttgatg atcagttcgt actgggcgag ccggccagca acttggcgcc
    46381 ggccttcgct cgccagggca tcgaagcctt cgatcagctc ggaaaagatg tcgcgcttca
    46441 tggcgttctc cttaaccaac ttgcccaccg acacgggggt tggacttcat tctgaaacga
    46501 aagacggctg cctcgggcag ccgtctcttc aaccttcgac cagggcgacc agttggaccg
    46561 ccgcaagatc tacttcaact tcattgccat cgtcatcgta cttgatgaac ccccagccgg
    46621 gtgccggtgg gcggcgatcc aacaagatgc gcgcaggccg ctcatcgtgc cgcacctgga
    46681 caatggttcg cttgatcttg tccgggtcca cactcggcgg gtctttccgc tcgctcgccc
    46741 cgctgttgtc gtcggtagtg ctgctttcag gctccttcct gcctccctcg tcccgctccg
    46801 aatcagtccg accattcagg aagtcgactg tgttggggtc gcgctcaccg ctgccttcac
    46861 caccactgcc gccggaatct tcgcgatggg gatcttggac gccggatcct ggatggccgc
    46921 gttcttcggt gatcttcaca actggcggct cctctttcgg aggctcctcc aagtcccggc
    46981 ggaaggcttt gacggcactc cgcagaatct cgtcgggctg ttccaggagc caagtttcca
    47041 cttcgcctgg atgggacttg tatgcggtca tcagttcagc gatggtggac aggtcgcggc
    47101 agcgccgctc gtcatagatt tgctcgatgc acggcggcat tttcagcaga ttggaaattt
    47161 gattcaccag ggactgcgaa ataccaaggc cctcggcgat ctgcttcttc gtctcacctc
    47221 ctgccagttt tcgcgcaacg aaccgcgcca tctgccgccc gctgacatcg agtcgcttgg
    47281 tgttctcttt ggcgttgtcg tagtcggtat agtcctcgtc gatgaaggct gggatctcct
    47341 ccagttcggc ccagacagtc gctcgccaac ggttctcgcc atggttgata agccacttgc
    47401 ctgggttctc cggatccgag cgcaaggaaa tcgggctttt tacaccgcga cttttaacat
    47461 caggccccag ctcctccgtg atgaacttct ggcgagcctc ctcgtcctcg gcgtggctgt
    47521 catcgccatt acggatctgg ttagggtccg gccgaatgtc agtcaccttg aacatcgctg
    47581 gcgtgccacg cggctgctca ggctgatcct tcagcagatt ggaaagactg cccagcgact
    47641 tcaggctgcg ctttcccttg ctttcgtttt cagtagccga gcccatcaca ccacccccat
    47701 cttttcaaaa acgcactgcg tgaacgcacg catttctttc gccgcgacgc gagccgcagt
    47761 cttcttgatt tcccaaaccg gcctgcccag ttccagcgcc tcatcaatcg aatcgcgcag
    47821 gccaatctca gggagaacat aaccgggaaa gtcttcgttg agctgggcca aattgtccaa
    47881 ctggcgttgc ttccggcgct ccaacatgct cggcaccatg ccgaggaact gcagatccgg
    47941 attgaactgg cgaatcgcgc ctaccgcagt gttcatctta ttgatgccgc tcaggctgta
    48001 gcgcttgagc tgaattggcg aaatgaagaa gtctgcgaca tacagtgcga tggtcagcgc
    48061 cttccccaag gatggaggtg tgtcgatcaa gcagaggtca tagccctgct ctgccagcac
    48121 gctcagcgcg tccctgaagt tctcgccagc gtctccaagg tccaagtctt ccaggtcagc
    48181 cagtccagga tcagccgcga ttagcgtgat gactggttca ccattcggga tggcggtcag
    48241 cgcctgctgc gcagctgtga gcggcagaaa aagattgctg gtagtaaggc cgctactgaa
    48301 ttcctccagg gtgtcggtgg cattgccttg agtatcgagg tcaatcactg cgaccttttt
    48361 cccccgagcc accgcgtcat gcgcgaggtg gacaatacat gcggtcttgc caacaccacc
    48421 tttctgctgc gctacaccca gagttttcat ttcgtcccct tgatggcctt caaggccgcg
    48481 ttttcccact gcttcacctg aaacgcctgc tcctccgtga tcaacgctgt gaccaggacg
    48541 tagcccggcg ggcacgcatt ccacacccga ttgaccgttt ggctgatcgc ccccctggtc
