LOCUS       AP014862             6183134 bp    DNA     circular BCT 23-MAY-2018
DEFINITION  Pseudomonas furukawaii DNA, complete genome.
ACCESSION   AP014862
VERSION     AP014862.1
DBLINK      BioProject:PRJDB3360
            BioSample:SAMD00023458
KEYWORDS    .
SOURCE      Pseudomonas furukawaii
  ORGANISM  Pseudomonas furukawaii
            Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales;
            Pseudomonadaceae; Pseudomonas; Pseudomonas
            oleovorans/pseudoalcaligenes group.
REFERENCE   1  (bases 1 to 6183134)
  AUTHORS   Kimura,N. and Suenaga,H.
  TITLE     Direct Submission
  JOURNAL   Submitted (15-MAY-2015) to the DDBJ/EMBL/GenBank databases.
            Contact:Nobutada Kimura
            National Institute of Advanced Industrial Science and Technology,
            Bioproduction Research Institute; Higashi 1-1-1, Tsukuba, Ibaraki
            305-8566, Japan
REFERENCE   2
  AUTHORS   Kimura,N., Watanabe,T., Suenaga,H., Fujihara,H., Futagami,T.,
            Goto,M., Hanada,S. and Hirose,J.
  TITLE     Pseudomonas furukawaii sp. nov., a polychlorinated
            biphenyl-degrading bacterium isolated from biphenyl-contaminated
            soil in Japan
  JOURNAL   Int. J. Syst. Evol. Microbiol. 68, 1429-1435 (2018)
  REMARK    DOI:10.1099/ijsem.0.002670
COMMENT     Please visit our web page
            URL:http://www.ddbj.nig.ac.jp/
            The genome sequencing of strain KF707 was supported by National
            Institute of Technology and Evaluation in Japan
            Strain KF707 (=NBRC 110670) is available from NBRC culture
            collection (http://www.nbrc.nite.go.jp/e/).
            
            ##Genome-Assembly-Data-START##
            Assembly Method       :: Newbler v. 2.6
            Genome Coverage       :: 124x
            Sequencing Technology :: 454 GS FLX; Hiseq1000; Miseq
            ##Genome-Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..6183134
                     /db_xref="taxon:1149133"
                     /mol_type="genomic DNA"
                     /organism="Pseudomonas furukawaii"
                     /strain="KF707"
     CDS             533..1987
                     /codon_start=1
                     /gene="dnaA"
                     /locus_tag="KF707C_10"
                     /product="chromosomal replication initiator protein DnaA"
                     /protein_id="BAU71689.1"
                     /transl_table=11
                     /translation="MELWQQCVELLRDELPAQQFNTWIRPLQVEADGDELRVYAPNRF
                     VLDWVNEKYMGRLLELLGERGNGLAPALSLLIGSKRSPAPRKAPPPPPPVMAPPPVAP
                     APSQLRVETVEEHRDNLDPLASVVPAPVVRTERSVQVEGALKHTSYLNRTFTFENFVE
                     GKSNQLARAAAWQVADNPKHGYNPLFLYGGVGLGKTHLMHAVGNHLLKKNPNAKVVYL
                     HSERFVADMVKALQLNAINEFKRFYRSVDALLIDDIQFFARKERSQEEFFHTFNALLE
                     GGQQVILTSDRYPKEIEGLEERLKSRFGWGLTVAVEPPELETRVAILMKKAEQAKVDL
                     PHDAAFFIAQRIRSNVRELEGALKRVIAHAHFMGREITIELIRESLKDLLALQDKLVS
                     IDNIQRTVVEYYKIKMSDMLSKRRSRSVARPRQVAMALSKELTNHSLPEIGDAFGGRD
                     HTTVLHACRKIAQLRESDADIREDYKNLLRTLTT"
     CDS             2017..3120
                     /codon_start=1
                     /EC_number="2.7.7.7"
                     /locus_tag="KF707C_20"
                     /product="DNA polymerase III beta subunit"
                     /protein_id="BAU71690.1"
                     /transl_table=11
                     /translation="MHFTIQREALLKPLQLVAGVVERRQTLPVLSNVLLVVEGQQLSL
                     TGTDLEVELVGRVALEEPAEPGEITVPARKLMDICKSLPSDALIDIRVDEQKLLIKAG
                     RSKFTLSTLPANDFPTVEEGPGSLNFSLVQSKLRRLIERTSFAMAQQDVRYYLNGMLL
                     EVNGGVLRAVSTDGHRLAMCSMQTGIEGLDRHQVIVPRKGILELARLLTEQDGEVRIV
                     LGQHHIRATTGEFTFTSKLVDGKFPDYERVLPRGGDKLVVGDRQVLREAFSRTAILSN
                     EKYRGIRLTLASGQLKIQANNPEQEEAEEEVAVDYNGGNLEIGFNVSYLLDVLGVMST
                     EQVRLILSDANSSALLQEADNDDSSYVVMPMRL"
     CDS             3128..4234
                     /codon_start=1
                     /gene="recF"
                     /locus_tag="KF707C_30"
                     /product="DNA recombination and repair protein RecF"
                     /protein_id="BAU71691.1"
                     /transl_table=11
                     /translation="MSLSRISVTGVRNLQPVTLSPSPRINILYGANGSGKTSLLEAIH
                     LLGLARSFRSTRLQPVIQYEQPACTVFGQIGLMEGGYSNLGISRDRQGEFQIRIDGQN
                     AKSTAQLAEVLPLQLINPDSFRLLEGAPKIRRQFLDWGVFHVEPRFLPAWQRLQKALR
                     QRNSWLRHGTLDAASQAAWDRELCLASDEIDQYRRAYIQALKPVFERTLADLVELDSL
                     SLSYYRGWDKDRELSEVLATSLLRDQQLGHTQAGPQRADLRLRSGAHNAADILSRGQQ
                     KLVVCALRIAQGHLVNQAKRGQCIYLVDDLPSELDEQHRQALCRLLEDLDCQVFITCV
                     DHEFLRDGWRTDTPVAMFHVEHGCISPTIIGSEA"
     CDS             4231..6651
                     /codon_start=1
                     /EC_number="5.99.1.3"
                     /locus_tag="KF707C_40"
                     /product="DNA gyrase subunit B"
                     /protein_id="BAU71692.1"
                     /transl_table=11
                     /translation="MSENNTYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFE
                     VVDNSIDEALAGYCSEISITIHTDESITVRDNGRGIPVDIHKEEGVSAAEVIMTVLHA
                     GGKFDDNTYKVSGGLHGVGVSVVNALSEELRLTIRRAGQVWEQIYRHGVPQFPLRAVG
                     ETDGTGTEVHFKASAETFTNIHFSWDILAKRLRELSFLNSGVGILLRDERSGKEEMFK
                     YEGGLKAFVEYLNTNKTIVNEVFHFNIQREEDGVGVEVALQWNDSFNENILCFTNNIP
                     QRDGGTHLAGFRSALTRHLNNYIEQEGLAKKYKIATTGDDAREGLTAIISVKVPDPKF
                     SSQTKDKLVSSEVKTAVEQEMGKYFADFLLENPNEAKAVVGKMIDAARAREAARKARE
                     MTRRKGALDIAGLPGKLADCQEKDPALSELYIVEGDSAGGSAKQGRNRKTQAILPLKG
                     KILNVEKARFDKMLSSQEVGTLITALGCGIGREEYNIEKLRYHNIIIMTDADVDGSHI
                     RTLLLTFFFRQMPELIERGYVYIAQPPLYKVKKGKQEQYIKDDEAMDEYMTQSALEDA
                     SLHVNENAPGLSGEALERLVNDYRNVMRILKRLSRLYPQELTEHMIYLPRVKEEELAD
                     KALMESWLEGFQVRLKAAEKSGLTYSASLREDRERHLWLPEVEQTAHGLSHYITFNRD
                     FFASNDYRQVTELGGQLNSLLEEGAYVQRGERKKPVNSFKDALNWLMTESTKRHTIQR
                     YKGLGEMNPEQLWETTMDPNVRRMLKVTIEDAIAADQIFNTLMGDAVEPRRDFIESNA
                     LAVSNLDV"
     CDS             6910..7044
                     /codon_start=1
                     /locus_tag="KF707C_50"
                     /product="hypothetical protein"
                     /protein_id="BAU71693.1"
                     /transl_table=11
                     /translation="MGIAPMILRASGRLPPASVSVTLGNQTYRIKPELPDPLVNTRIR
                     "
     CDS             8132..8323
                     /codon_start=1
                     /locus_tag="KF707C_60"
                     /product="hypothetical protein"
                     /protein_id="BAU71694.1"
                     /transl_table=11
                     /translation="MSDEKPQSSTSDEEISDYMIRQLRSGRVKPAVLVVLTEKNFPDV
                     DRERIIRCFNALDSGYLKG"
     CDS             complement(8440..9213)
                     /codon_start=1
                     /EC_number="2.3.1.51"
                     /locus_tag="KF707C_70"
                     /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
                     /protein_id="BAU71695.1"
                     /transl_table=11
                     /translation="MQAIRTFLFYLLLSLSAFIWGTLSLFFAPFMPFRARYNFVVRSW
                     CRFAVWLTQAVVGVRYEVQGLENVPQQPCVILAKHQSTWETFYLSGAFEPLSQVVKRE
                     LLRVPFFGWAMALMKPIAIDRSNPKAALKQLAAQGDERLKQGAWVLIFPEGTRVPVGQ
                     MGKFSRGGAALAVNAGLPVLPVAHNAGHYWPKEGWAKHPGTIQVVFGPVMYAEGEGPR
                     AIAELNDRAFAWVEATQLEIEGDRPGVSTEAVSHSVDKL"
     CDS             complement(9237..9767)
                     /codon_start=1
                     /EC_number="3.1.3.15"
                     /locus_tag="KF707C_80"
                     /product="histidinol-phosphatase"
                     /protein_id="BAU71696.1"
                     /transl_table=11
                     /translation="MKLLILDRDGVINEDSDAYIKCLEEWIPIPGAIAAIARLSRAGW
                     TVAVATNQSGIARGYYDLATLDAMHARLREMVEEQGGELGIIQYCPHGPDEGCDCRKP
                     RPGMLRRIAEHYGVELAGVWFVGDSSGDLDAALAVDCQPVLVKTGKGERTLAKALPAS
                     TLVFDDLAAVAAHLLQ"
     CDS             complement(9853..11898)
                     /codon_start=1
                     /EC_number="6.1.1.14"
                     /locus_tag="KF707C_90"
                     /product="glycyl-tRNA synthetase beta chain"
                     /protein_id="BAU71697.1"
                     /transl_table=11
                     /translation="MSAQDFLVELGTEELPPKALKSLGDAFLSGIEQGLKAAGLGYAK
                     AQVFAAPRRLAVLVEQLATQQPDRTVNLDGPPVQAAFDAEGKPTQAALGFARKCGVDL
                     ELIDRSGPKLKFSQSIPGQPAAGLLPGIVETSLAALPIPKRMRWAARREEFVRPTQWL
                     VMLFGEEVVDCEILTRKAGRESRGHRFHNPDNIRISKPSTYLEDLRSAHVLADFAERR
                     EIIAKRVAELAAEQKGTAVVPADLLDEVTALVEWPVPLVCAFEERFLEVPQEALIATM
                     QDNQKYFCLLDANGKLLPRFITVANVESKDPAQIISGNEKVVRPRLTDAEFFFKQDKK
                     QKLETFNERLKNVVFQAQLGTVYEKAERVSRLAGFVATQIGADAARAERAGILAKCDL
                     ATEMVGEFPEMQGIAGYYYAKNDGEADDVALALNEQYMPRGAGAELPQTLTGAALAIA
                     DKLDTLVGIFGIGMLPTGSKDPFALRRQALGVLRILIEKQLNLDLAAAVAFAVELFGA
                     KVKADGLASQVLDFIFDRLRARYEDEGVDVAVYLAVRAVQPVSALDFDLRVQAVQAFR
                     ALAGAEALAAANKRVSNLLGKAEGQVPANVDGALLQEPAEQALARAVAAAETAVAAGG
                     SYRETLERLAALREPVDAFFDSVLVNAEDAAVRGNRYALLAKLRGLFLGVADISALG"
     CDS             complement(11895..12842)
                     /codon_start=1
                     /EC_number="6.1.1.14"
                     /locus_tag="KF707C_100"
                     /product="glycyl-tRNA synthetase alpha chain"
                     /protein_id="BAU71698.1"
                     /transl_table=11
                     /translation="MSQTTPAVRTFQDLILALQQYWAEQGCVVLQPYDMEVGAGTFHT
                     ATFLRAIGPETWNAAYVQPSRRPTDGRYGENPNRLQHYYQFQVVLKPNPENFQELYLG
                     SLKAIGIDPLVHDIRFVEDNWESPTLGAWGLGWEIWLNGMEVTQFTYFQQVGGIECYP
                     VTGEITYGLERLAMYLQGVDSVYDLIWTDGPFGTVTYGDVFHQNEVEQSTFNFEHANV
                     PKLFELFDFYESEANRLIELQLPLPTYEMVLKASHTFNLLDARRAISVTERQRYILRV
                     RTLARAVAQSYLQARARLGFPMATPELRDEVLAKLEAQE"
     CDS             13074..13625
                     /codon_start=1
                     /EC_number="3.2.2.20"
                     /locus_tag="KF707C_110"
                     /product="DNA-3-methyladenine glycosylase"
                     /protein_id="BAU71699.1"
                     /transl_table=11
                     /translation="MTRCFWCNDDPLYIDYHDTEWGVPLRDAGALFELLLLEGFQAGL
                     SWITVLRKRERYREVLFGFDPKRLAVMSDEEIEQRMQDPGIIRNLAKLRAARQNAQAW
                     LRQEDPVALLWSFVGGVPKINHFNGRGEVPAITPEAEAMSKSLKKAGFTFVGPTICYA
                     FMQASGMVMDHTTDCYRYRELVG"
     CDS             13682..14569
                     /codon_start=1
                     /EC_number="2.3.1.-"
                     /locus_tag="KF707C_120"
                     /product="lipid A biosynthesis lauroyl acyltransferase"
                     /protein_id="BAU71700.1"
                     /transl_table=11
                     /translation="MDKLKGALVVGFLRLFALLPWRAVQAVGATIGWLMWKLPNRSRE
                     VVRINLSKCFPELSPAELEERVGRSLMDIGRTFTESACAWIWPAEKSIALVREVEGLD
                     VLHEALASGKGVVGITSHLGNWEVLNHFYCDQCKPIIFYRPPKLKAVDELLQKQRVQL
                     GNRVAPSTKEGILSVIKEVRKGGAVGIPADPEPSLSAGVFVPFLGTQALTSKFVPGML
                     AGGKARGVFLHALRLPDGSGFKVILEAAPDGMYSENVEEGVAAMSAVVEKYVRAYPTQ
                     YMWSMKRFKKRPEGEKKWY"
     CDS             14711..14944
                     /codon_start=1
                     /locus_tag="KF707C_130"
                     /note="FIG00954045"
                     /product="hypothetical protein"
                     /protein_id="BAU71701.1"
                     /transl_table=11
                     /translation="MKCRIKISHPSFGDLIAQTRDLSDGGVYVRHPDLAALSVGSIVS
                     GQVQDLPIEAPILQMEVMRVDAEGAGFRFIERD"
     CDS             complement(15036..15359)
                     /codon_start=1
                     /locus_tag="KF707C_140"
                     /note="Yop proteins translocation protein Y"
                     /product="chaperone protein YscY"
                     /protein_id="BAU71702.1"
                     /transl_table=11
                     /translation="MLEGLEKMLAKGVDNPLLRFGLGKGYLDQGDTATAAMHLRRCVE
                     QDPKYSAAWKLLGKALEAQGDLGAARDAWTEGLAAARAHGDKQAEKEMTVFLKRLEKR
                     GSSPA"
     CDS             complement(15372..16745)
                     /codon_start=1
                     /locus_tag="KF707C_150"
                     /product="Trk system potassium uptake protein TrkA"
                     /protein_id="BAU71703.1"
                     /transl_table=11
                     /translation="MKIIILGAGQVGGTLAEHLSGEANDITVVDTDGDRLRDLGDRLD
                     IRTVQGRGSFPTVLRQAGADDADMLVAVTNSDEVNMVACQVAYTLFSTPTKIARVREA
                     AYLTRAGLFDNEAIPVDVLISPEQVVTNYIKRLIEYPGALQVIDFAEGKAQLVGVKAY
                     YGGPLVGQELRQIREHMPNVDTRVAAIFRRNRPILPKGDTVIEADDEVFFIAAKAHIR
                     AVMSELRRLEDSYKRVVIAGGGHIGERLAEAIESRYQVKIIEMNPARCRHLSEVLDST
                     IVLQGSASDRDLLVEENISDADIFLSLTNDDEANIMSSLLAKRLGARKVMTLINNPAY
                     VDLVQGGDIDIAISPQLATIGTLLTHVRRGDIVSVHSLRRGAAEAIEAIAHGDAKSSK
                     VVGKRIEDIALPPGTTIGAIIRDEEVLIAHDDTVIESGDHVILFLVDKKYIRDAERLF
                     QVGLTFF"
     CDS             complement(16757..18070)
                     /codon_start=1
                     /EC_number="2.1.1.-"
                     /locus_tag="KF707C_160"
                     /product="ribosomal RNA small subunit methyltransferase B"
                     /protein_id="BAU71704.1"
                     /transl_table=11
                     /translation="MNPRLAAARALAAVLNGKASLGGSLPPLLDKVEPRDRALAQDLA
                     FGTARWQPRLSALAERLLQKPFKATDKDVEALLLVGLYQLFHTRIPAHAALGETVGCV
                     DKLKKPWAKGLLNAVLRNAQRQGASILDELARDPMVRTAHPRWLQKALKAAWPEHWEA
                     ICAANNAHPPLILRVNRRHGSRDAYLDELAAAGIAAEACRYSRDGIRLVEARDVKTLP
                     GFAEGRVSVQDEAAQLAADLLELAPGQRVLDACCAPGGKTCHLLEAEPGLAEVVAVDL
                     EESRLVRVRENLQRLGLDARLIAADGRDTASWWDGKPFQRILLDAPCSATGVIRRHPD
                     IKLTRQEADIAALAQLQGELLDALWPTLDVGGVLLYATCSTLPRENSENIAAFLARTP
                     GARELDIPGPYGLKQPHGRQLLAQEDGHDGFYYAKLIKIAASVRG"
     CDS             complement(18067..19011)
                     /codon_start=1
                     /EC_number="2.1.2.9"
                     /locus_tag="KF707C_170"
                     /product="methionyl-tRNA formyltransferase"
                     /protein_id="BAU71705.1"
                     /transl_table=11
                     /translation="MTEPLRLIFAGTPEFAAEHLKALLGSRHQVIAVYTQPDRPAGRG
                     QKLMPSPVKQLAVEHGIPVLQPPTLRDAAAQDELRALGADLMVVVAYGLILPQAVLDT
                     PRLGCINSHASLLPRWRGAAPIQRAVQAGDAESGVTVMQMEAGLDTGPMLLKVSTPIS
                     DSDTGGSLHDRLAQLGPRAVLEAIEGLAAGTLVGEVQDDALANYAHKLNKDEARLDWS
                     RPAAELERLVRAFNPWPICHTLLDGQPLKVLAAAPGEGRGQPGQVLAASKDGLTVACG
                     DGALCLTRLQLPGGKPLGFADLYNSRREQFAVGKVLGA"
     CDS             complement(19068..19574)
                     /codon_start=1
                     /EC_number="3.5.1.88"
                     /locus_tag="KF707C_180"
                     /product="peptide deformylase"
                     /protein_id="BAU71706.1"
                     /transl_table=11
                     /translation="MAILNILEFPDPRLRTIAKPVDVVDDSIRTLIDDMFETMYAAPG
                     IGLAATQVNVHKRVVVMDLSEDKSEPRVFINPEFEPLTEEMDQYQEGCLSVPGFYENV
                     DRPQKVKIKALDRDGQPYELIAEGLLAVCIQHECDHLNGKLFVDYLSSLKRDRIKKKL
                     EKQHRLQA"
     CDS             19716..20741
                     /codon_start=1
                     /locus_tag="KF707C_190"
                     /note="COG1652"
                     /product="uncharacterized protein with LysM domain"
                     /protein_id="BAU71707.1"
                     /transl_table=11
                     /translation="MRKSLLALLLLAASGLTQAAVELKEGHPERYTVVRGDTLWDISG
                     KFLRQPWKWPEIWHANPQIENPHLIYPGDVLSLVYVDGQPRLMLNRGDSRGTIKLSPK
                     VRSTPMAEAIPTIPLEAINAFLLTNRIVDDPKEFEAAPYIVAGNAERVVSGAGDRVYA
                     RGNFSQEQPAYGIFRQGKTYIDPETKEFLGINADDIGGGEMVADEGDIGTLQLTRSTQ
                     EVRLGDRLFPTEERAINSTFMPSAPARDVSGVILDVPRGVTQIGQFDVVTINKGKRDG
                     LVEGNVLAVYKTGETVRDRVTDEFIKIPDERAGLLMVFRTYDKLSYGLVLAATRQLAV
                     LDKVHNP"
     CDS             20825..21919
                     /codon_start=1
                     /locus_tag="KF707C_200"
                     /product="Rossmann fold nucleotide-binding protein Smf
                     possibly involved in DNA uptake"
                     /protein_id="BAU71708.1"
                     /transl_table=11
                     /translation="MTALSPAELEARLRLHHLPELGAARFRRLMDAFGSASAALSAPA
                     SAWRALGLPACSAEPRRSPEIREAAARALAWLESPGHHLLCWDHPSYPALLAELNNAP
                     PLLYVAGEPALLERPQLALVGSRRASAPGLDTARAFARSLAGGGFVITSGLALGIDGA
                     AHRGALDVSGATVAVLGTGLQRLYPNRHRGLAREILDAGGALVSELPLDCPPQPGNFP
                     RRNRIISGLSLGVLVVEASPSSGSLITARLAAEQGREVYAIPGSIHHPGARGCHQLIR
                     EGAALVERVEDILDTLRGWQALPPAEEHSSPAAEAHPLLALLRAAPHTSEGLAAASGW
                     ALPRVLAELTDLELQGRVAREAGGWVHRVG"
     CDS             21961..22515
                     /codon_start=1
                     /locus_tag="KF707C_210"
                     /note="required for threonylcarbamoyladenosine (t(6)A)
                     formation in tRNA"
                     /product="YrdC/Sua5 family protein"
                     /protein_id="BAU71709.1"
                     /transl_table=11
                     /translation="MVSKWRVQQVARVVREGGVIAYPTEAVWGLGCDPWNEEAVYRLL
                     ALKERPVEKGLILVADDIQQFDFLLEGLPGAWIDQLLASWPGPNTWLVPHQDLLPEWV
                     TGQHDSVALRVSAHPLVRELCALTGPLISTSANPSGRPAACSRLRVQQYFGDDLDAVL
                     GGALGGRRNPSVIRDLVSGRVIRG"
     CDS             complement(22505..23482)
                     /codon_start=1
                     /EC_number="1.6.5.5"
                     /locus_tag="KF707C_220"
                     /product="quinone oxidoreductase"
                     /protein_id="BAU71710.1"
                     /transl_table=11
                     /translation="MAKRIQFSAYGGPEVLEYADYQPTTPGPREVRVRNRAIGLNFID
                     TYYRSGLYPAPDFPTSLGTEGAGEVEAVGDEVTQFKVGDRVAYATGPLGAYSEFHVLP
                     ADKLIHLPDSIGFEQAAAVMLKGLTVQYLLRQTYELKGGETILFHAAAGGVGLIACQW
                     ARALGVKLIGTVGSPEKAELARANGAWATIDYNRENVAQRVLELTDGAKCPVVYDSVG
                     KDTWETSLDCVAPRGLLVSFGNASGPVTGVNLGILAQKGSLFVTRPTLFGYASTPERL
                     QAMANELFGLIAEGRIQVEIKQRFALADAAKAHSALASRQTTGSTVLIP"
     CDS             23613..24533
                     /codon_start=1
                     /EC_number="1.3.3.3"
                     /locus_tag="KF707C_230"
                     /product="coproporphyrinogen III oxidase, aerobic"
                     /protein_id="BAU71711.1"
                     /transl_table=11
                     /translation="MTDRIEAVKAYLLDLQDRICAALAAEDGKADFFEDAWDRPAGGG
                     GRTRVIENGALIEKGGVNFSHVFGNSLPPSASAHRPELAGRGFQAMGVSLVIHPENPH
                     VPTSHANVRFFIAEKEGEEAVWWFGGGFDLTPYYGNEEDCVHWHQVARDACAPFGADV
                     YPRYKEWCDRYFHLKHRNEPRGIGGLFFDDLNQWDFDTSFAFLRAIGDAYLEAYLPII
                     RRRRDTPFTERQREFQAYRRGRYVEFNLVFDRGTLFGLQSGGRTESILMSLPPQVRWG
                     YDWKPEPGSEEARLTEYFLQDRNWLGEAGR"
     CDS             24533..25357
                     /codon_start=1
                     /EC_number="1.1.1.25"
                     /locus_tag="KF707C_240"
                     /product="shikimate 5-dehydrogenase I alpha"
                     /protein_id="BAU71712.1"
                     /transl_table=11
                     /translation="MDRYCVFGNPIGHSKSPLIHRLFAEQTGQALTYDAVLAPLDDFP
                     GCARAFFATGRGGNVTVPFKEQAFELADQLSARAERAGAVNTLKKLDDGRLLGDNTDG
                     AGLVRDLTRNAGLALAGKRILLLGAGGAARGVIEPLLAEKPAALVIANRTLEKAENLA
                     RLFAELGPVSASGFDWLEEPVDLIVNGTSASLAGDLPPISPRLIQPGHTFCYDMMYGK
                     EPTAFNRWAASHGAARTLDGLGMLVEQAAEAFLLWRGVLPDSAPVLAELRRQLAEG"
     CDS             complement(25406..26335)
                     /codon_start=1
                     /locus_tag="KF707C_250"
                     /note="TC 3.A.1.12.1"
                     /product="L-proline glycine betaine binding ABC
                     transporter protein ProX"
                     /protein_id="BAU71713.1"
                     /transl_table=11
                     /translation="MKTINAALASALLLTTTLTLNAQAEDASCATVKLGDPGWSDIAV
                     TNGVARILLNGLGYRTETPTLAVPIIFAGLHKGQIDAFLGNWMPAQQSNYDKFVAAGS
                     VDKVTQNLAGTEYTLAVPRYAYDAGVKTFADLDRHADKFKHTLYGIAAGSPANVSIQQ
                     MIQSDEFGLGDWKLVESSEQAMLVQVGRAVKRKDFVVFLGWTPHPMNVQYDMVYLKGG
                     EKYFGESGSVNTLARKGYAQQCPNVGRLLANLQFTQEMENSIMDQVLNGNTSNDAAVK
                     AWLKANPATLEGWLQGVNTRDGGDALAAVKARL"
     CDS             complement(26443..27948)
                     /codon_start=1
                     /EC_number="3.1.6.6"
                     /locus_tag="KF707C_260"
                     /product="choline-sulfatase"
                     /protein_id="BAU71714.1"
                     /transl_table=11
                     /translation="MKAPNILFIMADQMAAPMLPFYAPSPLKVPNLARLAAEGVVFES
                     AYCNSPLCAPSRFTLVSGQLPSKIGAYDNAADFPADVPTYAHYLRRLGYRTALSGKMH
                     FCGPDQLHGYEERLTSDIYPADYGWAVNWDEPDVRPSWYHNMSSVLQAGPSVRTNQLD
                     FDEEVVFKARQYLYDHVRQSADQPFCLTVSLTHPHDPYTIPEEYWSRHDEAEIPLPRV
                     RFADTEQDPHSQRLLKVIDLWGKPLPEAKVRDARRAYFGACSYVDDQVGALLKTLADC
                     GLAEDTIVVFSGDHGDMLGERGLWYKMHWFEMAARVPLLVHAPSRFAAARVRASVSTV
                     DLLPTLVELAGGTLDARLPLDGRSLLPHLEGREGHDEVLGEYMAEGTTSPLMMIRRGP
                     WKFIYSEEDPCLLFDLANDPQELENLAGSADHQALLAAFLEEARARWDVAAIAEETLA
                     SQRRRRFVAGALSRGKLASWDHQPFADASQQYMRNHIDLDDLERRARFPQP"
     CDS             28060..29013
                     /codon_start=1
                     /locus_tag="KF707C_270"
                     /note="LysR family"
                     /product="transcriptional regulator"
                     /protein_id="BAU71715.1"
                     /transl_table=11
                     /translation="MAEFLPDLSLDLLRVFESAARHLSFTAAAVELGTTQPAVSQQIQ
                     RLEKQLATRLFDRVYRGIELTDAGRLLFLHVQEGLEAIATGLEAIGSRTQHEVLQVAT
                     DFAFAAYWLMPRLHRFHEANPDIDVSIVTSDRTMNMLRSEVDIAIAFGDGRFKHGDAL
                     LLFREEVFPIASPRLLAGQALPLAAGALLDLPLLHLKPEVRTRWFDWATLFRELGITQ
                     APGAGMLRFDNYTLLIQAAIAGQGVAIGWRYLVDDLLEQGLLVRLLDGSVTSDFGYYL
                     VQPERKRRARLMKCFVDWLQQELGDEARQPQLIRHREGIAL"
     CDS             29010..29378
                     /codon_start=1
                     /locus_tag="KF707C_280"
                     /product="aromatic ring-cleaving dioxygenase"
                     /protein_id="BAU71716.1"
                     /transl_table=11
                     /translation="MIQTPAPRIKGFHAHVYFDASTLQQARELCEEAARRFPLKMGRV
                     HEKPVGPHPDWSCQLAFKPELFGEVIPWLALHRDGLNVLVHPITGSDLRDHRDYPLWM
                     GTVRPLDLSGLEDGEIEYDL"
     CDS             complement(29514..30323)
                     /codon_start=1
                     /EC_number="4.2.1.20"
                     /locus_tag="KF707C_290"
                     /product="tryptophan synthase alpha chain"
                     /protein_id="BAU71717.1"
                     /transl_table=11
                     /translation="MSRLQTRFAELKQQNRAALVTFVTAGDPGYDASLAILKGLPEAG
                     ADVIELGMPFTDPMADGPSIQLANIRALGAKQNLARTLQMVREFRTGNQSTPLVLMGY
                     FNPIHYYGVDRFISDAKDAGVDGLIVVDLPPEHNEDLCHPAQAAGIDFIRLTTPTTDD
                     ARLPTVLAGSSGFVYYVSVAGVTGAGSATLEHVQEAVARLRRHTDLPVAIGFGIRTAE
                     HAANIARLADGVVVGSALVDQIAKADTAEQAVDGVLTLCKTLADGVRNARA"
     CDS             complement(30320..31531)
                     /codon_start=1
                     /EC_number="4.2.1.20"
                     /locus_tag="KF707C_300"
                     /product="tryptophan synthase beta chain"
                     /protein_id="BAU71718.1"
                     /transl_table=11
                     /translation="MTSLRTGPDAKGLFGSFGGQYVAETLMPLIHDLAREYEKAKDDP
                     AFIEELAYFQRDYVGRPSPLYYAERLSEHFGGAKIYLKREELNHTGAHKINNCIGQIL
                     LARRMGKKRIIAETGAGMHGVATATVAARFGMECVVYMGTTDIDRQQANVFRMKLLGA
                     TVIPVTAGTGTLKDAMNEALRDWVTNVDSTFYLIGTVAGPHPYPAMVRDFQAVIGKET
                     REQLAEKEGRLPDSLVACIGGGSNAMGLFHPFLDDDSVRIVGVEAAGHGIETGKHAAS
                     LNGGVPGVLHGNRTFLLQDEDGQIIDAHSISAGLDYPGIGPEHAWLHDIKRVEYTSIT
                     DHEALEAFHTCCRLEGIIPALESSHALAEAFKRAPNLPKDHLMVINLSGRGDKDMQTV
                     MHHMQEKEANA"
     CDS             31640..32527
                     /codon_start=1
                     /locus_tag="KF707C_310"
                     /product="glycine cleavage system transcriptional
                     activator"
                     /protein_id="BAU71719.1"
                     /transl_table=11
                     /translation="MSRDLPPLNALRAFEAAARLQSISRAADELHVTHGAVSRQVRLL
                     EEELGVALFSKDGRGVKLTDAGQRLRDAAGDAFERLRGVCADLAKRAEDAPFVLGCPG
                     SLLARWFIPRLDRLNRELPELRLQLSASEGELDPRRPGVDATLCFAEPPWPADMRVIE
                     LAAESIGPVLSPRYGRFDALAHGAPESVLAESLLHTVSRPQAWPQWAAAQGLDSGRLR
                     LGQGFEHLYYLLEAAVAGLGVAIAPQQLVADELASGRLVAPWGFVETRARLALWVPAR
                     QLDPRAERLAQWLRQAFAG"
     CDS             32592..32807
                     /codon_start=1
                     /locus_tag="KF707C_320"
                     /product="dodecin flavin-binding protein COG3360"
                     /protein_id="BAU71720.1"
                     /transl_table=11
                     /translation="MSDHHTYKKVEIIGSSRNSIDEAIRNALAEASRTIRNLEWFEMV
                     DVRGHIENGQVGHYQVTLKVGFRITDS"
     CDS             32931..33155
                     /codon_start=1
                     /locus_tag="KF707C_330"
                     /product="hypothetical protein"
                     /protein_id="BAU71721.1"
                     /transl_table=11
                     /translation="MKRLLLALGLFTLAGSSFAAVKPCEALKAEIDAKLKAKGVASYS
                     LEVVEKGAAAGKQVVGTCEGGTREIVYQRR"
     CDS             33324..34322
                     /codon_start=1
                     /locus_tag="KF707C_340"
                     /product="coenzyme F420-dependent N5,N10-methylene
                     tetrahydromethanopterin reductase and related
                     flavin-dependent oxidoreductases"
                     /protein_id="BAU71722.1"
                     /transl_table=11
                     /translation="MSSLSNLPLSVLDLAPIRDHGGAAQALHNSLALARHVEALGFSR
                     FWVAEHHNMDGIASSATAVLLGYLAANTARIRLGSGGVMLPNHAPLVVAEQFGTLATL
                     YPGRIELGLGRAPGADHLTARALRRDRLGSADDFPQDVEELETLLGPRQPEQKVIAMP
                     GVDTNVPIWLLGSSLFSAQLAGQKGLPYAFASHFAPRYLHEAIRVYRNHFRPSAVLDK
                     PYVMLGVPLVAAPTDEEAEFLATTVFQRVLALMRGESLVLRPPVESMAGRWLPHEKDA
                     VGSFLALAMIGGPEKIRARMQVLLDQTEADELIFTCDLYQHEHRLRAFDILAGLKG"
     CDS             complement(34332..34760)
                     /codon_start=1
                     /locus_tag="KF707C_350"
                     /product="lipoprotein, putative"
                     /protein_id="BAU71723.1"
                     /transl_table=11
                     /translation="MRTLLALTLLASLAACASKLPDPDPRMAWIDIAPDPSDTLMAHR
                     LDGRRWDDGRYFQVMPGRHELELRYQFEVGGGGGGGMGMNTEPTRITCYMELRYDGFE
                     AGKRYRVEARNAANQPMAWLYDQQRQVLARHQVLPRCGPF"
     CDS             complement(34815..35231)
                     /codon_start=1
                     /locus_tag="KF707C_360"
                     /product="lipoprotein, putative"
                     /protein_id="BAU71724.1"
                     /transl_table=11
                     /translation="MRPLLLSLPLLSLGGCALLMPSHDPSQAWIALDAREGQSMQASR
                     VDDKPLSDPRFFQVTPGRHELEVRLEFEVGAGDIGQGSDGYRRTCLLKLAYADFTAGE
                     RYQLQAGGIGFRPWVRLYDERNREVAKARESRCGDV"
     CDS             35284..36360
                     /codon_start=1
                     /locus_tag="KF707C_370"
                     /product="putative zinc protease protein"
                     /protein_id="BAU71725.1"
                     /transl_table=11
                     /translation="MPTLLLVDLLDRIRRPWVPLLGALALSGCSSLEYYGHLARGQFS
                     LLQAREPVQRLLDEPGLAPGLRQRLALSQQARSFASDHLGLPDNDSYRVYADLDRPYV
                     VWNLFATPEFSLQPITHCFPIAGCVAYRGYYQQGRARGAAALLREEGLDTWVGGVEAY
                     STLGWFDDPLLGTMLRWDDDRLAALIFHELAHQRFYLPGDTAFNESYASFVEREGLRQ
                     WRLSRGLPPADDADTHRREAFTRLVLDTRERLERLYASGLSPERMREAKAAEFERLRR
                     DYRALRDREWGGRKRFDTWVDGPMNNAKLLPFGLYDQWVPAFAALHRAVSGDWRAFYR
                     RVEELSALPAKERIRALESLMANG"
     CDS             36419..36652
                     /codon_start=1
                     /locus_tag="KF707C_380"
                     /note="FIG00955509"
                     /product="hypothetical protein"
                     /protein_id="BAU71726.1"
                     /transl_table=11
                     /translation="MKRVAVALMLSALSAAALAAPKPCEELKQEIEVKIQAAGVSTYT
                     LEIVPNDEVKDPSMVVGSCENGTKKILYQRNGD"
     CDS             complement(36665..37309)
                     /codon_start=1
                     /EC_number="3.1.3.18"
                     /locus_tag="KF707C_390"
                     /product="phosphoglycolate phosphatase"
                     /protein_id="BAU71727.1"
                     /transl_table=11
                     /translation="MNYRNILFDLDGTLTDPREGITRSVQYALAKLDIHEPDLASLEH
                     FIGPPLLQCFMQTYHLSEARAWEAVNHYRDRFKVTGLYENRVFDGVETLLARLGEQGR
                     TLYIATSKPTVFAREIARHFGFDRHFRRIYGSELDGTRTNKVDLIAHLLEEEGLAAED
                     TLMIGDRKHDLIGASRNGLHGAGVGYGFGSREELLDESPDYYFASLDELTRAFG"
     CDS             complement(37317..37862)
                     /codon_start=1
                     /locus_tag="KF707C_400"
                     /note="family 3"
                     /product="carbonic anhydrase"
                     /protein_id="BAU71728.1"
                     /transl_table=11
                     /translation="MKPIRTYQGITPELGERVFVDASAVVIGDVRLGDDSSVWPLVTI
                     RGDMHRIRIGARTSVQDGSVLHITHAGPFNPDGYPLEIGDDVTIGHKALLHGCSVGSR
                     VLIGMGSIVMDGAVIEDDVVLGAGSLVPPGKRLESGFLYVGSPVKQARPLTEKEKAFF
                     TYSAANYVKLKDLHIAEGQGD"
     CDS             complement(38164..38283)
                     /codon_start=1
                     /locus_tag="KF707C_410"
                     /product="hypothetical protein"
                     /protein_id="BAU71729.1"
                     /transl_table=11
                     /translation="MARRKAFGRNDGGGARPPRSITVSVWTGTWTRHHSWAGR"
     CDS             38314..40362
                     /codon_start=1
                     /EC_number="3.4.24.70"
                     /locus_tag="KF707C_420"
                     /product="oligopeptidase A"
                     /protein_id="BAU71730.1"
                     /transl_table=11
                     /translation="MSSSNPLLQDFDLPPYSAIKPEHVEPAVDQILADNRAAIAALLA
                     QQDGTPTWQGLVLALDELGERLGRAWSPVSHLNAVCNNAELRSAYEACLPKLSEYWTE
                     IGQNRALFQAYEALAASPGAAGFDVAQKTILDHALRDFRLSGIDLPTDQQQRYGEIQM
                     KLSELGSRFSNQLLDATQAWTKQVTDEAALAGLTDSARAQMKQAAEAKGLDGWLITLE
                     FPSYYAVMTYADDRALREEVYTAYSTRASDQGPNAGQNDNGPVMAEILDLRQELARLL
                     GFAHFSELSLATKMAENTPQVLGFLRDLAQRSKPFAAKDLDELKAFAAERGVADLKSW
                     DVGYFSEKLREQRYSISQEVLRAYFPVDKVLAGLFAIVQKLYGIEIRELSGFDTWHPD
                     VRLFEISEDGQHVGRFFFDLYARANKRGGAWMDGARDKRRNARGELIAPVANLVCNFT
                     PAVGDKPALLTHDEVTTLFHEFGHGLHHLLTRVEHAGASGINGVAWDAVELPSQFMEN
                     WCWEPEGLALISGHYQTGEPLPQDLLDKMLAAKNFQSGLMMVRQLEFSLFDFELHATH
                     GDGRGVLDVLEAVRDEVAVMRPPAFNRFANSFAHIFAGGYAAGYYSYKWAEVLSADAF
                     SRFEEEGVLNPATGRAFRDAILARGGSQEPMVLFVDFRGREPSIDALLRHSGLTEDAA
                     "
     CDS             40359..40625
                     /codon_start=1
                     /locus_tag="KF707C_430"
                     /note="FIG00954395"
                     /product="hypothetical protein"
                     /protein_id="BAU71731.1"
                     /transl_table=11
                     /translation="MSATPKRFIAGAVCPACSEMDKIQMWDEDGVPHRQCVNCGYADT
                     LNAQGQSVPKELGTRVNQAKPKAADPKVQAVQFFPNPKLKKPAE"
     CDS             40647..41426
                     /codon_start=1
                     /locus_tag="KF707C_440"
                     /product="hypothetical protein"
                     /protein_id="BAU71732.1"
                     /transl_table=11
                     /translation="MWHLVCGDNAVEGVAFALGETVPLECLRVLLDDLAVGPLKGIEQ
                     PPCTRRAAFWRAVWPEAVQPAPDFEAGLDEDARWLAGLAGQSQAVTVWHGDSASEQLL
                     LARVAAALEHSELPLWEVPCGTGDSRVANRRAVAMHRPAELAGLYLPKLVGLERRQQL
                     VAQWRGVLAEGAGIRRWRDGAFHGEDFSLIDADLLGHCTAEWRPLGRVMAGVMAGCDG
                     FFASDFFLFWRARELAAQGRVEIDGEPASNGYGGLRVRLTG"
     CDS             41523..42581
                     /codon_start=1
                     /locus_tag="KF707C_450"
                     /product="radical SAM domain protein"
                     /protein_id="BAU71733.1"
                     /transl_table=11
                     /translation="MSVILPPRGRGTGSNPLNRFAPTTSVALDDGWFQEVPPSRATEV
                     RLETAKSIITRNQSPDLPFDRSVNPYRGCEHGCIYCYARPSHAYWDLSPGLDFETRLI
                     AKTNAVALLEQQLSRPGYQCAPINLGSNTDPYQPIEREHRLTRQTLEVLLRYRHPLTI
                     VTKGSLVLRDLDLLTQLAEQKLVKVLISLTTLDDELKRTLEPRAAAPSARLGAIRVLR
                     ENRVPVGVLCSPMIPMINDMELESLLEAARDAGARQASYMLLRLPREVAPLFEEWLEA
                     HYPQRAAHVMSIIRQCRGGEVYDSRFGHRFRGQGPFAELLAQRFAVALRKLGLDRRMD
                     QELDRSRFCPPGGQMALL"
     CDS             42693..43400
                     /codon_start=1
                     /EC_number="4.2.1.1"
                     /locus_tag="KF707C_460"
                     /product="carbonic anhydrase"
                     /protein_id="BAU71734.1"
                     /transl_table=11
                     /translation="MSNEHDKQRSESAEEALRTIVEGFQRFRDEVFPQQEELFKKLAH
                     EQKPRAMFITCADSRIVPELITQSSPGDLFVTRNVGNVVPPYGQMNGGVSTAIEFAVM
                     ALGVHHIIICGHSDCGAMKAVMDPQTLERMPTVKAWLRHAEVAKVVVQENCGCANHES
                     LEVLTEENVVAQLDHLRTHPSVAARLASGQLFIHGWVYDIETSVIKAYDAELGRFRPI
                     GDGPLPMATPRPRYQVD"
     CDS             complement(43454..44113)
                     /codon_start=1
                     /locus_tag="KF707C_470"
                     /note="FIG00953365"
                     /product="hypothetical protein"
                     /protein_id="BAU71735.1"
                     /transl_table=11
                     /translation="MNTAALREVIQRALQNEAASTQLKAILEHQVASLHPAIRLPDED
                     AEGVLARFIAGYVEQVPDVLEAATNVAREAGIEDEIRPVLKVAEQFFLQPPALMAGHE
                     GLEGLLDEAYLAHRLVEEVNDRYIVHFGQPLIPLDTTVANLIAHQLIGEPFANELDEA
                     VHHAVEGLLDEEAFDQPSAQAYRQRLNDPKVDAAWKRWPCMSRQLGVELQLNQAPRTA
                     G"
     CDS             complement(44339..44500)
                     /codon_start=1
                     /locus_tag="KF707C_480"
                     /product="hypothetical protein"
                     /protein_id="BAU71736.1"
                     /transl_table=11
                     /translation="MSHHCGFPFSFLLSRRLGQRTGDGCPDYQARTADLGTQVHSRVP
                     SGTAFRVGV"
     CDS             44492..45616
                     /codon_start=1
                     /EC_number="1.9.3.1"
                     /locus_tag="KF707C_490"
                     /product="cytochrome c oxidase polypeptide II"
                     /protein_id="BAU71737.1"
                     /transl_table=11
                     /translation="MRHPRVWMGLLLWSVLSQAQAAWTVNMTPGATEVSRTVFDLHMT
                     IFWICVVIGVIVFGAMFWSMIIHRRSTGQQPAHFHESTTVEILWTVVPFVILVLMAIP
                     ATKTLIDIYDTSESGLDVQITGYQWKWHYKYLGQDVEFFSNLATPSEQIHNKAPKDEH
                     YLLEVDQPLVVPVGTKVRFLITAADVIHSWWVPALAVKKDAIPGFVNESWTRIEKPGL
                     YRGQCTELCGKDHGFMPIVVEAKSQEDFAKWLAARKEETAKLKELTDKEWTLDELVAR
                     GDKVYHTSCAACHQPEGQGMPPMFPALKGSKIATGPKADHLNIVFHGKPGTSMAAFGK
                     QLSEVDIAAVITYERNAWGNNTGDMVTPKEVLALKQAESQ"
     CDS             45646..47235
                     /codon_start=1
                     /EC_number="1.9.3.1"
                     /locus_tag="KF707C_500"
                     /product="cytochrome c oxidase polypeptide I"
                     /protein_id="BAU71738.1"
                     /transl_table=11
                     /translation="MSAVIDQDHAGHDHHHGPAKGLMRWVLTTNHKDIGSLYLWFSFA
                     MFLLGGSMAMVIRAELFQPGLQIVQPEFFNQMTTMHGLIMVFGAVMPAFVGLANWMIP
                     LMIGAPDMALPRMNNFSFWLLPAAFGLLVSTLFSEGGGPNFGWTFYAPLSTTYAPESV
                     TFFIFAIHLMGISSIMGAINVIATILNLRAPGMTLMKMPLFVWTWLITAFLLIAVMPV
                     LAGCVTMMLMDIHFGTSFFNAAGGGDPVLFQHVFWFFGHPEVYIMILPAFGAVSSIIP
                     AFARKPLFGYTSMVYATASIAFLSFIVWAHHMFTVGIPLTGELFFMFATMLIAVPTGV
                     KVFNWVTTMWEGSMTFETPMLFAVAFVILFTIGGFSGLMLAIAPADFQYHDTYFVVAH
                     FHYVLVPGAIFGIFASAYYWLPKWTGHMYDETLGKLHFWMSFIGMNLAFFPMHFVGLA
                     GMPRRIPDYNLQFADFNMISSLGAFTFGATQFLFLFIVIKCIRGGKPAPAKPWDGAEG
                     LEWTVPSPAPYHTFTTPPEVK"
     CDS             47254..47799
                     /codon_start=1
                     /locus_tag="KF707C_510"
                     /note="copper delivery to Cox1"
                     /product="cytochrome oxidase biogenesis protein
                     Cox11-CtaG"
                     /protein_id="BAU71739.1"
                     /transl_table=11
                     /translation="MSEMPVRRLVVRLLLLVVAMFGFGFALVPIYDVMCQAFGINGKT
                     AGAYQGVQSEDQQRQVRVQFLATNAAGMSWEFRPRADDLVVHPGASNEMLFVAYNPSD
                     KPMTAQAIPSVAPSKAAAFFHKTECFCFTQQVLQPGERIEMPVRFIVDRDLPADVHHL
                     TLAYTLFDITARKPPVARNGG"
     CDS             47825..48712
                     /codon_start=1
                     /EC_number="1.9.3.1"
                     /locus_tag="KF707C_520"
                     /product="cytochrome c oxidase polypeptide III"
                     /protein_id="BAU71740.1"
                     /transl_table=11
                     /translation="MASHEHYYVPSQSKWPIIATLGLLVTVYGVGTWFNDLKAGRPES
                     NGPIIFFVGGLLLAYMLFGWFGNVIRESRGGLYSAQMDRSFRWGMSWFIFSEVMFFAA
                     FFGALFYIRHFAGPWLGGEGDKGVTNMLWPGFQYAWPLLENPDSKLFPPPKAVIDPWH
                     LPLINTILLVTSSFTVTFAHHALRKNKRGPLKIWLALTILLGAVFIFFQAEEYVHAYQ
                     ELGLTLGSGIYGATFFMLTGFHGAHVTLGAIILTVMLVRILRGHFNADHHFGFEAASW
                     YWHFVDVVWIGLFIFVYVL"
     CDS             complement(48763..48966)
                     /codon_start=1
                     /locus_tag="KF707C_530"
                     /product="permease of the major facilitator superfamily"
                     /protein_id="BAU71741.1"
                     /transl_table=11
                     /translation="MLKAAIVLLLLATLISLFSGLFFLVKDEGRSSRVVNALTVRVVL
                     AALTLALIAWGFYSGQLVSHVTW"
     CDS             49036..49761
                     /codon_start=1
                     /locus_tag="KF707C_540"
                     /note="facilitates heme A insertion"
                     /product="cytochrome oxidase biogenesis protein Surf1"
                     /protein_id="BAU71742.1"
                     /transl_table=11
                     /translation="MNGFRPGLGPALVVLALLPVLIGLGFWQLSRAEEKRALLAAAEL
                     RRVASPVDLENLASSADPAWLRVRLEGHFDPRHSLLLDSRIRDGRAGVELLQPFQDAS
                     GRWVLVNRGWLPWPDRREPPRFQTPEGPQRLIAWVYVPPGAAFELKPSAASDWPQLVN
                     QVDAAALWQHLARTGLPLELRLEGGPAAYRTDWAVVAMGPEKHLGYAVQWFALATALL
                     GLFIYYGLRKGRENDHEPSTRHA"
     CDS             49736..50317
                     /codon_start=1
                     /locus_tag="KF707C_550"
                     /product="probable transmembrane protein"
                     /protein_id="BAU71743.1"
                     /transl_table=11
                     /translation="MNPALAMPDAPPARRRGRLQLLLILMVVIGPMVLASAMYKFQFW
                     VPEGRSFHGTLVGNGLTGADIGVRGAVSGGGWQLLVTAPAGCQADCQQLVYLARQIHI
                     GLGREASRASHSLATTVVPADYAETLRQEYPQLRRLGLDAAAYHKAAAAPEGAQLWIV
                     DPHGNLVLRYDGATRGKQILNDLRHLLKLSNIG"
     CDS             50355..51440
                     /codon_start=1
                     /locus_tag="KF707C_560"
                     /note="cytochrome oxidase biogenesis protein Cox15-CtaA"
                     /product="heme A synthase"
                     /protein_id="BAU71744.1"
                     /transl_table=11
                     /translation="MDNDKNRPGFRLALFATLLAVVVVLLGAYTRLTHAGLGCPDWPG
                     CYGFIGVPKTEAQLAHAEALFPHAPVEAEKGWNEMVHRYFAGTLGLVILGLALHALRR
                     RHEPGQPVKLPLLLVAVVVAQAAFGMWTVTLQLWPQVVTAHLLGGFTTLSLLWLLCLR
                     LSGAFAPLALPARVRRWAALGLALVIGQVALGGWVSSNYAAVACVDLPTCHGQWWPQM
                     DFANGFHLTQHIGPNYLGGQLDSDARTAIHMTHRLGAVLVTLALLALAWQLRSVGLKG
                     LAGVVLAALCLQVGLGISNVVFHLPLPVAVAHNGGGALLLLVLVSVNYRVRAASRPVG