    48601 aggttcagct ccttcgccag agctgactgc tgttcgccct tcaccagaca gcggtaggca
    48661 atatgccgtg tttgctcgct catctgcatc aggttcggca actgcacgat acggctgaat
    48721 tgctcctcgg ataatcgctt gactgtcatg ctgaacactc atgtgttgta ccccgcacta
    48781 caacatttct aggcggttgc cgccgccgga atggatcgaa aatttagcag ctaaacatct
    48841 ggctcagcgc cgcccgccct tcaccatgcg cgcaccccag ctgatgagga tgtacttcac
    48901 tgccactagc cccaccatgg cagccacggc caccagcccg gcgaaggtcg cggccggccc
    48961 atcctggaac aaccaacgca gcgcgtagaa cgtgaacgcc acgctgaaaa accagcccag
    49021 cggccgatga agaattacaa cgagggtgag aaacacccgc accagggccc caccgatgga
    49081 agccgcagcg ctcggctggg ccttcgtcgg ctgtactttc ttgggagcca cctggggagc
    49141 cgatttgact actgcgcggc gcgccaccgg aaactcataa acctttgcct tatccatgtg
    49201 ttgactcccc gattccgttg aagtcgaatg ttgaagccgg acccgcatct ggctggccct
    49261 ggcgaagttg ccgcttctca gggcccattc cttcagcccc ttgtatagct atagtttagc
    49321 tatacatacc aagcaaagca agccccgcaa cagcttttcc atctgcgcct tcccctggcg
    49381 tatccaagct ctacagctct tagcgccctt cagcacgcac cagccgtgag ccgcattcgt
    49441 aggcatcagc gcgcaggaca gcccgcaccg cctgcgtccg tcgagtctca taccaaggcc
    49501 gctcaaactc gggacgctgc gtctttacct gactgatgtt ccggatccta gagcgaagcc
    49561 agttggcatc cgctgtgtag actgcggcag gattgttgga ctggagcgcc tgcagcttgg
    49621 ccagcaattc cggggtcatc tttacgcggc cgagaatgtg gaagtcaccg tgatgcaggg
    49681 tggcgcagtc gtctgccgac atggcttcca ggttggaagg gatgccggcg cagaaggcgt
    49741 ccgtctggaa aatgcgcttc gcttggccaa gtagatcgcc agcggaaaga gccccacgtt
    49801 gcagcggaac gatcacccgc gccccgctcg caacccaagc gcagatccgt tcgcggtgga
    49861 gttcccacag cgccagggtg gccgcctgat caccgatcac atcgggggcc acgatactca
    49921 atcggtcagg cctctcggtc gagttgacca gacagtcgta ggcaatgaag actcgccccc
    49981 agtccatctg ttcgcccttc tgaaaggccg cgaacgcccc cgagtcgacg aaaaccgaac
    50041 caccttcatc caggtactgc gggagcgccc tgattacgtg agtgggtgta agcaggttgg
    50101 caacgacgcc gaccgggaca ccctcagcaa ttgccgctcg cagatcacta tctgccgaca
    50161 tcccagaatg gaaagaagcg cgccaaagga aggaagggga agcgaaagca ggcgcatcaa
    50221 actgcaggca ctgctgcttg tcgagggaca tccagaattc tccggtaggg agcccagcat
    50281 tcgtcgggcc taggcgtgca ttatcggtct ttaagaccta gctgtcaaca caataagtca
    50341 ctcctggtgg tcctcgatca gctgcccgcg tgccccctcg cccagcacgg cgccgacggc
    50401 cagctccggg gtcacgccca cctctctcct ggcgtacaac cgcttttcca tcgcctccaa
    50461 ccgtcggcgt cgacggccag ggtcactcct ggacgggatc gaggacgcgg atccgtgacc
    50521 gaatagggga gggtgacaaa ttgtcggggt agcgttccgc cccgtcgggg tagcgttccg
    50581 cgccgtcggg atagcgttcc gcctgcggcg gttcggcggc agcgccgcca ctgccggcac
    50641 gccggccggg ttgaacgcca ggggagggga gtggggtcac accaggtgcg cgagctcgac
    50701 atggccatgt gaccgccagc ggcccggccg ccagggtcac tcctggacgg catcgaggac
    50761 gcggatccgt gaccgaatag gggagggtga caaattgtcg gggtagcgtt ccgccccgtc
    50821 gggatagcgt tccgcctgca gctgcagccg gtcactcctg gacggccagc tgcagatccg
    50881 cgcgtaaccc ctgcagcggt cgcgccggct gggctggacg ccagggcaac ggacgctcca
    50941 acggcaggcc tggatatccg cgcgcgtttg tagtgattgc gggccgatag ccagcgggca
    51001 acaaaaaagc ccccggaggg gctttctgtg agcaacgctg actatcaatg ggacgaaccc
    51061 aggctatcac cgtaagcctc gcaactccgc gctgaaagca aagccccagg ccatgcctgg
    51121 ggctgtttgc tagatcggga acagacgcct tctgatagat agtgctgcca taaacgacaa
    51181 cggcagccaa atcaggaacc agctttcatt aggccgcgat agatagctgc taccctcgga
    51241 cattccggcg acaaggccat agacaagcat ggtggatgcc gccagatact cctcatcgcg
    51301 ccggtactcg atagccttcc aaaacgcgca ggcgtacatc agtccccaca aacccagccc
    51361 aaccgctcca agttccaaca agacggccag ctcgacgtta tgcgggtcac tcaacggcca
    51421 gcctggaacc acgttgaact gaaattcggc atggaaacca tgaccaacta gcgggtggtt
    51481 catcgctgtg ttgaacgcgg cctcccacaa ctgcgggcga taggacatac ctcgctccaa
    51541 cagcatttcc ggggacatca gcagtaccgc cgcacaggcg aagagaaggg ccaggacggc
    51601 caacagtccc cgctttccgg cgagagcagc aagccatatg ccgcacgcca ccagggctgc
    51661 aagcggagtc cgcgagccgg tagcgagcag gaccgcgagc agcgcgacac acgcaataac
    51721 ggagcgccag tttatccctg tggtatgtgc gacaaacatg gccatccagt acgcggtaaa
    51781 gaacccgaaa acgtgagagc tgagcagcgg atttcgcagc gcaccgaaac cgactaggcg
    51841 ctcaccaggt tgtgcggtcc acgcaaaatg cgcggcattc accaacgcga aggcaaccgc
    51901 aatccaggcg ctaacgcata gagcgagtcc tagacgctcc cgactattgc aggctattac
    51961 cgcgcagccg acgaacagca gcagaacata gagaggccgc ttaacaaggc cctgtggatc
    52021 gtctgcaggc gaccatagaa gcgatagcag tagccatgcg gagagggcta gaaacgcctg
    52081 aataatcggc tctcgaccga tgttcagtat caacctgggc gacaggcaga cagcgaacaa
    52141 cgcaggcgcc gcgaacagcc aatagaaaag cttcttgtag atgctgctgt tatccagcca
    52201 aaacaagccg gtgagcaata ccagataacc cacgggcagc cagtagcgag cgataagctc
    52261 gcgccactgg gtagcgggcg tccttgtggg agagatagcg gcagtcatac gcttcgctcg
    52321 cgggcatagg ataggaacgc ctcaatatcg tcagagcaaa ggaggtgggc gatctgacga
    52381 atctccttct catcccagca ccaccacttg gactgcagta gctgcgtccg ctgctcctcg
    52441 gtaaagcgcc atttgatatg gcgggccggg ttgccgccga caatcgaata gggcaatacg
    52501 tctcgggtga cgacggcacc actggcgact actgcgccat gccctacggt cacgccggat
    52561 aggatcacgg cgttagagca aatccacgca tcgctaccga tcacaacgtc gccatttgtg
    52621 ccgccgtagt ccttgacgtg cgcgacttcc tcgatcttcg ccgggaacgg gtactgacta
    52681 acccaatcgg tgcggtgatg gccacctaag aagacctgga cgttatcggc aatggacgta
    52741 taggcgccaa ttgtgagagt ggcgccttcg gcccaatcca tgacgctgag cgcaccataa
    52801 gtgcccgtgc ctatggtgta ggtcggaaac tggttgcgaa gccgggccgt ccctcgatgc
    52861 agctttggca gcgagcggag ggcgcggcgc tggcgtcttt cttccagcca gcttttcaac
    52921 gaagacagca cctgaacact ccttgaacta tgttggtttg gggcgcgtta tatcgcacac
    52981 gattcgtatc ccgataatca gggctctttt tgcaccactc tggcttcaga tacgctcaag
    53041 gcgtgttcct ggaaagcgcc cactgccgcc gcctcttgcc ggtccagttc agcttcttca