                     ASAARDRAGSDGSRAGLAPAVLTSHSK"
     CDS             51452..52357
                     /codon_start=1
                     /locus_tag="KF707C_570"
                     /note="protoheme IX farnesyltransferase COX10-CtaB"
                     /product="heme O synthase"
                     /protein_id="BAU71745.1"
                     /transl_table=11
                     /translation="MAIPLSQGHSQAHASWRDYLELTKPKVVVLMLITSLVGMFLATR
                     AGVPWQVLLFGNLGIGLCAGAAAAVNHVVDRRIDSIMARTLKRPVVNGRVSPAAALAF
                     AFVLAVAGQALLLAFTNELTAWLTLASLVGYAVLYTGFLKRATPQNIVIGGLAGAAPP
                     LLGWVAVTGHLSAEPLLLVLIIFAWTPPHFWALAIHRKAEYAKADIPMLPVTHGEQYT
                     KVHILLYTLVMFAVSLLPYAIHMSGPLYLVAALALGGRFLQWAWVLYRDSRPHAAIRT
                     FKYSIAYLFLLFIALLMDHYLMLNL"
     CDS             52363..52989
                     /codon_start=1
                     /locus_tag="KF707C_580"
                     /note="Sco1/SenC/PrrC, putative copper metallochaperone"
                     /product="cytochrome oxidase biogenesis protein"
                     /protein_id="BAU71746.1"
                     /transl_table=11
                     /translation="MQKTVFVLVALVAVVLGLTVHRVLSGQGQADPTKLLDAGIVLLP
                     QPRTLPSLEMTNQDGQPVPVDQFKDQWSLVFFGYTFCPDICPTTLAQMRELKGLLPEA
                     ARNNLRVILVSVDPNRDTPEKLKQYLGYFDPAFVGLTADLPTLQKLSNAVSIPFIPAD
                     TSKPNYTVDHSGNLVILGPDGTQRGFIRAPLNNQKLKEQLPALLAPKA"
     CDS             complement(53058..53834)
                     /codon_start=1
                     /locus_tag="KF707C_590"
                     /product="methionine ABC transporter substrate-binding
                     protein"
                     /protein_id="BAU71747.1"
                     /transl_table=11
                     /translation="MKKLLVAFAAFSALTAQAGTLKVAATPVPHAEILEFIKPQLAKE
                     GVDLQVKVFTDYVQPNVQVAEKRLDANFFQHQPYLDEFNKARQTQVKLVSVTGVHVEP
                     FGAYSSKVKSLAELPEGAQVVIPNDATNGGRALLLLDKAGVIKLKADAGITATPKDIA
                     ENAKGLKIRELEAATLPRVLNQVDLALINTNYALEAKLNPTQDALVIEGSDSPYVNIL
                     VSREDNKASEDMQKLAKALHSPEVKKFIEEKYKGAVVPAF"
     CDS             complement(53890..54555)
                     /codon_start=1
                     /locus_tag="KF707C_600"
                     /product="methionine ABC transporter permease protein"
                     /protein_id="BAU71748.1"
                     /transl_table=11
                     /translation="MDALLANIDWYEIWLATLDTLLMLGGSLLFTVLLGLPLGVLLFL
                     TGPRQLFENRAVYSLLSLVVNVLRSLPFIILLIVMIPFTVLITGTSLGVAGAIPPLVV
                     GATPFFARLVETALREVDRGILEATQAMGATTGQIIWNALLPEARPGIFAAITVTAIT
                     LVSYTAMAGVVGAGGLGDLAIRFGYQRFQTDVMVVTVVLLLVLVQILQTVGDRLVVHF
                     SRK"
     CDS             complement(54555..55562)
                     /codon_start=1
                     /locus_tag="KF707C_610"
                     /product="methionine ABC transporter ATP-binding protein"
                     /protein_id="BAU71749.1"
                     /transl_table=11
                     /translation="MIEFHSVHKAYRVQGREIPALQPTDLAIQHGEVFGLIGHSGAGK
                     STLLRLINRLEEPTGGRIVIDGEDVTALDAEGLRRFRQRVGMIFQHFNLLSSKTVAEN
                     VALPLKLAGELSRTEVDRRVSELLARVGLSDHARKYPAQLSGGQKQRVGIARALATQP
                     KILLCDEATSALDPQTTAQVLQLLAEINRELNLTIVLITHEMDVIRRVCDRVAVMDGG
                     VIVEQGPVADVFLHPRHGTTQRFVLEDEQVDEGEQRDDFAHVEGRILRLTFRGEATYA
                     PLLGTVARRTGVDYSILAGRIDRIKDTPYGQLTLALTGGDIDAALTCFREADVHLEIL
                     R"
     CDS             complement(55709..56137)
                     /codon_start=1
                     /locus_tag="KF707C_620"
                     /product="lipoprotein, putative"
                     /protein_id="BAU71750.1"
                     /transl_table=11
                     /translation="MKSFATRCLPVVALSLLLAACQTARQTAEVPDAALVSSFQELGD
                     DLSAGKLTEAEVQLKTLQDTAAGDARLEHYQRQLADAWLQRSQDALQQGDLDGATRAL
                     SHARSLMPKAPALTTGLDGAIDKARQLNPQSTAVEPGPQS"
     CDS             complement(56158..56340)
                     /codon_start=1
                     /locus_tag="KF707C_630"
                     /product="hypothetical protein"
                     /protein_id="BAU71751.1"
                     /transl_table=11
                     /translation="MGCVHGIPRRSCRCAGHLAGISRAKEPLQCMGCLWKCQDYGGFA
                     SIFCPEAIVDVESRVF"
     CDS             56326..57954
                     /codon_start=1
                     /EC_number="1.1.99.1"
                     /locus_tag="KF707C_640"
                     /product="choline dehydrogenase"
                     /protein_id="BAU71752.1"
                     /transl_table=11
                     /translation="MYTAHQAFDYIIIGAGPAGCLLANRLSADPGVRVLLLEAGGRDN
                     HPWIHIPVGYLYCIGNPRTDWCYRTEAEPGLHGRSLGYPRGRVLGGSSSINGMIYMRG
                     QAADYERWVELGNPGWGWADVLPLFLRSESHFGGASAFHNDAGEWRVERQRLSWEILD
                     AFRRAAAECGIAPVDDFNTGDNEGCGYFQVNQRGGVRWNASKAFLRPVRQRPNLFVYT
                     GFEAHRLLLEQGRAVGVAGRWQGLEHEVRARREVILCAGAVGSPLLLQRSGIGPRGLL
                     ERLGIGVRHELPGVGGNLQDHLQLRLVFKVSGVPTLNQMAGSLWGKAGMALRYLASRS
                     GPLAMAPSQLGAFVRSGPEQPRANLEYHVQPLSLERFGEPLHPFPAFTASVCNLRPLS
                     RGRIDLRSVDPQAPPVIQPNYLSHPEDLRVAADAIRFTRRIVAAPALAAYRPEEHLPG
                     PALQSEEALQDAAGRIGTTIFHPVGTCAMGQGVEAVVGAELKVHGVPGLRIADASVMP
                     EIVSGNTCSPTLMIAERAATLVLEDLRRAGAGRS"
     CDS             complement(57926..58711)
                     /codon_start=1
                     /locus_tag="KF707C_650"
                     /note="inner membrane permease protein ZnuB"
                     /product="zinc ABC transporter"
                     /protein_id="BAU71753.1"
                     /transl_table=11
                     /translation="MADFLFNALLAGLALALVAGPLGSFVVWRRMAYFGDTLSHAALL
                     GVALGLMLDVSPTLAVTVGCVLLAVLLVTLQSRQPLASDTLLGILAHSTLSLGLVVLS
                     FMTEVRIDLMAYLFGDLLAVGPKDLAWILGGSALVLLVLIPLWRPLLAITVHEELARV
                     EGLPVAAIRLALMLLIAIVIAVAMKIVGVLLITSLLIIPAAAAQRHARSPEQMALGAS
                     LLGLVAVCAGLALSWYEDTPAGPSIVVSAASLFLLSFALPRRA"
     CDS             complement(58704..59504)
                     /codon_start=1
                     /locus_tag="KF707C_660"
                     /note="ATP-binding protein ZnuC"
                     /product="zinc ABC transporter"
                     /protein_id="BAU71754.1"
                     /transl_table=11
                     /translation="MSDALIRLDRVGVDFAGQSVLQDVQLALKAGEIVTLIGPNGAGK
                     TTLVRTVLGLLKPDRGEVWRKPRLHIGYMPQKLQVDATLPLTVLRFLRLVPGVDRKAA
                     LSALDEVGAVQVIDSPLQAISGGELQRVLLARALLREPELLVLDEPVQGVDVAGQAEL
                     YRLITRLRDRHGCGVLMVSHDLHLVMSATDQVVCLNRHVCCSGHPEQVSGDPAFIELF
                     GQDAKSLAVYHHHHDHSHDLHGEVVKSPFPDGTRFTPAHQHGPDCNHG"
     CDS             complement(59501..60001)
                     /codon_start=1
                     /locus_tag="KF707C_670"
                     /product="zinc uptake regulation protein ZUR"
                     /protein_id="BAU71755.1"
                     /transl_table=11
                     /translation="MLKPISVKAPLACRPHDHSHCVSNALAEAEAICSRHGLRLTALR
                     KRVLELVWQSHRPLGAYDILGVLAEEDGRRAAPPTVYRALDFLLENGLVHRIASLNAF
                     VGCNHPGEAHQGQFLICRNCQTAIELEQTQISQAIVESASAVGFTVEGQTVEIVGLCA
                     NCRTQP"
     CDS             60066..60983
                     /codon_start=1
                     /locus_tag="KF707C_680"
                     /note="periplasmic-binding protein ZnuA"
                     /product="zinc ABC transporter"
                     /protein_id="BAU71756.1"
                     /transl_table=11
                     /translation="MIRLFVSLLLAACALSAQADVRLLTSIKPLQLIAAAVQEGVGQP
                     DVLLPPGASPHQFALRPSDVRRVREADLLYWVGPDLESFLPRVLQGRDKPSVALQDEP
                     GMHLRRFEALHDEHGEHDHDAHEHDHDHRPGSLDAHLWLLPANARVIAARMAADLAAA
                     DPANAARYQANLEAFEDRLAALDERLKARMAKVAGKPFFVFHEAFDYFESAYGLRHAG
                     VFSVAGEVQPGARHVAAMRERLQKAGPSCVFNEPPVVPRLAETLTAGLQVRLAELDAM
                     GMHAPVAANGYEALLESLADGLAGCLEAL"
     CDS             complement(61063..61197)
                     /codon_start=1
                     /locus_tag="KF707C_690"
                     /product="hypothetical protein"
                     /protein_id="BAU71757.1"
                     /transl_table=11
                     /translation="MTLGRLGCSRPGHQLPSRMKRPDSSDHDRRPLTHLNRDRCPSSP
                     "
     CDS             61159..63306
                     /codon_start=1
                     /EC_number="1.17.4.1"
                     /locus_tag="KF707C_700"
                     /note="coenzyme B12-dependent"
                     /product="ribonucleotide reductase of class II"
                     /protein_id="BAU71758.1"
                     /transl_table=11
                     /translation="MAGTGAPQATQGHHGVALQAASEDIWDSKYRLKQKDGTPIDLSP
                     DGTWQRVARALAGVEAEPTAREHWYERFLWALRNGAIPAGRILSNAGAQDLKPATSTI
                     NCTVSGTILDSMDDILSKVHEAGLTLKAGCGIGYEFSTLRPRGAFVAGAGAQTSGPLS
                     FMDIYDRMCFTVSSAGGRRGAQMGTFDVCHPDVREFIRAKREDGRLRQFNLSLLVSDA
                     FMHAVENDTEWPLLFPVHPRERDELDLHDVSQVIWRDWPVHEGYITRDDGLVACKVYG
                     RVRARHLWDLIMVSTYDFAEPGFILIDRVNELNNNWWCEAIRATNPCGEQPLPPYGSC
                     LLGSVNLTAFVEEPFGEEARFDWERFREVVRVFTRMLDNVVEINGLPLAPQREEILGK
                     RRHGMGFLGLGSTLALLRLRYGSPEACVFTEEVSREMALTGWQVALELAREKGPAPVL
                     LLDYEVTAAMLRKRPEMVDDGYRAGDRVPGRILHARYSRYMQRIAEHAPELVAELAEV
                     GARFTHHSSIAPTGTISLSLANNASNGIEPSYAHHYARNLIRPGRKTKEKVEVFSYEL
                     LAYRALVNAQARPDAEHPAQRLPEYFVSADDISPAEHVDMQAAAQKWIDSSISKTANV
                     PTDFPFEDFKDIYLRAWRQGLKGCTTFRFNPAAFQGVLVKEADLARTRYRFELEDGSV
                     VELQGNEEVEYDGEVHTAANLFDALKEGYYGRF"
     CDS             63323..64006
                     /codon_start=1
                     /EC_number="1.17.4.1"
                     /locus_tag="KF707C_710"
                     /note="alpha subunit, coenzyme B12-dependent"
                     /product="ribonucleotide reductase of class II"
                     /protein_id="BAU71759.1"
                     /transl_table=11
                     /translation="MSLKIEKRITGFSLVQPETDKARETGEAVPVVQMDETLQRPEIL
                     VGATYKIKSPLFEHALYVTINDIVLNPGTPHEQRRPFEIFINSKGMEHFQWIVALTRI
                     MSAVFRKGGDCTFLVEELKAVFDPRGGYLKRGGVYMPSLVAEIGAVLERHLIAIGLME
                     GQKLDEEQRLYLAEKRAAYEASLGTSTAEPGEDFPPGAQLCGKCNAQAVVQLDGCATC
                     LNCGHSKCG"
     CDS             complement(64342..65292)
                     /codon_start=1
                     /EC_number="2.7.1.39"
                     /locus_tag="KF707C_720"
                     /product="homoserine kinase"
                     /protein_id="BAU71760.1"
                     /transl_table=11
                     /translation="MSVFTPLERPELEAFLAPYGLGRLKDFQGIAEGSENSNFFVSLE
                     RGEFVLTLVERGPSHDLPFFIELLDVLHDAELPVPFALRTETGEALRELAAKPALLQP
                     RLPGKHVHHPNAHHCAEVGTLLARLHLATRERVLERKSDRGLAWMLEEGPSLALQLDN
                     TALPLLRDALKEIDAVQQRFLALPRANLHADLFKDNVLFDGPHLTGVIDFYNACSGPM
                     LYDLAICLNDWCSDADGHLDSQRARALLGAYAALRPFTAAEAELWPAALRIACVRFWL
                     SRLIAANAFAGQDVLIHDPDVFRKRLAQRQQVDLPLPFAL"
     CDS             complement(65322..65603)
                     /codon_start=1
                     /locus_tag="KF707C_730"
                     /note="FIG00953549"
                     /product="hypothetical protein"
                     /protein_id="BAU71761.1"
                     /transl_table=11
                     /translation="MRALNRLLIASLLAVAPVATFAADEPSAEPDVTIRQEGDKTIQE
                     YRVNGFLYAIKVTPKNGKPYFLVRADGESNFVRSDKPDMLIPAWEIFSW"
     CDS             65678..68425
                     /codon_start=1
                     /EC_number="2.7.7.7"
                     /locus_tag="KF707C_740"
                     /product="DNA polymerase I"
                     /protein_id="BAU71762.1"
                     /transl_table=11
                     /translation="MSQAPLVLVDGSSYLYRAFHALPPLTTSAGLPTGAVKGVLNMLK
                     SLRRQFPDSPFAVVFDAKGGTFRDEMFAEYKANRPSMPDELRVQVEPLHASVRALGLP
                     LLCVEGVEADDVIGTLARQSAAGGRPVVISTGDKDMAQLVDGHITLVNTMTGSTLDVD
                     GVKEKFGVGPELIIDYLALMGDKVDNIPGVPGVGEKTALGLLTGVGGGLDVLYASLDK
                     VPELPIRGAKGLPAKLLEHKDMAFLSYKLATIKCDVELDVEIDALHPGEPDRETLAEL
                     YRILEFKSWLDELQRQAKSEGDSLVLEDVPAAKAEQRYEVVLDQARFDAWLKKLEAAP
                     LIAFDTETTSLDAQQAQVVGVSFAVEAGEAAYVPLAHSYMGVPAQLDRDAVLKALKPL
                     LEDPAKAKVGQHAKYDMNVLANASTPIAVRGVAFDTMLESYVLDSTATRHDMDSLALK
                     YLGHSTIRFEDIAGKGAKQLTFDQIALEQAGPYAAEDADVTLRLHQVLWQKLEAVPSL
                     AKVLTEIEMPLVPVLARIERNGALVDGKLLGQQSLELGEKLVALERQAFDLAGQEFNL
                     GSPKQLGAILYEKLGLPVLAKTATGQPSTAENVLADLAEQDFELPKVIMQYRSLSKLK
                     STYTDRLPEQINPRTGRIHTSYHQAVAATGRLSSSDPNLQNIPIRTAEGRRIRQAFVA
                     PEGYKLLAADYSQIELRIMAHLAKDEGLLDAFRHGRDVHRATAAEVFGVALDEVTSDQ
                     RRSAKAINFGLIYGMSAFGLAKQIGVERKEAQAYIDRYFARYPGVLAYMERTREQAAA
                     QGFVETLFGRRLYLPEIHSKNQAMRKGAERTAINAPMQGTAADIMKRAMVAVDDWLQD
                     SGLDARVILQVHDELVLEVREDLVERVRDTLRPLMSGAAELDVPLVVEAGVGNNWDEA
                     H"
     CDS             complement(68706..69344)
                     /codon_start=1
                     /locus_tag="KF707C_750"
                     /note="EngB"
                     /product="GTP-binding protein"
                     /protein_id="BAU71763.1"
                     /transl_table=11
                     /translation="MSTKNPILGLCQQARFLISAAKVDQCPADTGLEVAFAGRSNAGK
                     SSALNTLTHASLARTSKTPGRTQLLNFFSLDDERRLVDLPGYGYAKVPIPLKQHWQHH
                     LEAYLSSRESLVGLVLLMDIRHPLTDFDRLMLDWSQAGGMPLHILLTKADKLAFGAAK
                     NALLKVRQEIRKGWGEGVTIQLFSAPKRQGIEEAHAVLAEWLQLGQDPEADA"
     CDS             69490..69813
                     /codon_start=1
                     /locus_tag="KF707C_760"
                     /product="cytochrome c5"
                     /protein_id="BAU71764.1"
                     /transl_table=11
                     /translation="MRGNALPMRLIMKKYLLVAGFAAISCVAQAAQDPEAVFNKACAA
                     CHNGALPMAPKKGDKAAWEPRLAKGMDTLVQSVTNGLNAMPPKGMCMDCSAEDYKAVI
                     EWMSQ"
     CDS             69882..70472
                     /codon_start=1
                     /locus_tag="KF707C_770"
                     /product="cytochrome c4"
                     /protein_id="BAU71765.1"
                     /transl_table=11
                     /translation="MSLLLTLGITGMAHAAGDAKAGQAKAAVCGACHGPDGNSAAPNF
                     PKLAGQGERYLLKQMHDIKSGNRTVLEMTGLLTNMSDQDMADIAAYFASQKGSVGAAD
                     PKLVARGEALFRGGKLDQGMPACTGCHAPDGTGNAAAGFPHLGGQHAQYVAKQLTDFR
                     EGNRTNDGDSMIMRGIAAKLSNKDIEAVSSYIQGLH"
     CDS             70613..71245
                     /codon_start=1
                     /locus_tag="KF707C_780"
                     /note="DsbA"
                     /product="periplasmic thiol:disulfide interchange protein"
                     /protein_id="BAU71766.1"
                     /transl_table=11
                     /translation="MRNLILSAVLAGASLLGMGAVQADDIEAGKQYVELGSPVPVAVP
                     GKIEVVELFWYGCPHCYQFEPTLNPWAEKLPEDVNFVRIPAMFGGLWNVHGQLFITLE
                     SMKVEHQVHKAVFDAIHKDGKKLATPEEMAEFLAGQGVDKDAFLKAFNSFAVKGQMEK
                     AKKLAMAYQITGVPTLVVNGKYRFDISSSGGPEQTLKVAEHLIEKERAAK"
     CDS             71355..72137
                     /codon_start=1
                     /locus_tag="KF707C_790"
                     /note="exonuclease/phosphatase family protein"
                     /product="endonuclease"
                     /protein_id="BAU71767.1"
                     /transl_table=11
                     /translation="MRLLSFNIQVGISTERYRHYLTRGWQHLLPHPGRAVNLQRIGEL
                     LGEYDLVALQEVDGGSLRSGYVNQVEHLAQLADFPFWYQQLNRNLGRLAQHSNGLLSR
                     LQPTLLEDHPLPGPPGRGAILLRFGQGRDALAVVMMHLALGARTRTRQLAYIRERVAG
                     FRHLVLMGDMNTHANDLLEHSPLRDLGLLAPQVEATFPSWRPQRCLDHILLSPSLTLE
                     RVEVLSQPISDHLPVAVDIRLPDGLRADLPLALSPSPQGVPA"
     CDS             72134..73984
                     /codon_start=1
                     /locus_tag="KF707C_800"
                     /product="GGDEF domain protein"
                     /protein_id="BAU71768.1"
                     /transl_table=11
                     /translation="MSDDAQRWKAKYLENLEEQEKLERRWDARLDLLRRGLVRSSLAA
                     EGTDKAVDLCMQELREIIRGEQMDAGLSALIPRLEKAVLDSEQRRQQRAEQSVGALAA
                     LAGRLLELDLPREVRKGLKQFAKRIDERARQPRELPALLAELGMLQGQALEAIARVDP
                     SAPRPGLLQRLFGAREEIPADAAPVGQPAAAVTSTVAEGPEPFPAAEPPVPVPVPPAP
                     MPATPASAPRSSTLDSLPLAASLITGEGDPDYALPSVPEPGYSAIAPHVAASLRALLD
                     ELDLPEHHQPQADALRQRLQGGLNWYELVPVLDDFGVLVLAITGNGQREFVGYLKQLN
                     QRLALFLEHLTAAQEGYAESLDSARALDDQLREQVSGLQASVQDASDLDDLKRSLERR
                     LDGLLQTLDRFHRQRSSREHEVGERLQALMARVSTMEVEARAFQEDLELQRQKALQDP
                     LTGLPNRAAWNERLEIERARQQRYGGDLSLAVVDIDHFKRINDSFGHLAGDKVLKIIA
                     GELARRLRKTDFIARFGGEEFVLLLPSTPLDGGRQLLEALRTDIEACPFHFKGERVAI
                     TFSAGLTPMLPGEPGDAAFQRADEALYRAKHQGRNRIEPAPASDEVSRAV"
     CDS             complement(73991..75409)
                     /codon_start=1
                     /locus_tag="KF707C_810"
                     /product="cryptochrome"
                     /protein_id="BAU71769.1"
                     /transl_table=11
                     /translation="MRRALLWLKQDLRLDDHPALHAAIQADRLLPLFVLDPQWLRPSP
                     LGPRRLGVHRARFLLESLAALDAGLRQHGSRLLVVQGDAERVIPSLVERLDLDEVLTL
                     EEVAPFELDEMRRVRHALGVPLTEWPGNSLFREEELPVPLQALPSVFNRFRDLVEARV
                     HVFQPNPTPHALPPLPTGAAALLTPLPSLSRLGLGEPLGVPATAFPFSGGEPAALARL
                     RDYLWESRSIRDYRIRSDGMIGSEYSSKLSPWLANGSLSPRRVAAELHRLESQHGRDD
                     STQQLWHQLLWREYFRWTMRRLGDALFRADGLKATARAPRNLDERFHGWCIGRTGMPL
                     VDANMRELVMTGWMSGRGRQVVASYLVNDLQQDWCHGAAWFEEHLLDYDPASNWGNWA
                     YLAGVACDPQRAKAFNALRQAFQYDPEAAYVSLWLPELRGLPVEQRHAPFILSEHQFA
                     GLDYPRLASIPEYWKPYLPSAA"
     CDS             75636..76229
                     /codon_start=1
                     /locus_tag="KF707C_820"
                     /note="FIG00953738:"
                     /product="hypothetical protein"
                     /protein_id="BAU71770.1"
                     /transl_table=11
                     /translation="MEILGIAVLVFLVTDPFGNIAIFIAALKGVAPERRLRVALRELL
                     FALALLMLFLTFGDRILSGLGLSRESIAIAGGIILFIIALRLIFPRPEGVLGDLPGGE
                     PMLVPLATPAVAGPSALAVLMTLRNTHQGELWVLYVAVLLAWAATALILLQAAFLQRF
                     LGDRGLMAVERLTGMLLIMLSVDMLLDNLQSVLHLTP"
     CDS             76226..77005
                     /codon_start=1
                     /EC_number="3.5.1.28"
                     /locus_tag="KF707C_830"
                     /product="N-acetylmuramoyl-L-alanine amidase"
                     /protein_id="BAU71771.1"
                     /transl_table=11
                     /translation="MKKLYLGLALLLLGGCTGGLRIDDSYRSVSQSSRVQYVVLHYTS
                     TGLESSLRLLTRDGVSSHYLIGDQPATIYRLVDENRRAWHAGESEWQGRTWLNASTLG
                     IELVNDGYRDTPAGRVYQPFSDEQIDALIPLLQDIVKRHHLPLGSIIGHSDIAPQRKV
                     DPGPLFPWKRLADAGLVPWPDAAAVARAQARFAVALPTVGWFQEQLARQGYTTPRTGV
                     LDKETRNVIAAFQMKYRQRLYDGEPDAETAALLLVLNGMPR"
     CDS             complement(77037..78812)
                     /codon_start=1
                     /locus_tag="KF707C_840"
                     /product="sensory box histidine kinase"
                     /protein_id="BAU71772.1"
                     /transl_table=11
                     /translation="MRLRTRLFLSISALITVALVGLLLGLVSVMQMAGAQERMIGRAF
                     ATIDISLRMRQHLGDQLVNLMGKDLDLPALERSQRRFLGALEEGLANSADPDTRERVQ
                     RIAVAYQTFLDVVRQPASLRWGLLDDNDFSHALDVLRNSMVDLQKHALERVGQAEGAA
                     RERAVLIGGLLGLLGIAVLLIGVITAHGIARRFGEPIDALAKAADQVGRGDFQVTLPL
                     SPVNEMAALIRRFGLMAEALRLLKETNIEQLLAERQRLKAVLDSIDDGLLILDRQGRV
                     QHANPVAQRQLSWGALPEGQPLSRALARPELEEAVQRVLRGDPLEEEPEDLVIEAEGE
                     QRLLSWSLAPVLLDEGRVLGAVMVLRDVTEARAFERVRNEFVLRASHELRTPVTGMQM
                     AFGLLSERLRFAPDSREGDLLTTVDEEMQRLVRLINDLLDFSRYQSGVQVLAREPCDL
                     EDLLAALRQRYSAQAGELGLEIELELHPPLPRVNLDRLQIERVLDNLVGNAIRHSRPG
                     GHIRLQARRHGERVLLSVADEGEGVPYSQQARIFEPFVQVGQRKGGAGLGLALCKEIV