    53101 cccatcgctt cggctgccca caacttttgc tctgcatgac gctgagtagt gatactcatc
    53161 attccctggc tccttcagcc gatgatattg aactggcgtt gcgcgtcttc cgagccgatc
    53221 tgaagggtgt cccgcacgcg gctgacaggc tctcccttct tcaccccccc gaccagaccc
    53281 acaacccgat agaagccctc agatgtttcg atgaggcttt catctctccc gagaaagcct
    53341 cccttggaat gcgtcactgc gaccagtttc ccaaggctct gcggggcgtt ggccagcctc
    53401 tccgcttcgc gcagctgctc cttgtacgca gcccgcgagc ccgcctggag gatcgccact
    53461 ctctcttcga gaatggcccg tacagggacc gccagcgcta tccagagcat ccctcctacg
    53521 aagactctca acccttcaaa cagaccgctc agaggccccc catgcgacac cgaagcgtct
    53581 cccgactgcg tgagaggggc agttatcagg ctaaacagct caagcgggcc aaaggttatg
    53641 actccgaacc agtacagaat cgccatgacc acgagcgccg ccgaggccaa gaaggcgtag
    53701 ccccgaagaa ggttctcagc ttcagtgttc tccatcgcaa atctctcctt gctacttttt
    53761 gtccctggac agtacgcgcg gaaaacgctt cgccaggatc tcgttcagct gatctaccag
    53821 atccagccgc ttgaatgtga tgtgccccga gcccttcaga taccaacgga tatgcaaata
    53881 gtcgttctct gcagtattgc cctgctgctt gctgccactg atgagctgat aggtcccgtt
    53941 ccgatgatca ggctcaggct taccatccag gatcgacatc acgcgcatca gatcgtccag
    54001 ttcatcggtc tgccgatggt tggggtagcc gtgggaaaac aggtagtcca cgatgatccg
    54061 cttgccgaac ttgaacggct gattggtctt gtaacaccac gagagacggc ggaaaacgga
    54121 aattacaccg tcctcaaaca tgctctggcg ggcatcgtga agacgggcaa acgtcgcccc
    54181 gatgttttcc ttggtaagcg ccgggaactc cccatttgtg atggatttgt cccaggagtc
    54241 gcgggcttca gcgttcatca atgaccgcat accagactcg tgcatcaggt gctgccaccc
    54301 agccgcatcc aattcctttt cggctttggt gatcgcacca tcctccagaa tgttgatatg
    54361 gctgcggttg taccgccagc actcaaacat caccttgata gacccgaacc cggctttgct
    54421 cgccatcgcg tcggcttcca ccaacagtgc gcgggctttc agcattcgct ccagaacccc
    54481 tgcgcgctga ttcagcatcc cttcgatact gaccgacttt actacgtcac tcattccaga
    54541 attctccggt agggggcccg gctttcgtcg ggccttatgg ggtttatgca gcggaagtgg
    54601 cgtcggccag gatcttggca gcagcttcct gcacgctcat tcccatgctc caagccaact
    54661 gcatgcagag cggctgggcc tcaactacgc cctgagcgtc cgaatagctg gcatccagcg
    54721 cctcagcaat caaatcagtt acttcgccct cccaggccgc aaaattgcct gggctcggcg
    54781 cgtgggacac gaaggccact gccactacag ttcgctcctg gttacaggac accacacgag
    54841 ccagccgctc agtgtgatgc tctttctggc cggcctggac gtccacaaac tcaacatccc
    54901 aaccgcagat ggagcgatct tcaaaacccg cgttatcagt ggccgccgcg acgatgtact
    54961 ccatcgcgac tgacttggaa atgtgccccg aaagctgaac atcacgcaca tggacggggg
    55021 cgcagctggt ggcgatgggg gacggggtgg cttgagtgga cattccagaa ttctccggta
    55081 gggggcccag cgttcgtcgg gcctgcggga gtattatcgg tctttaagac ctagctgtca
    55141 acacaataag tcactcctgg tggtcctcga tcagctgccc gcgtgccccc tcgcccagca
    55201 cggcgccgac ggccagctcc ggggtcacgc ccacctccct cctggcgtac aaccgctttt
    55261 ccatcgcctc caaccgtcgg cgtcgacggc cagggtcact cctggacggg atcgaggacg
    55321 cggatccgtg accgaatagg ggagggtgac aaattgtcgg ggtagcgttc cgccccgtcg
    55381 ggatagcgtt ccgcctgcag ctgcagccgg tcactcctgg acggccagct gcagatccgc
    55441 gcgtaacccc tgaagcggtc acgccggcag ctccgcggac acgccccggg gtgacctgtc
    55501 gggatagcgt tccgccctcg gggttgcgtt ccgcctgcgg cggttcggcg gcagcgccgc
    55561 cactgccggc gcgccggcgg ggttgaacgc cgggggaggg cagggggtca caccaggtgc
    55621 gcgagctcga catggccatg tgaccgtaac cctgtccagt cagctcctgg atctcgttga
    55681 ccgaataggc acgtgtgcct atccttcaac aaataggcac acgtgcctat ccttcaacta
    55741 gcatcgagtt cagcctatga gttcatccat cgcccgtatt cacgtcaacg gcgttgaggt
    55801 cggttcaata ccggctgata cctatcacgc tatggtccag aacgtgcgcc gcaaccgccg
    55861 gctatacctt gcctggacga ttgctgcgac caaggcctgc ttgcggccag tggtcaggtt
    55921 ctactgcgcc ctgccttcga ttgtcgtcgg cgttctcctc cttgccgcag ctgcgtggcc
    55981 ggcggcattc acggcgctcg ttgccgatct tcaagccgca gatcctcaaa cgattactgc
    56041 tggcctgcgc cacgccttgg ctttcatctg tgccgtgttc atcgtgggct ttcctatcct
    56101 ggccctgatg aggcccggac tggtgcgatt tgaaagccct ttcgacaagg ccctgagccg
    56161 tcagattcgg aggctgctgg aggtgcctac tgaggggacg atgagggttg agatcatcga
    56221 acggtaatgc gctgatggat aaccgcgttc gctaccagaa gctgctaacc gatcacggat
    56281 tgacccaagc cgacagcgcc gccttgatct gcgagtacac ccagcgacca tgctctgtcc
    56341 gtactgtccg ctcctggctc aacgaccccg acaagcccag ctctcgtagc tgtcccgatt
    56401 gggccgtcaa cgcattggag aaggctctga tcgctcgctc tgcaggtgag cattcgtagg
    56461 cagcactgcc ctcgaccacg ggtcactcct ggacgggatc gaggacgttg atccgtgacc
    56521 gacaggcaac aaaaagcccc cgagggggct ttgatggact caagcgtcag ccttgccgga
    56581 gcttccggct tcggtaagcc ttcgtgcagt aatgaatctc cgtcaggctc agatccatca
    56641 cttgcgtccc tctgtatttc gttttggttt taccggcagc ctttcgacat tcccggactg
    56701 ctcgatctgc agttgtgcct gcaggtagtc gatcaactgg ccattgtttc gagctgcttc
    56761 agcctgccgg gcctcgacct tggcgaacac ctcctggacg aaatccgggg cgctgtccca
    56821 gctcctgtag accatctcat cccggagctg ctgcaaaaca tcgtggcgta gcaagttgaa
    56881 taccccttgc acgctataac cgcctgctgt ttgccgcgca atatcttgct tcagacgctc
    56941 gccaaactct tcggccgtcc ggcgctcgaa aaccacgcgg taggactgca acgcgagcgt
    57001 gagggtcacc agctcgatgc actgctgcgg ctgatcgaag cccttcggca gtcgctcgtc
    57061 cagggccttg tgcatggcct tttccttctc ggcacgttcg cgggcctgct gctcctcgcg
    57121 gcgcgccttg atctctttcg catgttcaac gcgctgactg acgctgcgca ccagggcgac
    57181 agtctgctgc agggatgcca gttcctccgg ggagaacaag gcactcattg ggccggatgc
    57241 gagctttgcc agctgattgc cggcggtggt cagcttgcgc tgctccgcgc gcaggtcgtc
    57301 ggcgcgatag acccgcagca ggtccatcag tttttcgctg tccaggttca gaagcggatt
    57361 cttccgtgat gccatttcag gacctcccgc tagatgggtt ggtagagggc tcgctgccac
    57421 tcagttcgac ggtaaacgcg gtgatgccca gctcgtttgc gtagcgttcc agggtgtcga
    57481 gtctcgccca gacgcggatt ggttcacgct tggagcggac gggcagccag taggcgcctt
    57541 ggcgaacggc gagcgtccag ccgtcgcgct gcgcaccggg aaactggcgg gccggtcgta