                     QLHGGRIGLYSRPGQGARFYMTLPV"
     CDS             complement(78817..80163)
                     /codon_start=1
                     /locus_tag="KF707C_850"
                     /note="AlgB"
                     /product="alginate biosynthesis transcriptional
                     regulatory protein"
                     /protein_id="BAU71773.1"
                     /transl_table=11
                     /translation="MEQVTENQGRILLVDDEAAILRTFRYCLEDEGYSVATAGSAAQA
                     EAILQRQVFDLCFLDLRLGEDNGLDVLAQMREQAPWMRVVIVTAHSAVDTAVDAMQAG
                     AADYLVKPCSPDQLRMAAAKQLEVRQLTARLEALEGEVRRGGDGLDSHSPAMMAVLET
                     ARQVAGTDANILILGESGTGKGELSRAIHGWSKRAKKAFVTINCPSLSADLMESELFG
                     HNRGAFTGASESTQGRVSQADGGTLFLDEIGDFPLGLQPKLLRFIQDKEYERVGDPVT
                     RRADVRILAATNLDLDQMVREGRFREDLLYRINVIALKIPPLRERHEDILGLAERFLA
                     RFVTEYARPARAFSEEARAALLGYRWPGNVRELRNVVERASIICNQDLVEVVHLGLGE
                     APASNTPRVGGHLSLEELERAHIAGVLASSETLDQAARTLGIDASTLYRKRKLYGL"
     CDS             80670..80831
                     /codon_start=1
                     /locus_tag="KF707C_860"
                     /product="protein of unknown function DUF1328"
                     /protein_id="BAU71774.1"
                     /transl_table=11
                     /translation="MLSWALAFLVIAIVAAVLGFGGIAGTAAGIAKILFIIFLVLFVV
                     SFIMGRRSG"
     CDS             81092..82318
                     /codon_start=1
                     /locus_tag="KF707C_870"
                     /product="fused spore maturation proteins A and B"
                     /protein_id="BAU71775.1"
                     /transl_table=11
                     /translation="MLNGLWLGFFLVAAVAALGRWIGGDPGVWAAMVESLFAMAKLSV
                     EVMILLFGTLTLWLGFLRIAERAGLVDALGRALAPLFHRLMPEVPRGHPALGLITLNF
                     AANGLGLDNAATPIGLKAMRALQDLNPNPATASNAQILFLVLNASSLTLLPVSIFMYR
                     AQQGADDPTLVFLPILLATSASTLVGLLSVALVQRLRLWDPVVLAYLVPGALLLGGFM
                     AVLAGLSATALAALSSLLGNLTLFGIILCFLVLGALKRVPVYECFVDGAKEGFEVAKN
                     LLPYLVAMLCAIGVMRASGALDYGLDGIRVVVEWLGWDTRFVEALPTALVKPFSGSAA
                     RAMLIETMQTQGVDSFPALVAATVQGSTETTFYVLAVYFGSVGIQRVRHAVGCALAAE
                     LAGVLAAIGVCYWFFG"
     CDS             complement(82350..83387)
                     /codon_start=1
                     /locus_tag="KF707C_880"
                     /product="membrane protein, putative"
                     /protein_id="BAU71776.1"
                     /transl_table=11
                     /translation="MPLTAFKPQVLKLIELLQRHPRLIALYGFGSGLASFFLVERGAR
                     VAKVIAILLLVSWVWLMLENLFRRGVERLFGIELPPPLMRFLTQLIHQESLFFVLPFF
                     FVTTSWNSGQALFTGLLGVAALCSITDPVYNRHLAPRRWLFLAYHTLTLFAVLLAALP
                     LILQLTTAQSYRWALGTAVALSFISLFGVLRAQRWWRTLGLLGLTLALGGLGWVTRVW
                     VPPATLWLTEVAVSPELNDRTPGEGVDRVTANDLRARGLYAYTAINAPRGLNERIVHV
                     WRFKGREVDRIALDIHGGREAGYRAWTHKRNFPSDPVGRWQVQVLTEAGQMIGTLRFT
                     VTPSELPPKPR"
     CDS             complement(83479..85077)
                     /codon_start=1
                     /locus_tag="KF707C_890"
                     /product="aerotaxis sensor receptor protein"
                     /protein_id="BAU71777.1"
                     /transl_table=11
                     /translation="MKINLPVTGRAVAFDADANILSTTDPKGVITHVNPDFLAISGFS
                     ADELLGRSHNVVRHPDMPPAAFAHLWQTLKGGRSWMGLVKNRCKNGDHYWVSAYVTPV
                     QREGRVVEYQSVRTLPEPGQVEAAERLYAELREGRTPRVLKRPRLGLALRLPGGCALS
                     GLGVALLMAPLADSALLAAGAALASAALCGAWTLWQMRPLQPLLAKARSIADNPLGQW
                     LYCGRRDEFGELAFALRMLETEAGAVVGRIAESARQLADHADQMASSVSSTSQATRRQ
                     QAETEQVASAVEQMAYSVQEVARSAQQSATAADQTDSAASLGREEVEATRNRITRLEE
                     DVRRASQQVETLREHSGDITQVLGVIHGIAEQTNLLALNAAIEAARAGEAGRGFAVVA
                     DEVRALASRTQSSTEEIRGLIDTLQRGASQASEAMQRSREQAADSLHQALRASESLAL
                     INDQVSEISGMSLQIASAVEQQSVASEEIQRSLASIRLAADDNARNGGLSQHSALRVA
                     ELAGELQQLAQQFWERRRRVEGGR"
     CDS             complement(85074..87326)
                     /codon_start=1
                     /locus_tag="KF707C_900"
                     /product="sensory box/GGDEF family protein"
                     /protein_id="BAU71778.1"
                     /transl_table=11
                     /translation="MGLERQLKGMPGRMGLSRSEVELRCRYLDWHTEDATRLNARGPE
                     MEAVHHAFVERLYAHLDQFDPIAVILRDPATLQRLKRSQLDYYRRLWSGPYDREYVEN
                     RLRVGLVHQQVGVDLKWYLGAYRLYLDHMLDAMLPPGEGRDTFSSLLKAVFFDMALAI
                     DTYSCAQRQALEDSEARFARALRGANDGLWDWDLEQDRLYCSERWAAMLGVGRDSLGE
                     GSASWFARVHPDDLPGLRQAMDAHLRGDTPSLHHEYRIRRRDGGYLWVLVRGVAEEGR
                     MAGSQTDISERKASEQKLRHAARHDPLTGLANRLRLDELLHQALSRRQRPGAREAALL
                     FIDLDRFKLINDSLGHAMGDRVLVAVGQRLSRCLRPGDHLVRFGGDEFVVLLDDLACL
                     ADAEQVAQRMLDSLHQPLRLDDHDLAVSASIGITGLLLDGQAVDTLQAADLALYRAKE
                     AGKAQFARYSAELQATAQRRLALHNDLALALEREEFELHYQPICRIDGDRHRIIAVEA
                     LLRWRRDGRLESPLQFIPALEESGQIIAVGDWVLRRACRQLRRWQLAGLGELRCSVNL
                     SSRQLLQPDFAGRVAAILAESELAPASLVLEITESLLMQDSAETLACLRELAVLGVRL
                     ALDDFGTGYSSLGYLKRFPLQILKVDRSFIGGIPDDPELRVIARAIIGLGHSLGLEVV
                     AEGVERPGHLDFLHDEDCRYAQGYWFSRPRPATALEPLLRGECGFEGEGDLPGGIEWL
                     QEQQQGSTPA"
     CDS             complement(87489..87800)
                     /codon_start=1
                     /locus_tag="KF707C_910"
                     /product="hypothetical protein"
                     /protein_id="BAU71779.1"
                     /transl_table=11
                     /translation="MPRISPPLMLISPDRPLAERARRLLADDNLECAVLVDSGDCTRA
                     PLCHWLKDPPQGQAGQLRALLVETVSVLDDTRHAFRSRELGRLRKRLELALRELPALE
                     D"
     CDS             complement(87958..89646)
                     /codon_start=1
                     /locus_tag="KF707C_920"
                     /product="sodium-dependent phosphate transporter"
                     /protein_id="BAU71780.1"
                     /transl_table=11
                     /translation="MLTLLNLLSAVALLIWGTHIVRTGILRVYGANLRRLLSRSVRRR
                     PLAFAAGMGVTALVQSSNATALLVSSFVAQGLMMLAPALAIMLGADLGTALMARVLTL
                     DLSWLSPLLIFFGVIFFLTRKQTRAGQLGRVAIGLGLIILALQLIIAAAEPITSAKGV
                     KVLFSSLTGDVLLDALTGALFAMISYSSLAAVLLTATLAASKVISLKVALCLVIGANL
                     GSGVLALLSSSLQNPSGRRVALGSLLFKLAGCALVLPLVGPLANWIDSWPISNAELVI
                     AFHVLYNGVRCTLCLPLTVPMARFCDWLLPDRPQPDDVAKPRHLDPAALDTPSLALAN
                     AVRETLRMGDIVEQMLNNLVHLLRGGDPLLGKDIHRLDDDLDALYTAIKLYLARMPRE
                     DLGERDSRRWAEIIELTINLEQAGDIIERMLDDLRSKNSAQGRAFSEEGQAEIVSLHD
                     QLVENLRLALSVFLNGDLENAKRLRRAKQRFRILERRYAHAHVSRLHQQVVQSIETSA
                     LHLGLISDMKRLNSLFCAIAYAVLDNPDAPEAMDEDPASDVPQRYYEPEISSHR"
     CDS             complement(89944..90702)
                     /codon_start=1
                     /locus_tag="KF707C_930"
                     /product="integral membrane protein TerC"
                     /protein_id="BAU71781.1"
                     /transl_table=11
                     /translation="MEWLTSPEIWVAFFTLTALEIVLGIDNIIMIAILVGRMPPHLQA
                     RTRFFGLALAMVTRIALLLSITWIMRLTNDLFHLFGQGISGRDLILFFGGLFLLWKSS
                     TEMYHSLEGEDETGEQPSGAARNFIGTIIQIAIIDIVFSLDSVITAVGMVSHVPVMVA
                     AIIVAVLVMMLAAGTISDFIDRHPSLKMLALSFLVVVGTVLIAESFEVHVPKGYVYFA
                     MAFSLGVEALNIRARIARGRKEDPVKLRKDIPGQ"
     CDS             complement(90805..92112)
                     /codon_start=1
                     /locus_tag="KF707C_940"
                     /note="similarity to citrate transporter"
                     /product="uncharacterized transporter"
                     /protein_id="BAU71782.1"
                     /transl_table=11
                     /translation="MLTLLGFAMVICFMYLIMTKRLSALIALIIVPIAFALIGGFAAG
                     IGPMMLEGIGKLAPTGVMLMFAILYFALMIDSGLFDPPVRKILKLVKGDPLKVSMGTA
                     ALALIVSMDGDGATTYMICVAALLPLYSRLGMSPLIMAGLIILAGGIMNMTPWGGPTA
                     RAASALHVDPSDIFVPMIPAMAVGALALFGLAWAYGKRERARLGVLHLPDEEINHDEI
                     SVSQYPEARRPKLLWVNAGLTAALMVTLILGLLPLPVLFMIAFSIAMIINYPCLQQQK
                     ERVAAHAGNVLAVVGLIFAAGIFTGILSGTGMVEAMSKSLLAVIPPSMGPYLAVITAL
                     VSMPFTFFMSNDAFYYGVLPVLAEAASHYGISPVEMARASIVGQPVHLLSPLVPSTYL
                     LVGLAKVEFGDHQRFTLKWAVMICLCILLAALLLGVFPLFGAH"
     CDS             complement(92381..93307)
                     /codon_start=1
                     /locus_tag="KF707C_950"
                     /product="putative membrane protein"
                     /protein_id="BAU71783.1"
                     /transl_table=11
                     /translation="MLTLFQALWPLFALIVGGYLLRRWDFPGEAFWPAAERLNYFILF
                     PALLFSSLATAPLDNPALPRLALAVFIGLGAGWVALLLARRLLGWPAARFGALTQGLL
                     RFNTYLGLAAIGSLHGKDGLAIAALMLALMVPTVNLMSVWALTAERGVSLGGLLRPMA
                     RNPLILACLAGALVNLAGVGLPGGSDRLLNLLAVASLPLGLLCVGAALRPQELTGEIP
                     ALAWNCALRLLAMPALAFAVALGLRLPSMESAILVLFFALPTAPTAYVLTRQLGGDSH
                     LMAGIITLQTLLAGASLLLVMQLMTGSTSLAG"
     CDS             93409..93810
                     /codon_start=1
                     /locus_tag="KF707C_960"
                     /product="Gfa-like protein"
                     /protein_id="BAU71784.1"
                     /transl_table=11
                     /translation="MHQLHTGGCHCGQLRYQVEADLADVAHCHCSICRRTTGGIVTTW
                     ATVPLTGFRWTAGTPAQYASSASCTRYFCPNCGSHLALFTQLSPDSLDLTVATLDRPE
                     DSPPSRHIWVKSRLPWLHLDPQLPEEDEETL"
     CDS             complement(93838..95721)
                     /codon_start=1
                     /locus_tag="KF707C_970"
                     /note="FIG00953482"
                     /product="hypothetical protein"
                     /protein_id="BAU71785.1"
                     /transl_table=11
                     /translation="MLDDEGLSRAQRQASQQLLDDALAALPPSFIQRLDRVVRVGWSD
                     ELPDNGYGRATRFDALVLNRSLLPSLADGSAATQKTARVHGSVRRELLATVLHELTHL
                     YDRARLWSPAERTRQFRCRLQVASTGPVGLPGDCRGQDQRRFTLSDDPRLLDLAGWPQ
                     AVGRRGQREAENHQLARSPDPYELTNPREFVAVNMEYFLLDPSYACRRPALQRYFREH
                     FDWQPAQREACTQGYAYLNAGRDFARQPLGKLDPERVFEVDYLFAEANQNWASRWGHS
                     MLRLVICAPGRPRGPDCRLDLDQHLVLSYRAFVGDVQLSSWDGLTGAYPSRLFVLPLH
                     QVIEEYTKVELRSLASVPLTLDRRQLEHLVEHAAAMHWSYDGDYWFLSNNCAVETLKL
                     LRSGTDHPALKDLDSIMPNGLLKLLEGRGVADPTPLRDPKEALRLGYRFDSFRDRYQA
                     MFVILRERLRVPQENVEDWLELKAEQRRPWFNAADLRASAALLLLEQAAQRRQLLLAQ
                     DELKRNYLGSREQAGQTRFAKAGGTLEQMLANSGFLSRPAEMLQGGYGLPQDAEWRRL
                     EAESSSRQQTMRQLSDDLDREVRSLLEPRRLAELNATEANLKAIGEHLRQLHKASGGL
                     QLP"
     CDS             complement(95817..96137)
                     /codon_start=1
                     /locus_tag="KF707C_980"
                     /note="FIG00953248:"
                     /product="hypothetical protein"
                     /protein_id="BAU71786.1"
                     /transl_table=11
                     /translation="MRRSLSVAALALSLVAGAAQAQTLVATSNIIVRALDRTLDFTSD
                     TTTSIRDMKVVVAARDDAASFVASAGDIRGAQLEAAFSALRERFPQAREASDQALAET
                     ILAL"
     CDS             complement(96303..96620)
                     /codon_start=1
                     /locus_tag="KF707C_990"
                     /note="mostly Fe transport"
                     /product="outer membrane receptor proteins"
                     /protein_id="BAU71787.1"
                     /transl_table=11
                     /translation="MTSLRILGAAALLALAGSASATSFVVTTDAVVGAVAATSEATTD
                     VSSSFNDDKIVLAARDDAASFVASAGEIRGAHLEAALKHIRNVQPQLAASDLQLAQAI
                     LTL"
     CDS             complement(96725..96934)
                     /codon_start=1
                     /locus_tag="KF707C_1000"
                     /note="FIG00954150:"
                     /product="hypothetical protein"
                     /protein_id="BAU71788.1"
                     /transl_table=11
                     /translation="MDRTLTASSASTSPPAPVAPYLRLFATLVLWARNVRTRRQLASL
                     DDRALADVGISRGERLAELERPFWR"
     CDS             complement(97200..97415)
                     /codon_start=1
                     /locus_tag="KF707C_1010"
                     /note="FIG00954150:"
                     /product="hypothetical protein"
                     /protein_id="BAU71789.1"
                     /transl_table=11
                     /translation="MERTLSSDLIFESVEQSPKSSWVLRAASALLLWQRRIASRHQLA
                     RLDARLLADAGISEAQREAELRKPFWR"
     CDS             complement(97745..99238)
                     /codon_start=1
                     /locus_tag="KF707C_1020"
                     /product="acetyl-CoA hydrolase"
                     /protein_id="BAU71790.1"
                     /transl_table=11
                     /translation="MYSDRVRLPSLLDKVMSAAEAASLIQDGMTVGMSGFTRAGEAKA
                     VPEALAQRAKEQPLKISLMTGASLGNDLDKHLTEAGVLARRMPFQVDSTLRKAINQGK
                     VMFIDQHLSETVEQLRNHQLKLPDIAVIEAVAITEQGHIVPTTSVGNSASFAIFAKQV
                     IVEINLAHDTNLEGLHDIYIPTYRPTRTPIPLTRVDDRIGGTAIPIDPAKIVAIVITN
                     QPDSLSTVLSPDDETQAIADHLIAFFTREVEAGRLSNNLAPLQAGIGNIANAVMCGLI
                     ESPFENLTMYSEVLQDSTFDLIDAGKLRFASGSSITLSARRNGDVFGNLERYKDKLVL
                     RPQEISNHPEVVRRLGIIGINTALEFDLYGNVNSTHICGTMMMNGIGGSGDFARNAHL
                     AIFVTKSVAKNGAISSVVPMVSHVDHTEHDVDILVTEQGLADLRGLAPRERARVIIDN
                     CVHPDYRPALLDYFERACAKGGHTPHLLREALSWHINLEESGRMLVD"
     CDS             complement(99429..100865)
                     /codon_start=1
                     /EC_number="1.6.1.2"
                     /locus_tag="KF707C_1030"
                     /product="NAD(P) transhydrogenase subunit beta"
                     /protein_id="BAU71791.1"
                     /transl_table=11
                     /translation="MSMNLITVLYLVASVCFIQALKGLSHPTSSRRGNLFGMVGMAIA
                     VVTTVGLIYKLGADLATQGLGYVIVGLLVGGTAGSIMAKRVEMTKMPELVAFMHSMIG
                     LAAVFIAIAAVVEPQSLGIVAAMGDAIPAGNRLELFLGAAIGAITFSGSVIAFGKLSG
                     KYKFRLFQGAPVQFAGQHKLNLLVGLAIIGLGLYFTFTGNLQAFALLVALAFVIGVLI
                     IIPIGGADMPVVVSMLNSYSGWAAAGIGFSLNNSMLIVAGSLVGSSGAILSYIMCKAM
                     NRSFFNVILGGFGAEADAGGAAGEQQQRNVKSGSSDDAAFLLTNADSVIIVPGYGLAV
                     ARAQHALMELAEKLGHRGVTVKYAIHPVAGRMPGHMNVLLAEAEVPYEQVFEMEDINS
                     EFGQADVVLVLGANDVVNPAAKNDPKSPIAGMPILEAYKAKTVIVNKRSMASGYAGLD
                     NELFYMDKTMMVFGDAKKVIEDMVKAVD"
     CDS             complement(100868..101182)
                     /codon_start=1
                     /EC_number="1.6.1.2"
                     /locus_tag="KF707C_1040"
                     /product="NAD(P) transhydrogenase subunit beta"
                     /protein_id="BAU71792.1"
                     /transl_table=11
                     /translation="MDLISDGIYNLIIFVLAIYVGYHVVWNVTPALHTPLMAVTNAIS
                     AIVIVGAMLAAALTVTPLGKTMGTLAVALAAVNVFGGFLVTRRMLEMFKKKAPKAAAE
                     KH"
     CDS             complement(101195..102316)
                     /codon_start=1
                     /EC_number="1.6.1.2"
                     /locus_tag="KF707C_1050"
                     /product="NAD(P) transhydrogenase subunit beta"
                     /protein_id="BAU71793.1"
                     /transl_table=11
                     /translation="MHIGVPLETHAGETRVAATPETIKKLVSQGHQVTVQSGAGVSAC
                     IPDSAYEAVGATIGNDAAAFGADLVLKVVAPTEAELAHMRTGAVLVGMLNPFSNEIIA
                     RMNARGITAFALEAAPRTSRAQSLDVLSSQANIAGYKAVMLAANHYPRFMPMLMTAAG
                     TVKAARVLILGAGVAGLQAIATAKRLGAVIEASDVRPAVKEQIESLGAKFVDVPFETD
                     EERECAQGVGGYARPMPQSWMKRQARAVHERAKQADIVITTALIPGRKAPTLLHEATV
                     AEMKPGSVVIDLAAAQGGNCPLTEADQVVVKHGVTIVGHSNLAALVPADASALYARNL
                     LDFLKLVIDKDGQYHLNLEDDIVAACLMCRDGQVVRTNG"
     CDS             complement(102882..105398)
                     /codon_start=1
                     /locus_tag="KF707C_1060"
                     /product="hypothetical protein"
                     /protein_id="BAU71794.1"
                     /transl_table=11
                     /translation="MPRSGQTTPVPSSRLPRLPPGHIPRPGLVERLAAQDAQLRLLSA
                     PAGFGKSVLLNEFLRTHGGNGRVIWLNLAGQALSPGQLIAHLASELDRDLPALPAPQA
                     LQQLLAQRDAPLWLVLDDYPGQPPAELDDCIDQLLARALPELRLLVSTRQRPDWNLPR
                     LLLAGELLELDARQLAFDREHYERLVDRLAPQTAAAARDELWRATEGWCAGVRLQLTG
                     GSPSGAQGNHCWLKEYLDHELLNRLSEDEAQCLFALAHLPKVSATLCQQLWEDCDGTA
                     LFERLLARQAFCMPLDEHGSWYRVLPVVARVLRHRLSEAAATRLHLAACRVFIAAGQV
                     EDAIEQALCAGQPEAAANYLERLGQEWLTGEQHLARLLAWRSRLPGTLLESTPRLLTL
                     NAWGLLVSWRLDEADACIAKLGHFLPQPSARRNRKLLANWQALRGVLIALRSQSATHA
                     VRHCREALAELPEHDWMAILFCHSTLARIALAEGAQDEVQTRLHQALEIARRHGSLLF
                     EVLINLDCIRLLLLRGEHGRAQALLDQSFVLIGQRKQVDSLLLGRLHLIQAELHLIAD
                     RLDDAERALHTGLREARACADPFALAGFLGLAELHARRGHFDQAFQELREAERHMHCH
                     QVWRYAYSGLLNLQRMRVLARQGRWERIGPVALRIRRYFVGERPWMPQLDYPTLPLRN
                     QLLLARSRLETGHAEEAEALLLPLLDRCKVLQFIPLVCEVQLALAAAWHALGRDEAQG
                     LQRQALEQAERLGLACLLRDQPDAGQAAGSGGQASLLSQRERAVLQLLAEGFSNQEIG
                     GTLFISVNTVKTHTKKINSKLGVKRRTQAVMRAKALGLLV"
     CDS             complement(105545..106918)
                     /codon_start=1
                     /locus_tag="KF707C_1070"
                     /note="FIG002188"
                     /product="hypothetical protein"
                     /protein_id="BAU71795.1"
                     /transl_table=11
                     /translation="MTMKNSLLQGGVLALGLLALQAVAAVAPDEAAQLGASLTPLGAE
                     KAGNADGSIPAWTGGLPTNAATVDDRGFLGDPFPGEQPLFTITAANAEQYKDKLSPGQ
                     MAMFKRYSSTYRIPVYTSHRSAAVPQTIYDAAKQSALNTQPVDGGNGLTNFADSHYYA
                     FPIPKDGVQVMWNHITRYRGGNARRLVIQATPQTNGSFTPVQFQDEVAFPADMTALDK
                     EKSANVLLYFKQRVVAPSRLAGNVLLVHETIDQVKEPRLAWLYNAGQRRVRRAPQVSY
                     DGPGTAADGLRTADNFDLFSGAPDRYDWKLVGKKEMYIPYNSYKLESPQVKYKDIIQP
                     GHVNPDLTRYELHRVWEVVATLKPGERHIYAKRHYFIDEDSWQIAYADHYDGRGQLWR
                     VGEGHASYHYQRQVSAYAVETLYDLIAGRYIALGLKNEEKRGIEFGFAANGADYTPAA
                     LRNAGIR"
     CDS             complement(106930..108696)
                     /codon_start=1
                     /locus_tag="KF707C_1080"
                     /note="FIG067310"
                     /product="hypothetical protein"
                     /protein_id="BAU71796.1"
                     /transl_table=11
                     /translation="MTTRTMRGIFPPHLLAAAVALGCSDQIHAITFNIGDIEAQFDSS
                     LSVGASWAVRAPDPEFYSTASGGEALTRTSDDGRLNFKKGETFSKIFKGIHDLELKYG
                     DTGVFLRGKYWYDFELKDEHRLFYDIDDHNRKEGAQASGAQLLDAFLYHNYSLGDLPG
                     SFRVGKQVVSWGESTFIGNSINSINPIDAAAFRRPGAEIKEGLIPVNMLYLSQSLTEN
                     LSAEAFYQLEWDQTVADNCGTFFATSDVVADGCVDRLIVSGPDLPPGVSPNTGGTLYI
                     PRAGDRDARDGGQFGVALRWFVPELNDTEFGAYAMNYHSRGPIFSTLRTTTPSLAIIP
                     GAPGARYFIEYPEDIRLYGLSFQTNIEGTSVAGELSFRPNMPLQLNSTDLSFAALGIP
                     SVPIFESGHARNVAGEEIHGYMRKPVTQAQVTATQFVDQVMGASRLTLVAEVGYNHIG
                     GISDDIGDLRFGREPIYGPGQLSSQPLCLALTAASPNQRECNDKGFYTSSSWGYRARA
                     VWDYPNVVAGINLSPSIAWSHDVDGYGPNFNEGSKAVSLGLSADYQNTYTASLSYTDF
                     FGGHYNTTTDRDFVAVSFGVNF"
     CDS             complement(108887..109795)
                     /codon_start=1
                     /locus_tag="KF707C_1090"
                     /note="LysR family"
                     /product="transcriptional regulator"
                     /protein_id="BAU71797.1"
                     /transl_table=11
                     /translation="MRRKIPSTGALVAFESAARHQSFTKAAEELALTQSAICRQIAGL
                     EEFLGLELFRRSRRGVKLTEAGLAYSRRIAAQLDAVERDTLAVMGQQGAMTVELAIVP
                     TFGTQWLLPRLKDFQRLHPEVTVNLTNRTRPFLFADTDFDAALYFGDAEWSGTRADFL
                     MHENALPVCSPALLEGRDRLDAETLARLPLLQQTTRPYAWRQWFGSQGMTVARDLSGP
                     RYELFSMLAQAAMHDMGVALIPPFLIQRELADGRLVIANPHSFRSDKAYYLIIPERKL
                     ESAALGAFRHWLVDAARLYRHEAGLD"
     CDS             109988..111169
                     /codon_start=1
                     /EC_number="1.3.99.7"
                     /locus_tag="KF707C_1100"
                     /product="glutaryl-CoA dehydrogenase"
                     /protein_id="BAU71798.1"
                     /transl_table=11
                     /translation="MAAKASFNWIDPLLLDQQLTEEERMVRDSAYQFAQDKLAPRVLE
                     AFRHEQTDPAIFREMGEVGLLGATIPAEYGGSGLNYVCYGLIAREVERVDSGYRSMMS
                     VQSSLVMVPINEFGSQAQKQKYLPKLASGEWIGCFGLTEPNHGSDPGSMITRAKKVDG
                     GYRLSGAKMWITNSPIADVFVVWAKDDAGEIRGFILEKGWQGLSAPVIHGKVGLRASI
                     TGEIVMDNVFVPEENAFPDVRGLRGPFTCLNSARYGISWGALGAAEYCWHTARQYVLD
                     RNQFGRPLAANQLIQKKLADMQTEITLALQGCLRLGRMKDEGTAAVEITSIMKRNSCG
                     KSLEIARVARDMMGGNGISDEFGVARHLVNLEVVNTYEGTHDVHALILGRAQTGIQAF
                     F"
     CDS             111241..112464
                     /codon_start=1
                     /locus_tag="KF707C_1110"
                     /note="bile acid-inducible protein F"
                     /product="L-carnitine dehydratase"
                     /protein_id="BAU71799.1"
                     /transl_table=11
                     /translation="MAGALSHIRVLDLSRVLAGPWSGQILADLGAEVIKVERPGAGDD
                     TRAWGPPFLKGADGRDTSEAAYFLSANRNKQSVTIDFTKPEGQALVRELASRSDILIE
                     NFKVGGLAAYGLDYESLKALNPRLIYCSITGFGQFGPYAKRAGYDFMIQGLGGLMSIT
                     GRSDQEEGAGPVKVGVALTDILTGLYSSVAMLAALASRELTGKGQHIDMALLDVQVAC
                     LANQAMNFLTTGNPPRRLGNAHPNIVPYQDFPTADGDFILTVGNDGQFRKFCEVAGHR
                     EWADDPRFSTNKARVAHRAELIPLIRQATVFKTTAEWVAALEAVGVPCGPINDLAAVF
                     ADPQVQARGLRVELEHALAGVVPQVASPLRLSETPVEYRLPPPLLGEHTDQVLARVLG
                     LTEERIAQLHREQVI"
     rRNA            112918..114409
                     /locus_tag="KF707C_r10"
                     /product="16S rRNA"
     tRNA            114493..114569
                     /locus_tag="KF707C_t10"
                     /product="tRNA-Ile"
     tRNA            114602..114677
                     /locus_tag="KF707C_t100"
                     /product="tRNA-Ala"
     rRNA            114908..117807
                     /locus_tag="KF707C_r110"
                     /product="16S rRNA"
     rRNA            117936..118055
                     /locus_tag="KF707C_r120"
                     /product="23S rRNA"
     rRNA            118477..119968
                     /locus_tag="KF707C_r130"
                     /product="5S rRNA"
     tRNA            120052..120128
                     /locus_tag="KF707C_t110"
                     /product="tRNA-Ile"
     tRNA            120161..120236
                     /locus_tag="KF707C_t120"
                     /product="tRNA-Ala"
     rRNA            120467..123366
                     /locus_tag="KF707C_r140"
                     /product="5S rRNA"
     rRNA            123495..123614
                     /locus_tag="KF707C_r150"
                     /product="23S rRNA"
     CDS             124011..125606
                     /codon_start=1
                     /locus_tag="KF707C_1120"
                     /product="probable low-affinity inorganic phosphate
                     transporter"
                     /protein_id="BAU71800.1"
                     /transl_table=11
                     /translation="MTNPTTIPSASPSGISPISLFFSTLFIAVTGYFLFWGVDYVQGN
                     HILLFVLATLFGVFMAFNIGGNDVANSFGTSVGAGTLTIKQALIIAAVFEVSGAIIAG
                     GHVTQTIRGGIVDLGAMQVAPMDFVYIMMSALIAAALWLLFATKRGYPVSTTHSIIGA
                     IVGSSITLGILMQGSDAAFELVQWGKIGEIVISWVLSPLLGGLVAFLLFNQIKKHILS
                     YNERAEDRLEALREQKRAHKAQHQEGFDRLSELQKVAYTHAMARDQQLMSDRDFDPED
                     LESDYFKGLYHLERQREDIASHRALETWVPLVAAIGAMVIGSMLLFKGLKNLELGLTT
                     LNSYLLLGMIGVGVWMSTYVFARSLRDEPLGRATFLIFSWMQVFTACGFAFSHGANDI
                     ANAIGPFAAIIDVLRTGETGTQAAIPTIAMITFGVALIVGLWFIGKEVIQTVGHNLTQ
                     LHPASGFSAELAAAGVVMAASVMGLPVSSTHILIGAVLGIGLVNRQTNWGLMKPIGLA
                     WIITLPAAALLSAGAFLVLRSLL"
     CDS             125751..125909
                     /codon_start=1
                     /locus_tag="KF707C_1130"
                     /product="hypothetical protein"
                     /protein_id="BAU71801.1"
                     /transl_table=11
                     /translation="MKLPLTPPLKTSYWLETAEAGRPARTPIAGNHKVDFLVVGSGFV
                     GLWRALTL"
     CDS             126779..127237
                     /codon_start=1
                     /locus_tag="KF707C_1140"
                     /product="probable amino acid permease"
                     /protein_id="BAU71802.1"
                     /transl_table=11
                     /translation="MGINQRSEAESGLKAHALGSLESIAIIIGAGVFSMAYAARKVGY
                     LPRLACLAITSFFCIITLLYMAEASLRTRGNNQLSGLSRRYLGTFGGVPMGIIPILLL
                     NAARRSGDRQPEFTCGWYAHPSIQVAIIAIFAASGVYAVASALGMLPASW"
     CDS             127300..127626
                     /codon_start=1
                     /locus_tag="KF707C_1150"
                     /product="regulator of polyketide synthase expression"
                     /protein_id="BAU71803.1"
                     /transl_table=11
                     /translation="MPLNLRDLLGLPERRSRLLSGAAGLDRPVRWAHVCELPDPTEWL
                     GEGDLLMTTGLGTPATAEEQRRYLHRLAFRWTRSSSVAGSPHGGQCAFRQSEAPDKAD
                     GLRGSR"
     tRNA            complement(127672..127748)
                     /locus_tag="KF707C_t130"
                     /product="tRNA-Arg"
     CDS             complement(127940..128074)
                     /codon_start=1
                     /locus_tag="KF707C_1160"
                     /product="hypothetical protein"
                     /protein_id="BAU71804.1"
                     /transl_table=11
                     /translation="MHLCLLHTGATRGAGAGCRSSAHAGLARRESTERPGYPGTAGGV
                     "
     CDS             128069..129520
                     /codon_start=1
                     /EC_number="1.2.1.20"
                     /locus_tag="KF707C_1170"
                     /product="glutarate-semialdehyde dehydrogenase"
                     /protein_id="BAU71805.1"
                     /transl_table=11
                     /translation="MQLKDAALFRQQAFIDGAWVDADNGQTIKVNNPATGEIIGSVPK
                     MGTAETRRAIEAAERALPAWRALTAKERSTKLRRWFELMMENQDDLGRLMTIEQGKPL
                     AEAKGEIAYAASFIEWFAEEAKRVYGDVIPGHQPDKRLIVIKQPIGVTAAITPWNFPS
                     AMITRKAGPALAAGCTMVIKPASQTPYSALALMVLAERAGIPKGVLSVVTGSAGEVGG
                     ELTSNPIVRKLSFTGSTEIGRQLMAECAKDIKKVSLELGGNAPFIVFDDADLDAAVEG
                     ALISKYRNNGQTCVCANRLYVQDGIYDAFAAKLQAAVAKLKIGNGLEEGTTTGPLIDE
                     KAVAKVQEHIADAVSKGAKVLSGGKPHALGGTFFEPTILVDVPKSAAVAKEETFGPLA
                     PLFRFKDEADVVAMANDTEFGLASYFYARDLGRVFRVAEALEYGMVGINTGLISNEVA
                     PFGGVKASGLGREGSKYGIEDYLEIKYLCLGGI"
     CDS             complement(129607..129807)
                     /codon_start=1
                     /locus_tag="KF707C_1180"
                     /product="hypothetical protein"
                     /protein_id="BAU71806.1"
                     /transl_table=11
                     /translation="MPPVGAVAAYDDRLRGLAGGSFLQGWSWGAARSFAPCPVWGSLQ
                     GLNTVLLRESRIWPSFPISLVK"
     CDS             129853..131130
                     /codon_start=1
                     /EC_number="2.6.1.48"
                     /locus_tag="KF707C_1190"
                     /product="5-aminovalerate aminotransferase"
                     /protein_id="BAU71807.1"
                     /transl_table=11
                     /translation="MSKNESLLKRRAAAVARGVSQIHPIVAERAENATVWDVDGREYI
                     DFAGGIAVLNTGHLHPKVVAAVQEQLTKLSHTCFQVLAYEPYIELCEEIAKRVPGDFA
                     KKTLLVTSGSEAVENAVKIARAATGRAGVIAFTGAYHGRTMMTLSLTGKVVPYSAGMG
                     LMPGGVFRALAPCELHGVSEDDSIASIERIFKNDAQPQDIAAIIIEPVQGEGGFYVNS
                     KAFMLRLRALCDQHGILLIADEVQTGAGRTGTFFATEQLGVVPDLTTFAKSVGGGFPI
                     SGVCGKAEIMDSIAPGGLGGTYAGSPIACAAALAVLKVFDEENLLARSQEVGERLKAG
                     LREIAAKHKVIGDVRGLGSMVAIELFEGGDESKPAAELVGKIVARAREKGLILLSCGT
                     YYNVIRFLMPVTIPDAQLDKGIAIVAECFDELA"
     CDS             131381..132589
                     /codon_start=1
                     /locus_tag="KF707C_1200"
                     /product="response regulator"
                     /protein_id="BAU71808.1"
                     /transl_table=11
                     /translation="MPTPKVPHILIAEPDPWTSDLLAQLVLDVRPDAKVMQVADGREA
                     LARCKRGLPDLVIADGELGGIDGVELLRQLRRHPRLPALPFILISGRVDATSVRAVRP
                     LAPSAYLGKPFNAAKLRKRLVALLPAAEERAGRLEPALLLNSLAEYLDSVREEGQGAP
                     LLGDVREAVSQSLQADQVDLRDLDEVFSRDPQITARLIAAANSAAQHLGMPCQTLAQA
                     MQRLGITRVLNLVLGMALERNARLRDPRLAELAETVWRSAQRSAELGYWLASELDLDA
                     ELCYTAGLLHNIGELALLRSLQDWQDAGGSLGNEELEDVLRRRAASFGSALRIRWRLP
                     FGLRELVAAFHGLGSGVFSREALVLNLCAALLRLPDDQPLASLLGERSARLLRLDPRL
                     LERIPQRLLR"
     CDS             complement(132596..132718)
                     /codon_start=1
                     /locus_tag="KF707C_1210"
                     /product="hypothetical protein"
                     /protein_id="BAU71809.1"
                     /transl_table=11
                     /translation="MGFSHGWPRSQTLLHPRPIDGRPGFQRTLQQTSQWHRHRP"
     CDS             132704..133921
                     /codon_start=1
                     /locus_tag="KF707C_1220"
                     /product="response regulator"
                     /protein_id="BAU71810.1"
                     /transl_table=11
                     /translation="MAEPQQAPRVLIADPDRWSAELLAELVRKARCDANLKVLADSNA
                     VLEQCVDGWPDLLIVDYGLPGIGGLELLREVRRQRRHPPVPFFLLTDRVDAASVRAAL
                     PLAPTAYLAKPFNTEDLLKRLRNLLLEPGEEIACPMPAVDATRELDDYLSEARDGSAG
                     APLLTEVLEALELALNAHQRDLADLEPLFRRDPQLTGQLIAAANSAARHVGSACQTLP
                     QALSRLGAKYSLNLALGLALQRSVSLGDPLLLPHGERIWQQSQRTAETARWLAQCLEG
                     DAERCYTAGLLHLLGDLAVLRSIQAWRDSGGRALVDDDVEAALRKHGAPFGSALRTRW
                     RLPLELRQLIAAAFQLGGGVHSRDGLILHIARLVAELPEGADARPLARHKAARMLGLD
                     ASVLASKPSVMPG"
     CDS             complement(133918..134508)
                     /codon_start=1
                     /locus_tag="KF707C_1230"
                     /note="glutathione-dependent"
                     /product="2-hydroxychromene-2-carboxylate isomerase
                     family protein"
                     /protein_id="BAU71811.1"
                     /transl_table=11
                     /translation="MTKTLEFYFDLGSPASYLAWTQLPGICARQSAELRYRPMLLGGV
                     FQATGNASPAAVPAKARHSMIDLQRFARRYGVPMHFNPYFPINTLTLMRGAIGLQLRQ
                     PERFEAYLEAMFRALWENKRNLGDPAVLAATLQDAGFDPQALLSLASDQAVKDALKSA
                     TEEAVRRGVFGAPTCFVGDEMFFGQDRLDFVEEALA"
     CDS             complement(134580..135320)
                     /codon_start=1
                     /locus_tag="KF707C_1240"
                     /note="associated with 2-hydroxychromene-2-carboxylate
                     isomerase family protein"
                     /product="short-chain dehydrogenase"
                     /protein_id="BAU71812.1"
                     /transl_table=11
                     /translation="MPSEPHNKKVVLVIGAGDSTGGAIARRFAREGYIACMTRRNAEK
                     LQPLVDAIRAEGFEAHGFGSDARKEDEVAELVETIERDIGPIEAFVFNIGANVPCSIL
                     DETARKYFKIWEMACFSGFLTSQAVARRMVARGRGTLLFTGATAGLRGAAGFAAFAGA
                     KHALRALAQSMARELGPKNIHVAHVVVDGAIDTDFIRDNFPERYALKDQDGILDPEHI
                     AENYWYLHSQPRDAWTFELDLRPWIERW"
     CDS             135410..135982
                     /codon_start=1
                     /locus_tag="KF707C_1250"
                     /note="TetR family"
                     /product="transcriptional regulator"
                     /protein_id="BAU71813.1"
                     /transl_table=11
                     /translation="MRYSASHKEETREKLLESSAALAKRGGFATTGVDGLMKAIGLTG
                     GAFYSHFPSKDDLFSAIVQRELSRSLIGRITQESGFSRDRLDRCLDHYLCMAHVRHPE
                     SGCAIPALGAEIARADEAVRERAEHWMQQLQRAWAEILGDDELAWALIAQCVGALVVA
                     RMLASETTQAEVLASSRSLLDRVLDERLEQ"
     CDS             complement(135971..136891)
                     /codon_start=1
                     /locus_tag="KF707C_1260"
                     /note="LysR family"
                     /product="transcriptional regulator"
                     /protein_id="BAU71814.1"
                     /transl_table=11
                     /translation="MLLANALRKIDFQDLLVFLEICERQHLGEVAEALNLSASSVSYS
                     LKKLRGCFDDELFIATRSGMRPTRKALAMRPQVRTMVEMMNGCHGDQGAFDPCQAPRT
                     FRLCAPEYFELLILPALLRRLNDAGYPVSLDVQRLGRDIPAEALVQGGLDLALGFGPN
                     LHRAHPALMSLALLKDELLCIRDAASAPVNDLDDFCARRQVFPTPWNSERNMIDGWLQ
                     EQGRARQIAARTNNYLAALQLIPHSDLLLVLPERVYERLGDARTARSPLPGLPSFSLE
                     MLWAQPFDQDPANLWLREQILSVCAEQSLL"
     CDS             complement(136952..137854)
                     /codon_start=1
                     /locus_tag="KF707C_1270"
                     /product="integral membrane protein"
                     /protein_id="BAU71815.1"
                     /transl_table=11
                     /translation="MRQPPSPALGAHASMLLWALLVALSFFAAAEVNPALDALPLTAL
                     RLLLSGCLFLPFLLLRRPALPGARALLAHAVLGALLAMYFGGLFEALKRTRALDTALL
                     YVSVPLLTLGAERLLLDRPVLQRLWPTLVAALGALALLGLENAHFDAYAYGVYGLGCL
                     AMAGYGPLSQRLKPWLGPERGAASLASGNLLAGGVLLALACTLGQRWEGLQGLSSRDL
                     GWLLYLALTATLATFWLLHRAIHWLPPATVIAYSYVSGLFALLLQSAWLQQMPAPLAW
                     LGTGLIALGIAWLARLSPVRVATT"
     CDS             137819..137953
                     /codon_start=1
                     /locus_tag="KF707C_1280"
                     /product="hypothetical protein"
                     /protein_id="BAU71816.1"
                     /transl_table=11
                     /translation="MGAQGGGGWLAHGMAPCWTEGHCSRPQWVRQTRNADGHSKKCMT
                     "
     CDS             138051..138920
                     /codon_start=1
                     /locus_tag="KF707C_1290"
                     /product="hypothetical protein"
                     /protein_id="BAU71817.1"
                     /transl_table=11
                     /translation="MALPTPGDELAAASRATLLEDSHFLRDAASERIQQLRFSFREPP
                     LEEGQQPAWARAFGSRGSVDADHRAPRRERDLAGMLLGAERPLGDWLVGGMGGYSATS
                     MDLSGAGADIHSLHLGAYAGTKVYNQIGVKLGAAWSAHDGDGRAADGDADQVFGELGY
                     SLDFRDFSVEGYTELAYLRLDSDAIATTGSQRDELGYGTFGLRGTTRFDLGSGRRLTT
                     RLGAGWRHAFSDSRLQDASGGDAALLRDAFRLDLGADYQLVEAAYLGLFYNGTYAEDG
                     RDNGLTARLSLRF"
     CDS             complement(139002..139700)
                     /codon_start=1
                     /locus_tag="KF707C_1300"
                     /note="Crp/Fnr family"
                     /product="transcriptional regulator"
                     /protein_id="BAU71818.1"
                     /transl_table=11
                     /translation="MNEFKHLPDLLLTGHWFSQLPVGLRDALLAMAQLRRLAPGQRLF
                     RRGDPPCGLYAVLEGAMRVGSIGESGKEALLVLVEPPHWFGEISLFDGQPRTHDAFAE
                     GQVTLLHLPQVPLLALLEREPRYWREIALLMSQKLRLAFIALEEMSLLPAPQRLARRL
                     LMIAEGYGALSGQRRVLHLAQEPLAMMLAISRQTTNQILKELEAQGAVRLTYGEIEIL
                     DPDLLKRAAQGKTP"
     CDS             139786..140310
                     /codon_start=1
                     /locus_tag="KF707C_1310"
                     /note="FIG028593:"
                     /product="membrane protein"
                     /protein_id="BAU71819.1"
                     /transl_table=11
                     /translation="MKTLIDHLGQYAEYHRDRRNIATHFVGIPMIVLAVAVLLSRPGF
                     EAFGLWLSPAALVSLLSARFYFRLDGAYGLVMAMVLLLCLWVGAGLAVQSTALWLGVG
                     LALFVVGWIIQFVGHHYEGRKPAFVDDLSGLIVGPLFVLAELGFLMGLRREVERAVEE
                     RAGPTCIREKKAAV"
     CDS             complement(140332..141066)
                     /codon_start=1
                     /locus_tag="KF707C_1320"
                     /product="hypothetical protein"
                     /protein_id="BAU71820.1"
                     /transl_table=11
                     /translation="MIRKVLLYPLFWLLLALSDPAHAQLSAATLAQVHACRATSSLLL
                     FRGEGFQDTHAARMKADLAALDTAYRRIADPGETLASAHANLLEQLRRGATFGPREED
                     VPWRYPQELAKALRDFLIAARTREDASEADALPAKVEYLNVQYLSRAYIGTFEIARED
                     GGIYVGQDERLLLPAIDQALAPLDDKADPSLARLKTRWSFLKTALADLNSQSNALVSA
                     SGRPYAPMVVDRHARSMSTALLAKGD"
     CDS             complement(141254..142243)
                     /codon_start=1
                     /EC_number="3.6.3.25"
                     /locus_tag="KF707C_1330"
                     /product="sulfate and thiosulfate import ATP-binding
                     protein CysA"
                     /protein_id="BAU71821.1"
                     /transl_table=11
                     /translation="MSIEIRNVSKTFGAFRALDDINLDIHSGELVALLGPSGCGKTSL
                     LRIIAGLETPDAGSIQFHGEDVSGHDVRDRNVGFVFQHYALFRHMTVFDNVAFGLRMK
                     PRGERPSEKRIAEKVHELLNMVQLDWLADRYPEQLSGGQRQRIALARALAVEPKILLL
                     DEPFGALDAKVRKELRRWLARLHEDINLTSVFVTHDQEEAMEVADRIVVMNKGVIEQI
                     GSPGEVYEKPASDFVYHFLGDSNRLHLGDERHLLFRPHEVSLSRGEEAEHRAAQVRDI
                     RPLGAITRVTLKVEGQDELIEAEVVKDHDSLVGLVRGETLFFKPKAWQKAVGA"
     CDS             complement(142247..143110)
                     /codon_start=1
                     /locus_tag="KF707C_1340"
                     /product="sulfate transport system permease protein CysW"
                     /protein_id="BAU71822.1"
                     /transl_table=11
                     /translation="MSSATLTSVSAARRGSAWGRRLLIGAAWLAFVLFLVLPLLVVLS
                     EALKMGLGTFFAAILEPDALSALKLTLIAVGISVPLNLVFGVAAAWCVSKYEFRGKSL
                     LVTLIDLPFSVSPVIAGLIYVLLFGAQGYFGEWLMDRDIQIVFAVPGIVLATLFVTVP
                     FVARELIPLMQEQGTQEEEAARLLGASGWQMFRHVTLPNIKWGLIYGVVLCTARAMGE
                     FGAVSVVSGHIRGVTNTLPLHVEILYNEYNHAAAFSVASLLLALALCILLLKQWSESR
                     LSRLRHSDAEE"
     CDS             complement(143121..143939)
                     /codon_start=1
                     /locus_tag="KF707C_1350"
                     /product="sulfate transport system permease protein CysT"
                     /protein_id="BAU71823.1"
                     /transl_table=11
                     /translation="MSRRTSPVIPGFGLTLGYTLVYLSLLVLIPLGALFLKTFDLTWA
                     QFWNIVSAPRVLAALKLSFGTALAAAVLNGIIGTLLAWVLVRYEFFGRKVIEAMVDLP
                     FALPTAVAGIALTALYAPAGLVGQFATDLGFKIAYTPLGITLALTFVTLPFVVRTVQP
                     VLADIPREVEEAAACLGAKPLQVFRHVLLPALLPAWLTGFALAFARGVGEYGSVIFIA
                     GNMPMKTEILPLLIMVKLDQYDYAGATAIGVLMLVVSFLLLLLINLLQRRIETP"
     CDS             complement(144026..145021)
                     /codon_start=1
                     /locus_tag="KF707C_1360"
                     /product="sulfate and thiosulfate binding protein CysP"
                     /protein_id="BAU71824.1"
                     /transl_table=11
                     /translation="MSIRRFALATLASALIAGPAAATELLNVSYDPTRELYQDYNAAF
                     AKHWKAQGGDDVKVQQSHGGSGKQARAVIDGLRADVVTLALAGDIDELHKLGKLIPEN
                     WQARLPDNSTPYTSTIVFLVRKGNPKGIKDWGDLTKAGVEVITPNPKTSGGARWNFLA
                     AWAWAKKTYGSDAKAQEYVKALYQQVPVLDTGARGSTITFVNNNIGDVLLAWENEAFL
                     ALKEQGGENFEIVAPSLSILAEPPVSVVDRNVDKKGTRKVAEAYLQYLYSEEGQRIAA
                     KHFYRPRNEKVAAEFASQFPKLDLVTVDKDFNGWKEAQPRFFNDGGIFDQIYQAH"
     CDS             complement(145138..145320)
                     /codon_start=1
                     /locus_tag="KF707C_1370"
                     /product="hypothetical protein"
                     /protein_id="BAU71825.1"
                     /transl_table=11
                     /translation="MSAPLRSLEGQDDAALLREIQNALHGLRFGSVEITLHNGQVVQI
                     ERKEKFRLQPPNNRTS"
     CDS             complement(145467..147371)
                     /codon_start=1
                     /locus_tag="KF707C_1380"
                     /product="diguanylate cyclase/phosphodiesterase domain 2
                     EAL protein"
                     /protein_id="BAU71826.1"
                     /transl_table=11
                     /translation="MRSKFNALRLVLTYFVLASLWVLFSDRVLLGLVGDRDLLAELQT
                     VKGLAFVAVTSLLLFGLICLHLRSLRSYLDARRAHESSLRQAAAVFDATQEGVLVTDA
                     TRSIVHVNRAFARITGYEEAEVLGHDPRLFSSGRHSREFYNAMWHALDSRREWSGEVW
                     NRRKDGEIYPLWQNIRAIHDEDGVLTHYVAVFSDISAIKRSQNELDFLAHHDPLTNLP
                     NRLLFTERVEQVLERCRREHRNGAILLMDLDHFKHINESLGPSQGDLLLKMVGTRLQT
                     LLEGGMTLARLGGDEFGLLWDNCPLADQAAALAERIRSALATPFRIGGHDLFISTSLG
                     ISLLPEEDDNVERVMRNADSALFKAKSAGRDSYAFYSQELTAQAQQRVEMVSALRVAL
                     ERDQLRVHYQPIRRLADGRLIGFEALVRWEHPERGLVSPGEFLPVAEDSGLIGGIDVW
                     VLERACRQIQQWLEQGHELDFVAVNLSCRLFRRTELEGQVARVLAATGLPPGYLELEI
                     TESAVMEDPDTAEALLSRLRQLGVRLAIDDFGTGYSSLQRLKRLPVHKLKIDQSFVRG
                     LPADQNDIAIARAVTALGHSLGLAVLAEGIETADQATFLRDLGCEYGQGYLFSRPVPA