    57601 ccaggaagtc ccgcgcagtg ccgctcttga tcagcagttc cagggcctcg ggataaatgg
    57661 cttctcgcat gggctcagaa cttcgcggcg tcactggccg aacggtttgc tacatccgcc
    57721 ttcgctgcag aggccggcgc cggatcctgg gcgtcctgga cgcagccgga caggccgaac
    57781 atcagggtcg ccgcgaacag ccaggggagg ggggtcttcc aagtcatggc ggatctccat
    57841 ttcagagtga gtggcaggtg ctgccggaaa tgctcattta ccatttttag cataagtggg
    57901 cacccatttt tgtgcaaagt ggttttcgct gccgaaagga aagggccaca ctgggccctt
    57961 tgctgggggg gtccgtttaa ccattgtccc gttatgcgaa ggcgggcgtt acgccaggac
    58021 ggcgcgggcc ttgtcgcgcg cctcggtggc ggtgccgccg gccttctcgg cgaagcgctc
    58081 cagaatcggc agggccaggc ccagcgcctc gcgtgcctcg gtcaactggc cggccaggtc
    58141 ggcgactatc tcgctcgggc agtcggccgg gtgccagccc ggcggcgcgt gctgcgcgat
    58201 ggcctgcatc agggcgcggc caactgcggc catgtcttcg tcggtgtatt cggtcatggg
    58261 gcgggttcct ttcagtggtt agcagggcca tccgccaagg tcgcgccgat ctcccggtgg
    58321 gaggcattca gctcggcaga cagctcggtg aaagtcgagc tgtcaatcag cccctctagg
    58381 cgtagcgccg acagccagcc cgaggcgacc gcatattgat aggttaggtc gccctggtgg
    58441 cgggcatccg aaagctgggc gatcttcttg cgcgcgttgg ccagggtttg cggtttgttc
    58501 agttcgatgc tcataggggc ggattcgttc gcgcgcttgt acgcaaccca agcatccgcc
    58561 accacgccgg tatcaccggc aatagccatc cagcggcggc gctcgtcgac atcaagtgcg
    58621 ttccaccatt cgataccggc ctcttcgtcc tttgtccggg ggcgccccca atcttcgccc
    58681 tgagcagggt ttggcacagg agcggcgcca aggtccgcta atcgcttatc gcggcgcgcc
    58741 attgccgtcg attgcaggct gttggcgttg tggaccgata gatgcccctc atcctgcaat
    58801 ccgtccaggt agccataagc gtaggcggtg cgggtgcgcg cctctgtggc atcagacgcc
    58861 tcggtaatca gcttcagggc ggtcatcagt ctcgcttggc gttgtgcatc attcatgaag
    58921 caggttcctt tactcgcaag gtgccgatct gcggcgccga tcagttgatt gtttggccca
    58981 tcatcagcat ccagcgtctg tgacggacgt cacaaaacga cgatatatcg aaggaatttc
    59041 gatgccagat cacgaaatcc ttttggaatt cttcgcctta ccggagcgac cgttaacgga
    59101 agtcttcacc atgtcaaagt tggccatctg tgcgctctga acaatatcaa aatgcctcca
    59161 tataaccggc actcgcgata gccttctata tatagagtgg aactccaggg ccacttggtt
    59221 gacgccgcca ttttgacatc ataggctagg gcttacttcc tccgcaccaa atccaacaat
    59281 aggccgcacc tgtgaactaa tactggcatt tcgcctgtat ctaacagtga agcgctcagc
    59341 ctgcgaagca tcggcattaa tgcgcgcagc tataacacgc aattcgctca gtttggccgc
    59401 cgaaggggag gggaaggccg cgagccaatc acgaacaaac tcgtctacca ggggatcctt
    59461 catcgctgtc agttgaacaa gtagctcgtc ctgctgctca ttcctggagc gctgggaata
    59521 ctcctccccg ccagtttcgg cggggaaaag ttccatcacg aatattgcga tcatcagcag
    59581 caagagccac cgcatggctt acccctccag ctcagtccgg aggatggtca agccacggtg
    59641 agctgacacg cggaggcgtg ccgaaccgtc gtagacctcg ctcagttcca caacgatccc
    59701 atccgacagc agactggcca gcacctcctc ggcgctgccc aggtcggtgt ccttcaggct
    59761 aatacggatc gactgccccg ctttacgccc cagtacgaga ttgccatttc ggtcc
//