                     EEVERLWSPV"
     CDS             147548..148732
                     /codon_start=1
                     /EC_number="1.14.19.1"
                     /locus_tag="KF707C_1390"
                     /product="fatty acid desaturase"
                     /protein_id="BAU71827.1"
                     /transl_table=11
                     /translation="MWYNGILDLSLWQLVAVTLVLTHITIVSVTVYLHRYSAHRSLEL
                     HPALKHFFRLWLWLTTAMNTREWTAIHRKHHAKCETVDDPHSPVVKGLWTVLRQGAEL
                     YQAEAKNEETLRIYGKNCPDDWLERNVYGRYPIGGVTLMALIDLALFGAAGITIWAVQ
                     MMWIPVWAAGVINGLGHAIGYRNFECRDAATNLVPWGILIGGEELHNNHHTYPNSAKL
                     SVKSWEFDMGWAWIRLFSLLGLAKVQRVAPIAHRVEGKGSLDMDTAMAILNNRFQIMA
                     QYRKLVISPLVKQELAKADESVRHLFRRAKRLLSRETSLLDESHQARIAAMLEQSQAL
                     KVIYEKRLALQQIWVKTSANGHEMLAAMKEWIHEAETSGIQSLRDFAEQLKTYSLRPA
                     TA"
     CDS             complement(149324..150406)
                     /codon_start=1
                     /locus_tag="KF707C_1400"
                     /product="mobile element protein"
                     /protein_id="BAU71828.1"
                     /transl_table=11
                     /translation="MLAGTYRPSPVRRVLIPKPEGGERKLGIPTVTDRLIQQALLQIL
                     QPLLDPGFSDHSYGFRPGRSAHQAVLAAQRYIHSGRNILVDVDLEQFFDRVDHDLLIA
                     RLSRKVTDRGVLRLVRAYLNSGTLIDGVVVASERGTPQGGPLSPLLANVLLDEVDKEL
                     ERRGHCFVRYADDANVYVRSLKAGQRVMAVLRRLYDRLRLQVNERKSAIASAFGRKFL
                     GYSFWLSAQGEIKRGVASQALQRFKSRIRQLTSRNGGRSVSQVVESLRPYLLGWKAYF
                     GLSQTPRRWRGFDEWIRRRLRAIQLKQWKTGRRTYRELRKLGAWPDLAAAIAGNSHRF
                     WHNSVGLIHGVLTVAWFDRLGLPRLC"
     CDS             complement(151298..151501)
                     /codon_start=1
                     /locus_tag="KF707C_1410"
                     /product="hypothetical protein"
                     /protein_id="BAU71829.1"
                     /transl_table=11
                     /translation="MQRNLIATAFFAVFSLFFSQLTLAEESSAFVARNAALAEQRAAA
                     AHQDAVAKQNATPQRAEKAASDS"
     CDS             complement(151591..152556)
                     /codon_start=1
                     /locus_tag="KF707C_1420"
                     /product="transcriptional regulator"
                     /protein_id="BAU71830.1"
                     /transl_table=11
                     /translation="MDTLHCMRVFVRVIDTGSFTAAAQAMDLSTAQVSRLVSELEQQL
                     QARLLHRTTRRLALTEVGERYLQRCRQILGEVDEAAAEARGAHLKPHGRLRVHTMTGL
                     GLQHLTHLVARYTERYPEVVVELTLSQRTPDLLEDGHDVIITFARELPDSQMVAQVLG
                     SMFSVLCAAPDYLKKRGVPMEPADLRQHRYLRLLDPLYHDNWLFDGEDSEFDVLPAES
                     FQVNVAESLAKAAQAGMGVCLLPSFVACPPVRDGKLLRLLPEYRLRERSIYAVYPSRR
                     FLDAKIKTWVEFLKAELPPLLAQDEALLEDPKHWAINSKLLRQQK"
     CDS             152708..153769
                     /codon_start=1
                     /locus_tag="KF707C_1430"
                     /product="putative secretion protein"
                     /protein_id="BAU71831.1"
                     /transl_table=11
                     /translation="MTPDQKFARRVQVAIVLFVLLFAYFLAADLWMPITPQAQLTRPV
                     LRVAPRVEGQVLEVAVRNNQHVDAGQLLFRLDPEPFRLAVRAAELALEQARQDNRQLD
                     AAIAAARAELAAAQATASELQRQCARLARLVRSQHVSRQLFEQTEARRQAAQAGVAAA
                     GARVRELLVQRGAEGDDNLRLRQARNALERARLQQDFSEVRAERAGTLSNLQLSAGAY
                     LAAGSPVAALVADEADISADFREKALRYVSLEDGASVVFDALPGQVFAARVSAIDAGV
                     KEGQLDANGDLAAPTISDRWVRDAQRQRLHVQLTEALPRVLPSGAKATVQLYPRDSGL
                     ADLFGRLQITVISLLHYLY"
     CDS             153774..154802
                     /codon_start=1
                     /locus_tag="KF707C_1440"
                     /product="permease of the major facilitator superfamily"
                     /protein_id="BAU71832.1"
                     /transl_table=11
                     /translation="MVRRQRLTENDLRQCLRLAGGGALGLFVCKLMGWDNGSFFCVYP
                     MLLLGLTPSIDAHVVRQFLLQSVVVSLEVLLIHGLFGDRPQLMAPLAFLAFLWRFRLM
                     AQGPLFMFGALGTVFLSMQLHFASYPETHLLDLIASNLAAAALTVLIAWLMFWLFPDA
                     ESRPARSVPSKDLPSQRHEAVLGASLATLSFMVFQSLDLKDSLSAQVASILVLFPMHW
                     NGIRFAGRIRALGTLLGCGIGLALQLVLYSHYDVLPLVTLIYWTAAFCCARLHVLEGA
                     QGVGFGALTTLAIVFGQYLTPQHDVAYAIAYRLSSVCVAVFMTLVAVFVLHRLLNRFP
                     AFRHASHA"
     CDS             154879..155850
                     /codon_start=1
                     /locus_tag="KF707C_1450"
                     /product="sensory box/GGDEF family protein"
                     /protein_id="BAU71833.1"
                     /transl_table=11
                     /translation="MDTSVDSPSELESLTLALLHSRGEVERLREREAIYNSLLGSVNA
                     VLWAFDWESQKVIYVSPAYERMFGRSAALLLADYNEWRNCIYPDDLEYAARTFAEVLE
                     KGAVEAREYRILRADGQLRWISDKCFISQGGGEGQSTVVVGIAEDITEKKQLEGELHR
                     LATTDVLTKSSNRRHFFECAQREFEYAVQYGSPLAFILLDIDDFKKINDTHGHQAGDQ
                     VLQRIAQCGANALRRGDLFGRIGGEEFAALLPGCPPELARQIAERLQREVQRLGFNIS
                     GQGFGVTISQGLASLRDDGSLDSLYARADAAMYQAKRSGKNQIILAD"
     CDS             156224..156727
                     /codon_start=1
                     /locus_tag="KF707C_1460"
                     /product="uncharacterized protein ImpB"
                     /protein_id="BAU71834.1"
                     /transl_table=11
                     /translation="MASNSFQNEVPKARINIKLDLHTGGAQKKIELPLKLMLMGDYSN
                     GQEARPLSERSKVNINRNNFDSVLADFNPRLKLAVENTLAGDDSETSVELAFSRMKDF
                     EPEQVARQIPQLRALLAMRNLLRDLKSNLLDNATFRHELERILKDDALSEELRTELAA
                     LAPQDAR"
     CDS             156758..158293
                     /codon_start=1
                     /locus_tag="KF707C_1470"
                     /product="uncharacterized protein ImpC"
                     /protein_id="BAU71835.1"
                     /transl_table=11
                     /translation="MSVEHTSAASGGAAATQEHQGVYAALFSKINLSPISELGGIEAF
                     QNNEALSEASADERVTAAVSVFLDLLKQSSQRVERLDKTLLDEHIASLDAQISRQLDA
                     VMHHPDFQRVESTWRGVKSLIDQTDFRQNVRIELLDVSKEHLVQDFDDAPEIAQSGLY
                     VHTYTQEYDTPGGEPIAAAISNYEFDSSPQDIALLRNLSKVAAAAHMPFIGSVGPAFF
                     GKETMEEVAAIKDIGNYFDRAEYIKWKSFRDSDDARYIGLTLPRVLGRLPYGPDTIPV
                     RNFNYVEKVKGPDHDRYLWTNASFAFAANMVKSFINNGWCVQIRGPQSGGAVTDLPIH
                     LYDLGTGNQVKIPSEVMIPETREFEFANLGFIPLSYYKNRDYACFFSANSAQKPALYD
                     TADATANSRINARLPYIFLLSRIAHYLKLIQRENIGTTKDRRVLELELNKWIGGLVTE
                     MTDPSDDLQASYPLREAKVIVEDIDDNPGFFRVKLYAVPHFQVEGMDVNLSLVSQMPK
                     AKA"
     CDS             158318..159673
                     /codon_start=1
                     /locus_tag="KF707C_1480"
                     /note="VasE protein"
                     /product="uncharacterized protein ImpJ"
                     /protein_id="BAU71836.1"
                     /transl_table=11
                     /translation="MNIDRPLWAAGTLLSPQQFQQQARWEAWTNECIAHLALVHPWGA
                     LAAAFDPDALKLGKLKAFRLHLRMPDGTLIDTDRSDRLPPALELSLVLPDDLQSALVL
                     LALPLEQGNGNNCLLEGDREDRPTRYRQDWRAVQDLYGDERQSISVMEHQLCLRLASD
                     DNGDYLTCPVARLVRDPQGIWGLDPVYVPPLLSFAAHPGLSTQLDNLLTQLSAKRQRL
                     MGMRRESNQRMADFAVADVSLFWLLNALNTYQPILADLRAHPARHPEQVYRELVKLAG
                     SLSTFSLEHDIEQIPAYRHEHLETVLPPLMGMISSLLEASLPSRVIALELEERGANRW
                     QVALNDPRLREPGGADFYLSVRSRLSAAQLHSQFPHLCKLGSPDDVDHLVNAALDGVP
                     LQPLRHVPAAIPLRLENQYFALDLDHPKGRAMLAAGVCAIYVPAALIEARLELFAVLR
                     S"
     CDS             159700..160350
                     /codon_start=1
                     /locus_tag="KF707C_1490"
                     /product="putative membrane protein"
                     /protein_id="BAU71837.1"
                     /transl_table=11
                     /translation="MAIDIDALLQDTYLLVVSLREGAVAQSGRELWRHCCKQVETLRN
                     ALEEAGISQRSIDCISYAQCALLDETVLGYASDEAHANWASEPLQAKFFNRHQAGEFL
                     YEDMREVLRQPAPDPQVLTVYHRVLMLGFKGRYRDLQAPEREELLSTLDAQVRPLVVR
                     DGLISDSARGHGFVLQQWLRSPVIQLFVAAALIAGAWWSMDHLLQRAVASLLPGVA"
     CDS             160928..162070
                     /codon_start=1
                     /locus_tag="KF707C_1500"
                     /product="outer membrane protein"
                     /protein_id="BAU71838.1"
                     /transl_table=11
                     /translation="MQPEVFEAGARIGLGEWQKCRGAFSLSAARLRTSVVLDSAAEWL
                     NQHLLVRFTIRREPAALAHGIMLVPALPRSLPGNLWQQWLHGKTVLSELDVPAAPARL
                     PLPDPLLPLLPVTVRSSALARAGSVALWLSTAAILLAMAGSTWQNSRLVRQVSDDLQR
                     YLAIPYVPSRNLPEFALREAAAAVLRADADRLDGYYRHGEPLWLGMGLYQGERLRREL
                     LAVITRHRLPQDAPAQVADQPQPEPLRLDSLSLFNVGSATLKPESTKLLINALVGIKA
                     QPGWLIVIAGHTDATGNAEQNLQLSRARAGAVRDWMQRMGDIPDSCFAVQGFGAGQPI
                     ASNDTEIGRAANRRVDIRLVPEVGACALPTTAPDGKHQSHSAAVNL"
     CDS             162084..162575
                     /codon_start=1
                     /locus_tag="KF707C_1510"
                     /product="uncharacterized protein ImpD"
                     /protein_id="BAU71839.1"
                     /transl_table=11
                     /translation="MAIPVYLWLQDDGGADIKGSVDVQKREGSIEVVAQDHSLYIPTD
                     NNTGKLTGTRVHTPFLFTKEIDASSPYLYKAVTTGQTLKSAEFKWYRIDDAGQEVEYF
                     NTKLENVKVVKVAPKMHDVKDPAKEKHNHLEQVELRYEKITWTYKDGNIIHSDSWNER
                     QSA"
     CDS             162704..165370
                     /codon_start=1
                     /locus_tag="KF707C_1520"
                     /product="ClpB protein"
                     /protein_id="BAU71840.1"
                     /transl_table=11
                     /translation="MAQNPASLLRRLNPYCARALSAAASLCQSRAHGQITPEHWLLKL
                     LEQGEGDLTLIARRYEWDLDALWQGLLDHLDRLPRSVREKPQLSAELQQLIKSAWLRA
                     SLDEDNDRLRSLHLLGALLEAPHLIRCEAAWPLFSLGESQVQRLLPMLDQHSEERPAL
                     QREAALEGDENCAAVLATAPAGKAGTDALHAVLERFTQDLTAQAREGRIDPVFGRDDE
                     VRQVIDILSRRRKNNPILVGEPGVGKTALVEGLALRIAEGSVPDSLKTVSVRTLDLGL
                     LQAGAGVKGEFEQRLKQVIDAVQRAERPVLLFIDEAHTLIGAGNQAGGADAANLLKPA
                     LARGELRTIAATTWSEYKQYFERDAALERRFQMVKVDEPDDAGACLMLRGLKGRYARH
                     HGVHIEDAAVQAAVSLSRRYLTGRQLPDKAVDLLDTASARVRMSLDCEPQSLVRLASR
                     LSALELEQQALDADSHLGGRPPAGRLDELSEQRAELERQHCELERQYRLELELSLQLL
                     AARQEEPRQAERCAELQRQLEAAQGDRPLLSLDVTSRNVAEVIADWTGVPLGSLLKDE
                     QANLLELEHRLAQRVIGQHTALAALAQRLRAARTGLTDERTPQGVFLLVGSSGVGKTE
                     TALALADSLFGGEKSLITLNLSEYQEAHTVSQLKGSPPGYVGYGQGGVLTEAVRQRPY
                     SVVLLDEVEKAHRDVLNLFYQVFDRGFMRDGEGREIDFRNTVILMTSNLGGDLLQACL
                     QEQPDATDGTLQELLRPILREHFQPALLARFQTLIYRPLGADSLKRIVDLKLAQVARR
                     LQRHYGLDCRIDDALSDALAAACLLPDTGARNIDSLLNQQILPVLSQQLLQRQASRLG
                     TRGVTLSHSDADGITLHFSDSLEHPHGMLEEA"
     CDS             165373..167769
                     /codon_start=1
                     /locus_tag="KF707C_1530"
                     /product="VgrG protein"
                     /protein_id="BAU71841.1"
                     /transl_table=11
                     /translation="MLAEIRPFFDHSRHTLTVDGLDTALDVLAFHGKEALSEPFSYQV
                     EFTATARDLPADRFLGQAARFSLHPPPTPVPFVGLSLPPAQPLRTLHGVVTGFCRLSG
                     SNDEARYQLTLEPRLALLGRGRQYRIYQHLSVPEIVEQILRSDRHRWAGQDFLFDLKR
                     EYPKREQVMQYGESDLAFIRRLMAEVGIWFRFTADERLGIDVVQFHDDQRNYQFGLQL
                     PCRPQSGTQSSGADAVWGLQTSHGVVEKHLRIRAYTPRDAAAYLDGEVDQTRGDPTTY
                     GEAYHYAEPYTELDDPHARDEDLQSESGFFYARLAHERYLNQQTSLSGLTSSAALAPG
                     QVLKVEGGAPEAFAPGAVITRLETTAARDRSFQASFSAIPYAEHICFRPERLAKPVIA
                     GTIPARVTSPQAGDLYSHIDLDGRYKVNFLFDQDSWPAGQESLWLRLARPYAGDTYGL
                     HLPLIQGTEVAIAFEHGDPDRGFIAFALHDSQHPDLVTLKNYKRNVLRTPANNKLRLD
                     DSRGQEHIKLSTEHSGKSQLNLGHLVDGQRQKRGEGFELRTDGWGAIRAGKGVFISAD
                     EQARAQGQVLEMKPAVVQMEKASQQLEQWQEIARAHQSRESSHEGLDDLLKQGKGLQG
                     PAILLSAPSGIAAVTPSSLLLQSDQTLYLQSLDEINLAAAQRLALQSNQGLSLLAQQE
                     GLRLVSGRGPLEIESHGDLLNLIAQRDITLQSVQGHLQITAQNGITLASGGGYIRITP
                     DGAIEIHSPGTLNLKGRHVWEGPAGQGFPLPELPTSVCEDCLKKAQAQAAGAVMRVTN
                     "
     CDS             167780..168544
                     /codon_start=1
                     /locus_tag="KF707C_1540"
                     /product="hypothetical protein"
                     /protein_id="BAU71842.1"
                     /transl_table=11
                     /translation="MNPSFDVWLEQITDMVAAAGLNHVDVLIDQANCDLAILPGLALM
                     EPAMPWFSLFSGLPEEALLEQAPLLIRISLDEWRHKSWLGELVEHLAPQSRLLVLLSP
                     LPFESLAKTFQGLSQLEWGGLSGLLRFYDPRVLPHLLDRVLDPEQKEQFLGVALFWSW
                     LDRDRLPVWRSGTYRSSSAAPEPPAAITLTDEQYFRLGSLSDAQQLLGLASERMPDST
                     EEQRFEACYHLALKAEQEGFFGDLEIYVIQDSKLLF"
     CDS             168939..169232
                     /codon_start=1
                     /locus_tag="KF707C_1550"
                     /product="hypothetical protein"
                     /protein_id="BAU71843.1"
                     /transl_table=11
                     /translation="MMKVEWEIDPDPYAKIKRKTTGYGFDEEAYAKHAANYQQHTASV
                     PLPPYEEEGLCALEVHFFPCHQVKVTTSCWRYPSPNSPIREPLEMKEPAVCPK"
     CDS             complement(169776..169931)
                     /codon_start=1
                     /locus_tag="KF707C_1560"
                     /product="hypothetical protein"
                     /protein_id="BAU71844.1"
                     /transl_table=11
                     /translation="MVGAYCAWVTGQTPHQGENRRDMCPGMSVHFGHSAGSFISRGSL
                     IGFLGEP"
     CDS             169833..172154
                     /codon_start=1
                     /locus_tag="KF707C_1570"
                     /note="FIG00462664"
                     /product="hypothetical protein"
                     /protein_id="BAU71845.1"
                     /transl_table=11
                     /translation="MSEVNTHAWAHVPAVFPLVGRLPGDPSAVRANHRKQVAEELAHR
                     RCLNAAQGGPGASTCAHSLHISLFFDGTNNNEDYDTRKAKVPHPTNIARLYHASLEHL
                     DSGYFRYYIPGVGTPFPEIGELEFGTRGMAFGFRGEDRINWGLLQVADALMFALNDKK
                     GLKLPQAQAQLKKMATAWPLTGLGRACRRAAMMELLEPLRQRVGNAQPTVVAIKLFVY
                     GFSRGAAEARTFVTWLSELFDTPEGADQPERSLLGIPLRIEFLGLMDTVASVGSAHAA
                     PFASGHMDWADGNLPLPCAERFPGWIKDCRHFVAAHEQRLCFPLDSIRTEAGHYPPYA
                     REVLYPGVHSDVGGGYPPGAQGKARDGQAELLSQIALHDLYAAAFAAGAPLAVPEAVV
                     PEELRQMKPVRAMSAETDREFTLNEELTHRFNAWRSATLGLSEATPAESSSHEPQQAG
                     QDLDTLMAEQLAWLTGWRIERFARGSYASRPFYGEARQTSAEEQVQEREALAARRDEL
                     RKKRQAARGNPDVRLVDEPDYEPVLDRQQIREAATEFEHDYTERWREQTGLGGFLLDV
                     LVGDTVLLLNDDDELAEFQRLKAEGEARARELFAEPFKGRFELTDHPARAALVALFDD
                     QVHDSRAWFLHSTIGAREMWGDYFRYRMVYFGTQTNKRVTPVVIAGRVVGVAVLLGGA
                     YAIRKHGWTGLAGTLAAGSIGYQVINTVSGKPVPFLPGAEKILQPTRAIGQVVAEQRQ
                     ALLAAEEEQRMQTMLDYLRKTGGLVEQAKAVLP"
     CDS             172151..172414
                     /codon_start=1
                     /locus_tag="KF707C_1580"
                     /product="hypothetical protein"
                     /protein_id="BAU71846.1"
                     /transl_table=11
                     /translation="MKPLVRVGDPLVPFGGEVLEGHFLAFGKPVAFVGARARCDKHGM
                     TQIVQGASLSTVQGSAVALDGHPCACGCRVMSTLPGSSMSVAP"
     CDS             172411..173541
                     /codon_start=1
                     /locus_tag="KF707C_1590"
                     /product="hypothetical protein"
                     /protein_id="BAU71847.1"
                     /transl_table=11
                     /translation="MKRPPHYPDYVEPSAPQWRRWWLALLLLWGVQLGLTWALWPEGR
                     PRQEQWPLGVIVPLAWLLALALRLLVWQVGLINRDAHRSTLEAALRGWWCRRGATLPV
                     EHALLLGPAGDSSWQYQGLMAATPVPKPVVLPGSGELALRCQVSLRQAEDRHAALGQH
                     LARQLLALPEREARWSGWRGLAWVGDAAGEVSFAATLVAAGAQLPETRWRLRTLDDLD
                     TLIDEFPRICPEEADGLLCAGVVSLAQAEEGAVPGEAGFAWVIGHRGQLQLHRGEYLL
                     TDEESAAELCAQMQRYGRLDKAPAHCLALDAASHRAFIEGGWQAGEHQLSAHWGALGP
                     LAPFVGMSLALLQVKESRQPCGWLCAQGEQGMAMGVAVHGNG"
     CDS             173516..176893
                     /codon_start=1
                     /locus_tag="KF707C_1600"
                     /product="probable membrane protein YPO1482"
                     /protein_id="BAU71848.1"
                     /transl_table=11
                     /translation="MWRCMEMDKQGPQGSLGRAALVYLLLVSALVLLGTLLYGLWGTE
                     LGLPGIALVHLALRGLVVWLVLCMFCPVFLLAWRHLAIVRARSLLGNDAHGTAPVSAD
                     GSATQDVKPPLAHLRQGFGPFWRRRTRLLLVIGEPGEVAAIAPALADRQWLEGDGAVL
                     LLGGAAQEAAFDTRLTRWRTLRPRRPLDGIVWALNPAQGADPDYLDRYQRQLQALARQ
                     LRWQAPVHLWEVRESHWAQPAIESAVGCALPLRASPELLERHLRSLLPSWREQGLARM
                     RADNRHDSLLRLAHDLQGEGIGRWHRAWARLRQGSGVMLRSLWFSLPLPGSSVAGDHH
                     WRVHPAWHGVLAGRHPGGRAQGWTGWRIGRAALLGLLALWGLGLVLSFASNRVQVAEM
                     QSVLATLDQPREGAAQLLALNELVHELDRLDHRAKHGVPWYQRFGLSQNDGLLAALWP
                     RYVTANNRLIRDPAAAGLERQLRELLDLPPESRERAIRARDAYAPLKAYLMMARPEKA
                     DAAFLGKTLAAYETERAGVADGLWQGVAPNLWRFYAEHLEEHPEWRIEEAPGLVAGAR
                     QLLIGQLGQRNGEANLYRQVLQRAANQYPSLGLAQLVGDTDAQLLFSTAAEVPGVFTR
                     QAWEGAVRQAIDEIAAARREEIDWVLSDDRSQIAAELTPEVLRERLAERYFQAYGQAW
                     LEMLNSLRWREAQSLADTIDQLTLMTDVRQSPLIALVNTLAYQGQAGARGQALGDSLL
                     QSAQTLIGQDKAPVIDQLDRFPKSPLDESFGPLLALLGKADDHPGTDDSLSLQAFLTR
                     VTRVRLRLQQISTAPDPQAMVQALAQTVFQGRSVDLTDTQSYGSLMAASLGSDWSGFG
                     QALFVQPLDQAWRKILQPSAAGLNGQWQRAIVTPWNDAFAGRYPFAASGADSSLPMLG
                     QMIRADTGRIDQFLTRQLGGVLRKEGNRWVADSSHSQGLRFNPEFLEAINRLGELADV
                     LYTDGGMGIAFDLRAKPVRDLVQTSLVVDGNALTYFNQRERWQRFQWPGIQDHPGTRL
                     SWIHARTGERLFGDYPGTWGLIRWLEQARVTPLDDSETRYRLRLDAPDGLGLTWHLRT
                     ELGAGPLALLQLRGFKLPTRIFLESGGYSLAQSGDEA"
     CDS             176890..178473
                     /codon_start=1
                     /locus_tag="KF707C_1610"
                     /product="uncharacterized protein ImpA"
                     /protein_id="BAU71849.1"
                     /transl_table=11
                     /translation="MSLSALISTCLGERDPLGLARQQASDWEAWLQPISPRSAVGEDP
                     GYDDDFQHMREEVNKLSGADTERVVRLAEKLLTQRCKDLRVVTYYLWARMQRDGEAGL
                     ADGLTLLAALMERYAEDILPSRPNSRRMALEWLASGKVLDSLSLYPEVVKAEAERTVA
                     ALAWLKQGLATWPEDQRPELGALYTALSSRLAQSGGVDALVPQNSAVHETARQGATPV
                     GTAIRSGRDLLDSGRALAGYLREQPQGWLAAHRLMKSLRWDTVHQLPPAEASGNTRLT
                     PPRSDYRAQLKRLHLQQSWSELLDQVERIYAEGVNHFWLDLQWYLCQALGKQPAPQDG
                     WADIVKRDLGMFLDRLPGLESLRWSDGTPFADESTRNWIAQHVSGNQSSQWLPVAAAP
                     ASMDADILALEGKALAQADSEGVEAAIAWLGERPEAQSGRQRWLLRLLMARVAEQCGK
                     TELAIHLLGELETTARRLALAEWEPDLAFEVLARLLKLLRLKSQRNDVDKAALGRRKD
                     ALLAELVGLDPVRAAVLCN"
     CDS             178502..180271
                     /codon_start=1
                     /locus_tag="KF707C_1620"
                     /product="protein ImpG/VasA"
                     /protein_id="BAU71850.1"
                     /transl_table=11
                     /translation="MDMDNLTLRYFDAEMRYLHEAGQEFAEAFPDRAAQLNLDRPGAR
                     DPYVERLFEGFAFLMGRLREKLDDDLPELTEGLVSLLWPHYLRTIPSLSIVELAPDLQ
                     QMKRSERVERGLEVMSQPVGPQRTRCRYTTTQDLTLQPLAVESLRLAYEPDGRPLLRL
                     RFACGPLAEWSQVDLGRLPLYLNAEASVASALHLALTRQVHALYVRLPGQPERSPLRG
                     HFSAKGFAGEDRLWPKGDSAFSGYQLLLEYFSFREKFMFVTLHGLERLSVPEGAPWFE
                     LEVALAEGWPHDFEPRAEHIRLHAVPVINLFALEADPLRLDPLQSEYLLRPMRLQDGH
                     TEIYSVDQVTASKNAEREDYVPFTSFRHKGGMLRDDAPERYFHTRLKRAANGLHDTWL
                     ILGGEGFDADRLVRGENLSLRLTGTNGQLPRKALQSTLLDSLVQSTQTGLRVRNLCAP
                     TLPCYPPNRDRFHWRVLSHLGSNFLPMLDNAEVLRGTLALYDWTGDELNRRRLAAIVE
                     VRHHLIQRFEKGFLLRGVDIEVTLDANGFSGEGDIGLFGEMLSRFFALYADIHLFNQL
                     TLILQPTGKCLRWNENHSQRIPG"
     CDS             180235..181329
                     /codon_start=1
                     /locus_tag="KF707C_1630"
                     /note="VasB protein"
                     /product="uncharacterized protein ImpH"
                     /protein_id="BAU71851.1"
                     /transl_table=11
                     /translation="MERESQSAYPRLNASGLLQALEGRIAEASLYRFCQLLEQALPDR
                     PPLGSTTRPSDDPVRFRPDPGMGFPAGELKAIEVDARCPTGPATVRTRLLGLYGVDSP
                     LPTAYLDDIAQRREGHEALEAFLDIFNHRIFTQFYRIWRKYSYPATFERSGTDATSQC
                     LLGLIGLGIPGTADHVATPISRFLALLSVMRLPTRNAEGVVALVRLLAPRTRARVTPH
                     WPRPVVLEEPASLSSRRPVNLSQGTPLGGVGRDANSQMHLALYTEDPQEALGWLPGAR
                     LHGDLLALLRVYLGWRCTARLELTLPTCCLPRPALGQATLLLGMTGLLGLGGSLPADE
                     SRTVSIPLGRYQGLRSNPQAREAEHVAYPC"
     CDS             181310..181852
                     /codon_start=1
                     /locus_tag="KF707C_1640"
                     /product="probable lipoprotein"
                     /protein_id="BAU71852.1"
                     /transl_table=11
                     /translation="MSRTPARTLLPALLATLLAGCGLYQSVGDSSAAFARSIFYKQVK
                     TLHLDFNGRAAMNTDSHDMSGLSVPTLVRIYALRDDKAFRQASYDQLLDDSREVLGAD
                     LLDERAVLVRPDEGAQLSVPLDGSARVVAVAALFRQPDTLTDAWRLVLTRDELDPDQP
                     RVVELADNRLTLRALRGVSP"
     CDS             181849..182280
                     /codon_start=1
                     /locus_tag="KF707C_1650"
                     /product="uncharacterized protein similar to VCA0109"
                     /protein_id="BAU71853.1"
                     /transl_table=11
                     /translation="MTEQTPSLYETLLQNFAGELELHRVREEDQLMLSVLDNLQRILD
                     SRAGSLEHLPDYGLPDLGQVLQGLPAAAHGLIGTLTHTLLKYEPRLAELQVRLLPQSQ
                     PGQLEYSLDIRLESGAQATFGTTLAPSGKALIRHLRQQNHL"
     CDS             182310..183443
                     /codon_start=1
                     /locus_tag="KF707C_1660"
                     /product="hypothetical protein"
                     /protein_id="BAU71854.1"
                     /transl_table=11
                     /translation="MNGLVGRVGDGHGDLAALYEELAKLHHPACPDIDWRQVEQWCRE
                     LLRDNGSDLQIAAFLALALAQRYGLPGLAEGLKVMVQMLSGAWDRLWPRNATERMDIL
                     AWLFVQLQPLLRGLGAGERDAATVRGLESDLETLQALLRQHRLPTMTAMHAFIRQVEL
                     LAVRLDDVPMPATKGAREPESNAAEPPLRVFVSVPEAGSVAPRVYVERLPAGASRGRG
                     LRFALWGALAGMILALSGVLGWHLWQRFGQEPPIVEAPVRLDSLQLFGSGSAELKPES
                     TKLLINALASMKAQPGWRIVITGHSDATGDESRNLALARARAEAVRDWMKTMGDVPED
                     CFAVHGQGSSRPVADNASEAGRAANRRVDISLVPEPGACQAHR"
     CDS             183571..184173
                     /codon_start=1
                     /locus_tag="KF707C_1670"
                     /note="FIG006045"
                     /product="sigma factor, ECF subfamily"
                     /protein_id="BAU71855.1"
                     /transl_table=11
                     /translation="MTDSSSPAAPAPAPDASASADPDRREDFLRTFLSRRQQMETLVS
                     RRVGCRATAADLVQDLFLRFWRRPSAPVEDLGTYLLRSAHNLAIDHLRSEGSRNRAES
                     ALLPEQQLAEPASPEAALEAGSQLRHVESALRELPERTRQIFLLNRIHGRTYGEIARA
                     MGLTQSAVEKHMMRALEVCKTSLHRADQPSPRPGSAPDES"
     CDS             184163..185167
                     /codon_start=1
                     /locus_tag="KF707C_1680"
                     /product="iron siderophore sensor protein"
                     /protein_id="BAU71856.1"
                     /transl_table=11
                     /translation="MSLESTPLRAVDGAGEPDLEQVAWLWLGRLQDTSDPAQREAFHA
                     WLHGAPEHADAYRRAEALWRLSLAPAARLASEEAEELRVLMARMDAPPKPAYRRWGAG
                     LGLAASLLLATWLGGWQPLERLRDLGADHVSAPGQVREVTLADGSVLTLDADSAVAVA
                     YGKGERRVELRRGAAFFRVVPGQRPFVVSANGGEARVLGTRFEVRLRGEGAQVTVEQG
                     RVGVRASPAASPHELTAGQQLAYADGQAETVQSVDTAARLAWREGRLTFFRTPLGEVL
                     DELDRYYPGRIVLLDSRLAQTRVSGSFPSQEPAAVLDALQAVVGFQRDELLGRVMILR
                     "
     CDS             185294..187723
                     /codon_start=1
                     /locus_tag="KF707C_1690"
                     /product="ferrichrome-iron receptor"
                     /protein_id="BAU71857.1"
                     /transl_table=11
                     /translation="MKYGTKRVRGGVFGRLGLASLLLAGALSPLAVDLAYAAEAGALA
                     SVHDFDIPAQPLPRALDAFSRVTGFSVVYTLDTPLGLEAPAVAGRLSASEALARLLAG
                     SGFSWRQAGDATLTLEPRRDEGALTLDAVTIDSRLAHSGGYQPPPDTGITRASTPLLE
                     IPQAVAVVPAQALQDQQPQNLDDALANVSGITQANTLGGTMDAVMKRGFGDNRDGSIL
                     RDGMRTIQGRNLTATAERVEVLKGPSSMLYGILDPGGVINVIGKKPQLEAYRAITARA
                     SSYGDGKDGSGGQLDLTGPLGENGLAYRLIADYDDGDYWRNFGHSREKTFAPSLAWFG
                     EETRINLSFEHREYSVPFDRGTVFVNGQPLDVPAERRLDEPYNVTEGRSDLAIFDLSH
                     QLGEDWTAHFAYSYNRDTYDDYQARVTRVNTDGTLTRRLDGTRGAVSTSHFATFDLAG
                     EVHWGGMQHDLLMGVDHEYRKFFREDLIRQTTRVRFDPFEPVYGQVPVPTTVAASDSD
                     QTDRVVSQSAFFQDSLHLTERWILVAGARYQLYDQLAGRGRPFSKNTDIDGQLWVPRA
                     GLVYKWSDELSLYGGYSESFKPNSTIAPLSGTASIDGLDPEEGKSWEIGAKLDLPGRI
                     TGTLALFDIVKENVLVTQSVTVNGLTDTVATAAGEVRSRGLELDLTGQLTDSLSLIGT
                     YAFTDAEVTEDPELKGNRLQNVARHSGSLSAVYDFGALAGNDRLRAGLGARYVGERSG
                     DAEDSFDLDAYTLADAFASYETPLGDNRLKLQLNLKNLFDKTYYSSSVNALNVSIGDP
                     RQVQLSTTLEF"
     CDS             188844..190508
                     /codon_start=1
                     /locus_tag="KF707C_1700"
                     /product="malonate decarboxylase alpha subunit"
                     /protein_id="BAU71858.1"
                     /transl_table=11
                     /translation="MTTTPTSPPQWSRRRAEKQRRLDRVRHLADGAVLPSERIVEALE
                     ALIAPGDRVVLEGNNQKQADFLSRALAKVDPGRLHDLHMIMPSVSRAEHLDLFERGIA
                     RRLDFSFAGPQSLRIGQLMEDGLLEVGAIHTYIELYSRLVVDLIPNVTLVAGFMADRE
                     GNLYTGPSTEDTPALVEPTAFSDGIVIAQVNQLVEDVRDLPRVDIPASWVDFVVVADK
                     PFYIEPLFTRDPRHIKPVHVLMAMMAIRGIYEKHKVQSLNHGIGFNTAAIELILPTYG
                     ESLGLKGKICRNWTLNPHPTLIPAIETGWVESVHCFGTELGMEGYIAQRPDVFFTGRD
                     GSLRSNRMLCQLAGQYAVDLFIGATLQVDGDGHSSTVTRGRLAGFGGAPNMGHDPRGR
                     RHSTPAWLDMRAEPEALLARGKKLVVQMVETFQEGGKPTFVETLDAVDVARKTGMPLA
                     PIMIYGDDVTHLLTEEGIAYLYKARSDEERRAMIAAVAGVTAIGLRHDPKDTERLRRE
                     GLIALPEDLGIRRTQATRELLAAKSIADLVEWSGGLYTPPARFRSW"
     CDS             190508..191359
                     /codon_start=1
                     /EC_number="2.7.8.25"
                     /locus_tag="KF707C_1710"
                     /product="triphosphoribosyl-dephospho-CoA synthetase"
                     /protein_id="BAU71859.1"
                     /transl_table=11
                     /translation="MSALTLRDADLPLADWLADLAVDALIDEADLTPKPGLVDRRGSG
                     AHHDLHLGLMHASALSLWPCFRQMAEAAQQHGEVGLPLREALGRIGREGEAAMLAITG
                     GVNTHRGAIWALGLLVAALALSPDSLDARAIALRAGRIALIDDPAAPKPDSHGADVCR
                     RYGVRGAREEAQLGFPAALDHGLPQLRRSRAAGAGEQNARLDALLAIMAELSDTCVLW
                     RAGPEGLQATRAGARAVLVAGGAASLAGRRQLRALEARLLELNVSPGGAADLLAACLF
                     LDHAGSL"
     CDS             191361..191660
                     /codon_start=1
                     /locus_tag="KF707C_1720"
                     /product="malonate decarboxylase delta subunit"
                     /protein_id="BAU71860.1"
                     /transl_table=11
                     /translation="METLTFEFPAGQPARGRALVGCVGSGDLEVLLEPGRAGTLAIQV
                     VTSVNGSGPRWEQLFQRLFAGQALPALNIDIHDFGATPGVVRLRLEQALEEVAHD"
     CDS             191653..192507
                     /codon_start=1
                     /locus_tag="KF707C_1730"
                     /product="malonate decarboxylase beta subunit"
                     /protein_id="BAU71861.1"
                     /transl_table=11
                     /translation="MTDTARLLAARSFVELGARQRARALLDAGSFRELLGPFDRVMSP
                     WLVQQGIVPQADDGVVVAKGSLDGRPLVVAAIEGAFQGGSLGEVGGAKIAGALELAVE
                     DNRQGIPTAAVLLLETGGVRLQEANLGLAAIAEIQAAIVALRQHQPVVGLIAGAVGCF
                     GGMSIAAGLCSHLLVTREARLGLNGPQVIEQEAGLDEYDARDRPFIWSLTGGEQRHAS
                     GLADAYLADDVAAIREALAGLLAAGEPAAPRCRRPDEFLARLARLGDDCEQLDAARVR
                     ALYQGDPQ"
     CDS             192504..193289
                     /codon_start=1
                     /locus_tag="KF707C_1740"
                     /product="malonate decarboxylase gamma subunit"
                     /protein_id="BAU71862.1"
                     /transl_table=11
                     /translation="MSRGLNWLHGLAGGNEVAGFPASVKVIDGELGNRAARFIAVVPD
                     ARNPFPRAHNGEVGLLEGWGLAKAVGEAIEADAGRADKRVLVAVVDVPSQAYGRREEA
                     LGIHQALAGAVDAYARARLAGHPVIGLLVGKAMSGAFLAHGYQAQRLIALDDAGVMVH
                     AMGKAAAARITLRSVDELEALAAMVPPMAYDLGNYASLGLLWERLAVDNPDCPGPVDL
                     DRVRDSLVRAVADIGASTDLTNRLGAENRAASSKVREMLRAQW"
     CDS             193311..193925
                     /codon_start=1
                     /EC_number="2.7.7.-"
                     /locus_tag="KF707C_1750"
                     /product="phosphoribosyl-dephospho-CoA transferase"
                     /protein_id="BAU71863.1"
                     /transl_table=11
                     /translation="MDTIHPHDLLWGLAPDQLPAEAPAWARQVLAAGQPVVVRRALCA
                     PGRVAVGVRGATRGERFAACMPVDAIQRRIAPEHLRLRAPAELAALRALDQVTPLLDA
                     IGLAWGPTGGVGYQLATGLAVLHGASDLDLLLRIAEPIDRARARALLAQLDSASCRID
                     LQLETPCGAVALREWAGDSRRVLLKCDAGARLVDNPWQPLELAA"
     CDS             193922..194848
                     /codon_start=1
                     /EC_number="2.3.1.39"
                     /locus_tag="KF707C_1760"
                     /product="malonyl CoA acyl carrier protein transacylase"
                     /protein_id="BAU71864.1"
                     /transl_table=11
                     /translation="MSSLFAFPGQGAQQPGMLQALPSEPEVRACLEEAGRVLGEDLGA
                     LDSAEALQSTRAVQLCLLIAGVACARLLLARSPAPDYVAGLSIGAYPAAVVAGALDFA
                     DALRLVALRGELMQQAYPQGYGMTALQGLDLATVEGLLAEAEGPVFIGNLNADNQIVI
                     AGSDAAMAAVAERARALGAGLVRRLAMSVPSHCPLLEAPARELAAAFAGVEVRRPAIR
                     YLSGTSARPIHDPARLRDDLAYNMCRVVDWHGTQRTAYERGVRLFIELPPGAVLSGLA
                     RRVFDKGTVIAFQGARLDTLDALLRQEVEYNR"
     CDS             194908..195309
                     /codon_start=1
                     /locus_tag="KF707C_1770"
                     /note="MadL subunit"
                     /product="malonate transporter"
                     /protein_id="BAU71865.1"
                     /transl_table=11
                     /translation="MIIYGVAFLALCTLVGLFIGELLGKLLGVPANVGGVGIAMLLLI
                     FIGSYLQKRGLMDARSEQGVEFWSAIYIPIVVAMAAQQNVLGALSGGPMAILAGVAAV
                     VLSFAMVPAIDRFGQKKPGAAAAESLTSAQR"
     CDS             195315..196079
                     /codon_start=1
                     /locus_tag="KF707C_1780"
                     /note="MadM subunit"
                     /product="malonate transporter"
                     /protein_id="BAU71866.1"
                     /transl_table=11
                     /translation="MYESMMKVIGGYGLISGFAVIGVTMWLSYWLSARLTRGRLHGSA
                     IAIFLGLVLSYVGGVMTGGQKGLVDIPLLSGIGLLGGAMLRDFAIVATAFGVNVEELK
                     RAGVSGVVALFFGILTSFVAGVGVAMAFGYTDAVSLTTIGAGAVTYIVGPVTGAAIGA
                     SSEVMALSIAAGLVKAILVMVATPFVAPFIGLNNPRTAVIFGGLMGTSSGVAGGLAAT
                     DPKLVPYGCLTAAFYTALGCLLGPSLLFFVMRGVAG"
     CDS             complement(196084..197004)
                     /codon_start=1
                     /locus_tag="KF707C_1790"
                     /product="malonate utilization transcriptional regulator"
                     /protein_id="BAU71867.1"
                     /transl_table=11
                     /translation="MQIDDELTLKKLQTFLVFMRAGNLSRAAAELNTSNVSVHRAIHS
                     LESALRCPLFRHEGRNLTPLESAYVLEEKAQKLVQDVMDMVRLTREAAGFSAERFKLG
                     ALYSLTVKTVPQLVMGLKLRRSELNIDLTLGSNVDLLYRLKNLELDAILVSLDESVSD
                     PDCEQLPLFSDDIFLAVPTDSPFSEKTEVDLADLAESTFITLTQGFATHRDGARVFQQ
                     AGFEPKVAMQVNDIFTLLSMVSSGVGYALLPGRIAAVYENRVKLIPLQARYRLQQHIG
                     VVFLKARERDPNLLALLAECRMYSLRQEQR"
     CDS             197185..197766
                     /codon_start=1
                     /locus_tag="KF707C_1800"
                     /note="FIG00953394"
                     /product="hypothetical protein"
                     /protein_id="BAU71868.1"
                     /transl_table=11
                     /translation="MRSQAIRYLILPGWQGSPADHWQSHWERVLPNARRVEQADWDQP
                     DRAAWVTALEHAIDAERTPVILIAHSLGCVTVAHWAGQADSDVLRRVRGALLVAPADV
                     ERAGCPEPLTGFAPIPRAMLPFPSLLVGSDNDHAASPQRALAMASDWGSEAVILAGAG
                     HINLKSGHRTWESGFVHLYRLQGLVEESARRLA"
     CDS             complement(197777..198151)
                     /codon_start=1
                     /locus_tag="KF707C_1810"
                     /product="hypothetical protein"
                     /protein_id="BAU71869.1"
                     /transl_table=11
                     /translation="MNAENAAHNAIRQLVRDYVEGMVRADESLLRLAFHPNARIIGRF
                     QALPEWLTLDDFVDAIRDRGPVLAPEQSPFWQIVSQDVTDETAMVKVLDDYAGLRFTD
                     YLSLMVLDGRWRIVNKLFHCHS"
     CDS             complement(198275..199465)
                     /codon_start=1
                     /locus_tag="KF707C_1820"
                     /product="arabinose efflux permease"
                     /protein_id="BAU71870.1"
                     /transl_table=11
                     /translation="MNPSTLLSLPLLALALGGFVVGSSEFIIMGLLPEVAQDLSVSLS
                     DAGLLVSAYAMGVVIGAPLLGPLLGRLPRRRALLWLMGAYALGNLGCALAPSYEWLMA
                     MRMFTAFSHAGFFGCATLLAAELAPPHRRASAMALVLSGLTIANVLGVPAGAWLGQAT
                     SWRVTFMVVAGLGFLTLLAQALWLPATPRPTPNAAGAWDGILRRPVLHALFVCSLSSV
                     ALFGVFTYISPLLREISGFSPEQANLALLLFGIGLTLGNLLGGRLADRGFRYALPLAF
                     GVSGLCLLGLFLFAQLPVLALGCLFLWGVASFAISSPLQLLLVEQAGESASLAATLSH
                     AAFNLGNASGAFIGGLWLSMGMGLSNLPLMGVGVLALTLLVCLPLPRLRATRERLRES
                     GQIH"
     CDS             complement(199591..200337)
                     /codon_start=1
                     /locus_tag="KF707C_1830"
                     /note="ATP-binding protein"
                     /product="cystine ABC transporter"
                     /protein_id="BAU71871.1"
                     /transl_table=11
                     /translation="MITVRNLTKSFKGQAVLKGIDLTIEPGEVVAIIGPSGSGKTTLL
                     RCLNLLEEPSGGSIRVGEIEIDANQPLKAQQGLIRKLRQHVGFVFQSFNLFPHRTALE
                     NVIEGPVVVKKEPRERAIERARALLAKVGLAGKEDAYPKRLSGGQQQRVAIARALAME
                     PDVILFDEPTSALDPELVGEVLATIRGLAEERRTMVIVTHEMSFARDVANRAIFIDKG
                     VIVEQGEAKALFSAPKEERTRQFLSKFLQG"
     CDS             complement(200337..201005)
                     /codon_start=1
                     /locus_tag="KF707C_1840"
                     /note="permease protein"
                     /product="cystine ABC transporter"
                     /protein_id="BAU71872.1"
                     /transl_table=11
                     /translation="MIEASLQLALDSAPFLLKGAVYTVVLSLGGMFFGLLLGFLLALA
                     RLYGFTPLRWLARVYVSFFRGTPLLVQLFMIYYGLPQLGIQLEPLPAALIGFSLNMAA
                     YTSEILRAAIASIDKGQWEAAASIGMSRSQTLVRAILPQAARTALPPLGNSFISLVKD
                     TALAATIQVPELFRQAQLITARTFEIFTLYLAAALIYWVLATVLSHFQTRLEARVNRH
                     EQDN"
     CDS             complement(201002..201799)
                     /codon_start=1
                     /locus_tag="KF707C_1850"
                     /note="periplasmic cystine-binding protein FliY"
                     /product="cystine ABC transporter"
                     /protein_id="BAU71873.1"
                     /transl_table=11
                     /translation="MTFATLRRPFLLASLTLALGIGFAGTASAADLLQDIQQKGAIKV
                     GLEGTYPPFNYQDESGKLTGFEVELAQALAKELGVTAEFQPTKWDGILAALESKRLDV
                     VINQVTISDERKKKYDFSTPYTVSGIQALVRKGTEGDIKSAADLAGKKVGVGLGTNYE
                     QWLKDNVPQADIRTYDDDPTKFQDLNVGRIDVILVDRLAAFEMVEKTGGRLAVAGEPF
                     SRQEAGIALRKGNPELLAALDKALAKFKADGTLKALSEKWFKADVTQ"
     CDS             complement(201907..202908)
                     /codon_start=1
                     /EC_number="4.4.1.15"
                     /locus_tag="KF707C_1860"
                     /product="D-cysteine desulfhydrase"
                     /protein_id="BAU71874.1"
                     /transl_table=11
                     /translation="MLNDALARFTRLELVPSPTPLECLERLSKQLGRDLYVKRDDLTP
                     FALGGNKVRKLEYLAAEALAQGADTLVTAGAIQSNHVRQTAALAARLGLSCVALLENP
                     IGTADRNYLENGNRLLLDLFGTEVEPVPNLDNADELLAATAERLRGAGRSPYVVPIGG
                     SNALGALGYVRAGLELAEQIRASGETFAAVVLASGSAGTHAGLALALEYALPGTRVIG
                     VTVSRPDATQRPKVEGLLQRTAELLGVPVPASLRVELWDRYFGPRYGEPNALTLEALG
                     HAARLEGLLLDPVYTGKAFAGLLDGAAHGAFDGDGPVLFLHTGGSPALFAYHPAGNT"
     CDS             203242..204573
                     /codon_start=1
                     /locus_tag="KF707C_1870"
                     /note="OprD family"
                     /product="outer membrane porin"
                     /protein_id="BAU71875.1"
                     /transl_table=11
                     /translation="MNRSSLSLAVALASLAQHAAAGGFIEDSKASLSLRNFYINQDNR
                     EGAALPSRQEEWGQGFLLNYSSGYTEGTVGVGVDALGLLGVKLDSGKGRHYNPTSAGY
                     GGTVFPSDNDGRAKDDFSSLGLTGKVRISRTEARIGTLQPKLPVVTFNDGRLLPQTFE
                     GGQVTSSEIDGLTLVGGQLEHAKGRNSSDARGLSIGGANNARTGQFVNTFYFAGGDYK
                     VRDNLLAQYYYGNLEDFYTQHFVGLTHNWALPVGALKSDLRYFHSDSDGKNASVAGRA
                     EGFRSSGNWAASDPDRYEVDNRTWSALFTYSLGGHAASLGYQQVSGDSAFPFLNQGDG
                     ATAYLITDRQIGKFLSAGERTWVAEYGHDFASLGVPGLRAVATYLKGSNIETQGGDQG
                     EWERDFRLDYVLQDGPLKGLGLSWRNAALRSDAARDQDENRLILSYTLTLL"
     CDS             204740..204955
                     /codon_start=1
                     /locus_tag="KF707C_1880"
                     /product="organosulfonate utilization protein SsuF"
                     /protein_id="BAU71876.1"
                     /transl_table=11
                     /translation="MTIKAINVRNQFKGTIKEIIEGPVLSEIDVQTAAGIVTSVITTR
                     SVRELELGIGSEVIAFVKSTEVSIAKL"
     CDS             complement(205145..206251)
                     /codon_start=1
                     /EC_number="3.5.3.12"
                     /locus_tag="KF707C_1890"
                     /product="agmatine deiminase"
                     /protein_id="BAU71877.1"
                     /transl_table=11
                     /translation="MNTLNSLPRDDGFRMPAEWEPHTRTWMVWPERSDNWRLGGKPAQ
                     AAFTAVAKAIARFEPVTVCVSAGQYENARARLDEPNIRVVEISNDDAWVRDTGPTFVI
                     NDQGEVRGVDWTFNAWGGFDGGLYFPWNRDDQVARKILEIEGCKRYRTNGFVLEGGSI
                     HVDGEGTLITTEECLLNRNRNPHLTREQIEAVLREQLAIDTVIWLPDGLYNDETDGHV
                     DNFCCYVRPGEVLLAWTDDPQDPNFPRCQAAMKVLEHARDAKGRQLVVHKMPIPGPLY
                     ATDEECAGVDLVEGTQERDPSIRLAGSYVNFLIVNGGIVAPKFDDPKDAEAEAILKRV
                     FPQHEVVMVPGREILLGGGNIHCITQQQPAPQKR"
     CDS             complement(206337..207215)
                     /codon_start=1
                     /EC_number="3.5.1.53"
                     /locus_tag="KF707C_1900"
                     /product="N-carbamoylputrescine amidase"
                     /protein_id="BAU71878.1"
                     /transl_table=11
                     /translation="MSRIVTVAATQMACSWDRAANIANAEKLVRQAAAEGAQIILIQE
                     LFETPYFCQKPNPDYLQLATPTETNAAIAHFQKVAAELQVVLPISYFEQAGRARFNSI
                     AIIDADGSNLGVYRKSHIPDGPGYHEKYYFNPGDTGFKVWNTRYAKIGVGICWDQWFP
                     EAARSMALLGAEILFYPTAIGSEPHDPSISSRDHWQRVQQGHAGANLMPLVASNRIGR
                     EEQDGYDITFYGSSFIADPFGKKVAELNETEEGILVHSFDLDKLEHTRSAWGVFRDRR
                     PNLYSPIKTLDGSLES"
     CDS             complement(207414..208058)
                     /codon_start=1
                     /locus_tag="KF707C_1910"
                     /note="TetR family"
                     /product="transcriptional regulator"
                     /protein_id="BAU71879.1"
                     /transl_table=11
                     /translation="MPRPATARKPRASSQLRIAGILDAARALLAEQGVANLSIYSVAE
                     RAEMPPSSVYHFFASVPAILEALTTDIHGAFRACLLEPIGHDSLQHWRDLSRIVEERM
                     LSIYGGDAAARQLILAQHGLTEVTQADRQHDIELGRLMHALFDRHFELPALPTDVDVF
                     ALAMELGDRVYARSVQLHGEITPRLAEEGMRVFDAYLGLYLPPYLPKRLQPLAD"
     CDS             complement(208196..209254)
                     /codon_start=1
                     /locus_tag="KF707C_1920"
                     /note="TC 3.A.1.11.2"
                     /product="putrescine ABC transporter putrescine-binding
                     protein PotF"
                     /protein_id="BAU71880.1"
                     /transl_table=11
                     /translation="MPRSLAPLLLALLPTLAQAEDLIRVYNWNDYIAPEVLETFQEET
                     GIRVEYHTFASAEELELALSSDAPIDVAVPSHNDLPRLIKAGTLQPLDFSRLPNRQHL
                     DKQLLSKLAAMDPQNRHAVPYLWGAVGLAVNKPQAEQAFGGPLPQSWSLLFDAQQSAR
                     LGQCGMSLLDAPDETLSVLLNYQGRNLARSAPSRLKRSAETLTALRPHLRYVDSERYI
                     DDLNAGKLCVAMAWVGDALNAAAAGQPVTFMVPDEGSVLFIDNLAIPRKANRADLAHR
                     FIDFMLRPEVAAKVTSETLYPSANADARQFLAPGLRDQPGLYPDKDTKRRLFPVEPMP
                     EKLGATRDEVWTAFRDGQ"
     CDS             complement(209403..210782)
                     /codon_start=1
                     /EC_number="6.3.1.2"
                     /locus_tag="KF707C_1930"
                     /product="glutamine synthetase"
                     /protein_id="BAU71881.1"
                     /transl_table=11
                     /translation="MSVPPRAVQLQEANEFLKEHPEVQFVDLLIADMNGVVRGKRIER
                     ASLTKVYEKGINLPASIFALDINGSTVESTGLGLDIGDADRICYPIPGTLSDEPWQKR
                     PTAQLLMTMHEMEGEPFFADPREVLRRVVEKFDALGLTICAAFELEFYLIDQENINGR
                     PQPPRSPISGKRPQSTQVYLIDDLDEYADCLQDILEGAKVQGIPADAIVKESAPAQFE
                     VNLHHVDDALKACDYAVLLKRLIKNIAYDHEMDTTFMAKPYPGQAGNGLHVHISLVDK
                     KTGKNIFAADDPEQNAALRHAVGGVLETMPASMGFLCPNVNSYRRFGAQFYVPNAPSW
                     GLDNRTVAVRVPTGSADAVRIEHRVAGADANPYLMMSAILAGIHHGLTNKIEPGAPIE
                     GNSYEQLEQSLPNNLRDALRELDDSEVLARYISPEYIDIFVACKESELEEFEHSISDL
                     EYNWYLHTV"
     CDS             210723..210857
                     /codon_start=1
                     /locus_tag="KF707C_1940"
                     /product="hypothetical protein"
                     /protein_id="BAU71882.1"
                     /transl_table=11
                     /translation="MLLKELVRFLKLNGTRGYRHDATPFLLKISITLSIRCESIRITP
                     "
     CDS             211061..211813
                     /codon_start=1
                     /EC_number="3.5.1.94"
                     /locus_tag="KF707C_1950"
                     /product="gamma-glutamyl-GABA hydrolase"
                     /protein_id="BAU71883.1"
                     /transl_table=11
                     /translation="MARLPLIGVSACTREMGPQTYHIAGDKYLRAVALGAGGIPLVIP
                     ALGDLLDQETLLASLDGLLFTGSPSNVEPHHYQGPASAAGTRHDPARDRTTLPLVRAA
                     IAAGIPVLGICRGFQEMNVAFGGTLHQRVHETAGYMDHREPADEPLEVQYAPRHPVRV
                     QAGGILDGIGLPSEIQVNSIHGQGVERLAPGLHVEALAPDGLVEAFSVEGARSFALGV
                     QWHPEWQVLTNPNYLAIFQAFGEACRKTAGQR"
     CDS             211956..213314
                     /codon_start=1
                     /locus_tag="KF707C_1960"
                     /product="glutamine synthetase family protein"
                     /protein_id="BAU71884.1"
                     /transl_table=11
                     /translation="MTTKLDQLTSWLKERKITEVECLISDLTGIARGKISPTNKFLDE
                     KGMRLPESVLLQTVTGDYVEDDIYYDLLDPADIDMFCRPDEKAVFLVPWAIEPTAMVI
                     HDTFDKQGNPIELSPRNLLKKVLKLYADKGWKPIVAPEMEFYLTKRCDDPDFPLQAPL
                     GRSGRPETGRQSFSIDAANEFDPLFEDMYDWCEMQDLDLDTLIHEEGPAQMEINFRHG
                     DALDLADQILVFKRTMREAALKHNVAATFMAKPITDEPGSAMHLHQSVVDIKTGMNIF
                     SNDDGSMSELFLHHIGGLQKYIPEVLPLFAPNVNSFRRFLPDTSAPVNVEWGEENRTV
                     GLRVPDAGPQNRRVENRLAGADANPYLAIAASLLCGYIGMVEGVNPSAPVKGRGYERR
                     NLRLPLTLEAALERMESCRDIEKYLSSKFVQAYVAVKRAEHENFKRVISSWEREFLLL
                     SV"
     CDS             213393..214748
                     /codon_start=1
                     /EC_number="2.6.1.18"
                     /locus_tag="KF707C_1970"
                     /product="omega-amino acid--pyruvate aminotransferase"
                     /protein_id="BAU71885.1"
                     /transl_table=11
                     /translation="MTNPQTLEWQALGRQHHLPPFTDYKALNAKGARIITKAEGVYIW
                     DSEGNKILDGMAGLWCVNVGYGREELVQAATRQMRELPFYNLFFQTAHPPAVELAKAI
                     AEIAPEGMNHVFFTGSGSEANDTVLRMVRHYWATKGQPQKKVVIGRWNGYHGSTVAGV
                     SLGGMKALHEQGDLPIPGIEHIAQPYWFGEGGDMSPADFGVWAAEQLEKKILEVGEDK
                     VAAFIAEPIQGAGGVIVPPETYWPKIREILARYDILFIADEVICGFGRTGEWFGSQYY
                     GNAPDLMPIAKGLTSGYVPMGGVIVRDEIVDTLNEGGEFYHGFTYSGHPVAAAVALEN
                     IRILREEKIVEKVKAETAPYLQQRWQELADHPLVGEARGVGLVAALELVKNKQTRERF
                     AGGIGMLCREHCFRNGLIMRAVGDTMIISPPLVISKDEVDELVTKARKCLDLTLAEVK
                     G"
     CDS             214907..216007
                     /codon_start=1
                     /locus_tag="KF707C_1980"
                     /note="TC 3.A.1.11.2"
                     /product="putrescine ABC transporter putrescine-binding
                     protein PotF"
                     /protein_id="BAU71886.1"
                     /transl_table=11
                     /translation="MIKTFGKTLLAMTLAGAVAGMAQADDKVLHVYNWSDYIAPDTVE
                     KFTKETGIKVVYDVFDSNETLEAKLLAGKSGYDIVVPSNNFLAKQIKAKVYQPLDKSK
                     LPNWKNLDPNLLKTVEVSDPGNQYAFPYMWGSIGIGYNPDKVKAVLGDNAPVDSWDLL
                     FKPENIEKLKSCGVSFLDSPTEILPIALHYLGYSPVSQDPKELKEAEALFLKIRPHIT
                     YFHSSKYISDLANGNLCVAVGYSGDVYQAKSRADEAKAGVNVAYNIPKEGAGTFFDMV
                     AIPADAANPDAAHAFMNFLMKPDVMAEITNFVQFPNGNAAATELVDEAIRKDPGIYPS
                     QETMAKLYAFPDLPAKVQRAMTRAWTTIKSGK"
     CDS             216147..217241
                     /codon_start=1
                     /locus_tag="KF707C_1990"
                     /note="TC 3.A.1.11.2"
                     /product="putrescine ABC transporter putrescine-binding
                     protein PotF"
                     /protein_id="BAU71887.1"
                     /transl_table=11
                     /translation="MHFPIRKMMITAAATLTLVSQAQAEQTVHIYNWSDYIGETTLAD
                     FQKETGIKPVYDVFDSNETLEGKLLAGRTGYDLVVPSNHFLGKQIKAGAFQKLDRSQL
                     PNWENLDPKLLKQLERNDAGNQYAVPYLWGTNGIGYNVEKVKAALGVDHIDSWAAIFE
                     PENMKKLSQCGVAFLDSADEMIPAVLNYMGLDPNSTNPDDYKKAEAKLMAVRPYVTYF
                     HSSKYIGDLANGDICVAAGFSGDIFQAASRAEEAGKGIEIAYAIPKEGGNLWFDMLAV
                     PADAANAKEAHAFINYLLKPEVIAKVSDYVGYANPNLKAGEFMDQEVRTDESVYPPQA
                     VLDKLYVSAELPPKVQRLMTRSWTKIKSGK"
     CDS             217382..218524
                     /codon_start=1
                     /locus_tag="KF707C_2000"
                     /note="TC 3.A.1.11.2"
                     /product="putrescine transport ATP-binding protein PotG"
                     /protein_id="BAU71888.1"
                     /transl_table=11
                     /translation="MAIASGAYKKALEGNQQPKEVLVKIDRVTKKFDETVAVDDVSLT
                     INKGEIFALLGGSGSGKSTLLRMLAGFERPSEGRIMLDGVDITDMPPYERPINMMFQS
                     YALFPHMTVAQNIAFGLKQDRLPAAEIDARVNEMLKLVHMTQYAKRKPHQLSGGQRQR
                     VALARSLAKRPKLLLLDEPMGALDKKLRSQMQLELVEIIERVGVTCVMVTHDQEEAMT
                     MAQRIAIMHLGCIEQIGSPVDIYETPINRLVCEFIGSVNLFEGEVVEDEEAHALIACP
                     QLERPIYVGHGVTTSVQDKRITYALRPEKLLVTTEQPDCQYNWSRGRVHDIAYLGGHS
                     VFYVQLPNGSIVQSFVANAERRGARPTWEDEVYVWWEDDSGVVLRS"
     CDS             218521..219429
                     /codon_start=1
                     /locus_tag="KF707C_2010"
                     /note="TC 3.A.1.11.2"
                     /product="putrescine transport system permease protein
                     PotH"
                     /protein_id="BAU71889.1"
                     /transl_table=11
                     /translation="MKIAKLKRLVPTGRHLVIGVPFFWLFLFFLLPFAIVLKISFAEA
                     DVAIPPYTDIYAWADNQIQLILNLGNYFLLSEDELYLAAYLGSLKVAFFSTLLCLLIG
                     YPMAYAIARASKEAQTVLLLLIMMPTWTAILIRVYAWMGILSNNGLLNSLLMGIGLID
                     QPLQILNTNLAVYIGVVYSYLPFMVLPLYANLVKHDPSLLEAASDLGSSNFNSFWKIT
                     VPLSKNGIIAGSMLVFIPVVGEFVIPELLGGPETLMIGKVLWQEFFNNRDWPVASALA
                     VVMLAILLIPIILFNKNQAKELEGKV"
     CDS             219426..220310
                     /codon_start=1
                     /locus_tag="KF707C_2020"
                     /note="TC 3.A.1.11.2"
                     /product="putrescine transport system permease protein
                     PotI"
                     /protein_id="BAU71890.1"
                     /transl_table=11
                     /translation="MKRFSFSNLMLWVGLLFIYLPMVILVIYSFNASKLVTVWGGWSV
                     KWYVGLLDNTQLMNSVFRSLEIALYTAIAAVALGTLAAFVLTRIPRFRGRTLFGGMVT
                     APLVMPEVITGLSLLLLFVAMAQLVGWPEERGLVTIWIAHTTFCSAYVAIVVSARLRE
                     LDLSIEEAAMDLGARPWKVFILITIPMIAPSLAAGGMMSFALSLDDLVLASFVSGPGS
                     TTLPMEVFSAVRLGVKPEINAVASLILLSVSLFTFLAWYFTRKAEERRKRAIQQAMEV
                     MAEEAGGANWKPGSTQTA"
     CDS             complement(220435..221187)
                     /codon_start=1
                     /locus_tag="KF707C_2030"
                     /product="hypothetical protein COG3332"
                     /protein_id="BAU71891.1"
                     /transl_table=11
                     /translation="MCLIVFAWRPGHDVPLVLAANRDEFYARPTLPLARWEDAPGVVA
                     GRDLEAGGTWLGAGPRGRFAALTNIRDPRTPPVGRTRGELCVQFLRGEMGPGEFLEDA
                     LRRAGDYSGFNLLVGDDRELWFLNPRSGGPINLGPGVYGVSNADLDTPWPKVERGKAA
                     IAECLEPPSTDALLNLLHDPEQAPDHILPETGVGLNTERMLSSVFIATRTYGTRASSA
                     LIVRADGSRELVERSYGPYGALLGDVRFDLQD"
     CDS             221339..222121
                     /codon_start=1
                     /locus_tag="KF707C_2040"
                     /product="protein of unknown function DUF81"
                     /protein_id="BAU71892.1"
                     /transl_table=11
                     /translation="MEFLLYLVLGACAGVLAGLFGVGGGMIIVPVLVFSFTAHGFDVG
                     ILTHLAVGTSLATIIFTSVNSVREHHRKGAVRWPIFAWMALGILAGAGLGSLTATAIQ
                     GPVLQKIIGVFAILVALQMGLDLKPKASRGVPGKPGLTAAGVVIGWASAIFGIGGGSL
                     TVPFLVWRSLPIQQAVATSSACGLPIAAAGALSFMALGWNHEQLPPYSLGFVYLPALV
                     GIAVTSMFFARFGARLAHRLSPRLLKRLFALLLVSVGLNFLI"
     CDS             222131..222934
                     /codon_start=1
                     /EC_number="2.4.99.-"
                     /locus_tag="KF707C_2050"
                     /product="prolipoprotein diacylglyceryl transferase"
                     /protein_id="BAU71893.1"
                     /transl_table=11
                     /translation="MLAYPQIDPVAIALGPLKIHWYGLMYLIGIGGAWWLASRRLKAF
                     DPTWSREKLSDLVFWVALGVIAGGRLGYVLFYDLSAYLANPLLILEVWKGGMSFHGGL
                     IGVMLATLWFGKRNNKSFFQLMDFIAPLVPIGLGAGRIGNFINAELWGKATDLPWAMI
                     FPTDPAQLPRHPSQLYQFALEGVALFAILWFYSRKPRPTMAVSGMFALFYGLFRFAVE
                     FVRVPDAQLGYLAFGWLTMGQILCLPMIVGGIALIVWAYRRQDAQGVTP"
     CDS             222931..223725
                     /codon_start=1
                     /EC_number="2.1.1.45"
                     /locus_tag="KF707C_2060"
                     /product="thymidylate synthase"
                     /protein_id="BAU71894.1"
                     /transl_table=11
                     /translation="MKQYLDLMRRVRETGTFKSDRTGTGTYSVFGHQMRFDLAEGFPL
                     VTTKKCHLKSIVHELLWFLQGDTNIQYLKDNGVSIWDEWADENGELGPVYGYQWRSWP
                     TPNGESIDQITKLIEMIRKNPDSRRLIVSAWNPALVDEMALPPCHALFQFYVAEGKLS
                     CQLYQRSADIFLGVPFNIASYALLTLMVAQVCDLAPGEFIWTGGDCHLYANHLEQADL
                     QLTREPLPLPTMKLNPEVKDLFAFRFEDFELVGYQAHPHIKAPVAV"
     CDS             223774..224772
                     /codon_start=1
                     /EC_number="3.1.27.6"
                     /locus_tag="KF707C_2070"
                     /product="ribonuclease I precursor"
                     /protein_id="BAU71895.1"
                     /transl_table=11
                     /translation="MKAPFAVLLTGFVGLWSSFATAEPAQGSFVAAQTCEAFQSIRKR
                     TNPDDAKVRPGQRYEVVEVNKRDYDWLRVRIPDSPTPLRWVAASCGSVEGLAFNTGDT
                     ERSEAGGDVCRQPDQHDGYVLAATWQPGFCEHVPFKGRKPECDALASGELQARHLTLH
                     GLWPNRQSCGKNYGHCDGPALRLSESTLEHVRPWMPNFQFGTSFGRYQWDKHGVCQTQ
                     MDDDAYFRRAADLVRQLDATRAGQYVVENIGGAISRQAFYQRVTEEFGSARAGNNILL
                     ICAKGNYLQEIRVSLPRELKPADSLVGVMDGQFAPRRPDDRNACRGDRILIEAAGS"
     CDS             complement(224900..226033)
                     /codon_start=1
                     /locus_tag="KF707C_2080"
                     /product="MloA protein"
                     /protein_id="BAU71896.1"
                     /transl_table=11
                     /translation="MQVEQFISGHWQQQYQYKSFSPTRINQEWLWMDPRLNTLLEQAS
                     RALAELNTLSLMVPDVDLFIRMHIAKEANTSSRIEGTQTQMDEAIMRKEQVAPEKRDD
                     WQEVQNYIEAINTAVDQLQGVPLSIRLLKQTHSVLMQGVRGAHKMPGEFRASQNWIGG
                     SNLNNAVFVPPHPHEVPDLMSDLERFWHNDDIRVPDLIRIALSHYQFETIHPFLDGNG
                     RIGRLLITLYLVDKGLLHKPALYLSDFFERNRGAYYDALTVVRASNDLLHWLRFFLTA
                     IVETATSSKDTFMAIMALRQDVEHQILALGGRAENAKKLLMLLYQRPLLNVNEAAEHL
                     GVTHQSANALIKQLEQMKILVETTGYGRNRLYLFQRYFDLFVK"
     CDS             complement(226102..227478)
                     /codon_start=1
                     /locus_tag="KF707C_2090"
                     /product="probable integral membrane protein NMA1898"
                     /protein_id="BAU71897.1"
                     /transl_table=11
                     /translation="MTKPLKLAVVGHTNVGKTSLLRTLLRDRSFGEVSHRPSTTRHVE
                     GARLSVDGTPLLELYDTPGLEDAIALLEHLERLDRPGERLDGPARIARFLEGSEARQR
                     FEQEAKVLRQLLASDAGLYVIDAREPVLAKYRDELAVLALCGRPLLPVLNFVASGSHR
                     EDDWRAALARLGLHALVRFDSVAPPLDGEQRLYDSLALLLERARPQLQRLVDDHQAQR
                     RLRLEAGSRLIAELLLDAAACRRSVPAQETALEAATERLRQQVRDREQRCVEALLRLY
                     AFDDGAAATGELPLLGGRWGDDLFNPETLRQLGVRLGGGMAAGAAAGAGLDLLVGGLT
                     LGAAAALGAIAGGAWQTVGHYGERLLGKLKGQRELTVDDAILRLLALRQCQLLQALDA
                     RGHAAFEAVRVETPEERQWREGKLPPELSRARAHPEWSSLNTGAELEQAERQAEVAQL
                     AKQFLPAQ"
     CDS             complement(227471..228853)
                     /codon_start=1
                     /locus_tag="KF707C_2100"
                     /product="probable integral membrane protein NMA1899"
                     /protein_id="BAU71898.1"
                     /transl_table=11
                     /translation="MSRLDTLSHLDRLWLTEAIRLREEHAGPLEDAEANRRANAAGGD
                     LPQRIQARALWLAERDGQYPALQRWRQGARLAGLLLAALAIISGAGLALAALGDGQRP
                     VNLFWALGSLLGLHLLTLLGWALSFGLGGSASLLGRLWLWASGKLARDARAAHLAPAL
                     LLLLQRHGLTRWGLGALVHGAWLLALGSALVMLLLLLSTRRYGFVWETTLLDSDTFVV
                     LTQALGALPGLLGFSLPDIETIRASSSALADDGARQAWSGWLLGVTFTYGLLPRLLLG
                     LLCLGRWLHGRSRLALDLGLPGYNLLRERLQPPSERLGVCDAAADAPMEPTPHAFNGR
                     SEGALLVAIELDDRRPWPPALPKGVGDAGVLDSREQRQRLLGQLSRFPAERLAVACDP
                     RRSPDRGTLALIGELARSAGEIRIWLLPAPPGEALDSHRLEDWQQALARLGLPFSQGA
                     PMNWLESGHD"
     CDS             complement(228940..230448)
                     /codon_start=1
                     /locus_tag="KF707C_2110"
                     /product="xanthine permease"
                     /protein_id="BAU71899.1"
                     /transl_table=11
                     /translation="MQRPEDENLGIGANFAYGLQHVLTMYGGIVAVPLIIGQAAGLSP
                     ADIGLLIAASLFAGGLATLLQTIGLPFFGCQLPLVQGVSFAGVATMIAIIGGNGQGGI
                     PVVLGAVISASLIGLLITPVFSRITKFFPPLVTGIVITTIGLTLMPVAARWAMGGNSQ
                     SPEFGSVANVSLAAFTLATVLLLSKLGSASISRLSILLAMVIGTVAAVFFGMADFSKV
                     LEGPLVAMPTPLHFGMPEFQLAAILSMLIVIIVTLVETSADILAVGEIIGTKVDSKRL
                     GNGLRADMISSSVAPLFGSFTQSAFAQNVGLVAVTGVKSRYVVATAGLILVTLGLLPV
                     MGRLIAAVPTAVLGGAGVVLFGTVAASGIRTLAQVDYRNNMNLIIVATSIGFGMIPIA
                     APSFYHHFPAWFETIFHSGISSAAIMAILLNLLFNHLKAGNSDQQSVFVAASERTLRY
                     QDIAVLHEGDYFRDGKLYDCDGNEVPVTDRDDHHHGGAPEPRVKMAAGSHSH"
     CDS             230672..231277
                     /codon_start=1
                     /EC_number="1.5.1.3"
                     /locus_tag="KF707C_2120"
                     /product="dihydrofolate reductase"
                     /protein_id="BAU71900.1"
                     /transl_table=11
                     /translation="MRRPSGCPDFVTDDPASVGFLAVVPAGILAAMNKTLPLCLIAAL
                     AQNRVIGRDNQLPWHLPADLKHFKALTLGKPIIMGRKTWDSLGRPLPGRLNLVVSRQA
                     GLQLEGAEVFPDLATAIARAEVWAREEEVDEVMLIGGAQLYDQGLPEADRLYLTQVAL
                     EPEGDAFFPEVPAADWHLTSSIEHEASDTTPAYAFQVWERR"
     CDS             complement(231398..231859)
                     /codon_start=1
                     /locus_tag="KF707C_2130"
                     /product="phosphoesterase, putative"
                     /protein_id="BAU71901.1"
                     /transl_table=11
                     /translation="MTLRIGLIADTHGLLRPQALAALEGCHHILHAGDIGKPEILDAL
                     RQLAPLTVVRGNNDTQDWALEIPHDATLCLGGARLYLVHDQADIPPGLTTRGIDAIVT
                     GHSHKPLVTSRDGILHVNPGSAGPRRFSLPISVGFLLVGDGVRAELRALDI"
     CDS             complement(232019..233857)
                     /codon_start=1
                     /EC_number="4.2.1.9"
                     /locus_tag="KF707C_2140"
                     /product="dihydroxy-acid dehydratase"
                     /protein_id="BAU71902.1"
                     /transl_table=11
                     /translation="MPDYRSKTSTHGRNMAGARALWRATGMKDEDFKKPIIAIANSFT
                     QFVPGHVHLKDLGQLVAREIEKHGGVAKEFNTIAVDDGIAMGHDGMLYSLPSREIIAD
                     SVEYMVNAHCADAIVCISNCDKITPGMLMAALRLNIPVVFVSGGPMEAGKTKLANHGL
                     DLVDAMVAAADDSCSDEKVAEYERSACPTCGSCSGMFTANSMNCLTEALGLSLPGNGS
                     TLATHADREQLFLRAGRLAVELCQRYYGEGDESVLPRNIASFKAFENAMTLDIAMGGS
                     TNTILHLLAAAQEAEIDFDLRDIDRLSRKVPQLCKVAPNIQKYHMEDVHRAGGIFSIL
                     GELARGGLLHTDVPTVHSPSMADAIAQWDITQTDDEAVHTFFKAGPAGIPTQVAFSQS
                     TRWDSLDDDRENGCIRSVEHAYSQEGGLAVLYGNIALDGCVVKTAGVDESIHVFEGTA
                     KIFESQDAAVKGILSDEVKPGDVVVIRYEGPKGGPGMQEMLYPTSYLKSKGLGKQCAL
                     LTDGRFSGGTSGLSIGHASPEAAAGGAIGLVQDGDKIHIDIHNRTIQLLVSDEELSHR
                     RHVQEKKGWKPAAPRARKVTTALKAYALLATSADKGAVRNKAMLEG"
     CDS             complement(234096..235121)
                     /codon_start=1
                     /EC_number="1.5.1.21"
                     /locus_tag="KF707C_2150"
                     /product="delta 1-piperideine-2-carboxylate reductase"
                     /protein_id="BAU71903.1"
                     /transl_table=11
                     /translation="MQNPPSDRVQLSFDELRNLIAGIFECHGTSARTAAILAENCAAA
                     QRDGSESHGIFRIPGYLSSLGSGWVNGQAEPVVEDVGAAFVRVDAAGGFAQPALEAGR
                     ALALEKVRANGMAVLAIRNSHHFAALWPDVEPFAREGLVALAFVNSMTCVVPHGGHRP
                     LFGTNPIAFAAPRSGGDPLVFDLATSAIAHGDVQIAAREGHALPEGFGVDAQGRPTTD
                     PRAVLDGGALLSFGGYKGSALSMMVELLAAAITGGNFSFEFDWSGHPGAQTPWTGELL
                     ILIDPDRGASRPFAERCEHLITRMVEAGQERQPGDRRYRQRARAEREGIPLKAADLER
                     LRALAGR"
     CDS             235236..236111
                     /codon_start=1
                     /locus_tag="KF707C_2160"
                     /product="transcriptional regulator"
                     /protein_id="BAU71904.1"
                     /transl_table=11
                     /translation="MNRTLKERLEDSLSARTASSRAIANYMLANLQELPFETSAALAE
                     KLGISESTVGRFCRALGYAHFKALKADLKGDLGDSPWLIGDRLKEFRQQAVAGEDALS
                     VGLEREMAALVRVYEHSRTLQWRTVCERLASIPRVYAAGFQTERGISVSFVHLLQYLR
                     DGVHLVDGASGYFGDVLLSAPGQSALVVFEARRYSRHAIALCRHAREAGIPVTLVTDD
                     YCDWAEQHADEVFRVPTDLNLFWESTGPMLTLVNLLLNDVFKCLGPDVEQRLESVAAL
                     HNEFVGYTSSPGSSR"
     CDS             236138..236896
                     /codon_start=1
                     /locus_tag="KF707C_2170"
                     /note="periplasmic amino acid-binding protein"
                     /product="amino acid ABC transporter"
                     /protein_id="BAU71905.1"
                     /transl_table=11
                     /translation="MKRLTRLALASLAFCGLVATAQAETLRIATEGAYPPFNYVDSKN
                     QLHGFDVDIANALCAKLKVECTLVAQDWDGIIPALLAKKYDAVVASMVITEERQKKVA
                     FTDRYYRTRLAVAVAKGSELKDTRPESFKGLVVGAQSATTQGMYAEDIYGAAGAEVKL
                     YPSQDEANADLATGRLDALVHDKFPLLDWLAKDGNDCCVLLGDIQGTDDEVAIAVRQE
                     DNALRERLNKALAEMVADGTYKQIASRYFPFDIY"
     CDS             236950..237669
                     /codon_start=1
                     /locus_tag="KF707C_2180"
                     /product="arginine transport system permease protein ArtQ"
                     /protein_id="BAU71906.1"
                     /transl_table=11
                     /translation="MFEQLALLSLGEGGWGMALLAGALVTLSLALACLPLGLSLGLLV
                     ALGARSPHRGRRALSSVFATVFRGLPELLTLLIVYYGCQIGVQKLLAHFGHTTEVSIN
                     AFLAAMIAFSLVFAAFSSQVWLGAFKVIGKGQYEAAQVLGLSRVTTFFRVILPQLTRV
                     ALPGLSNNWLSLLKDTSLVSTISLVDVMRQTNLAVSATKEPMLFYGCACLIYLFFSAL
                     SGRVFSYAEKRYSLGHRSQRA"
     CDS             237666..238370
                     /codon_start=1
                     /locus_tag="KF707C_2190"
                     /note="permease protein"
                     /product="amino acid ABC transporter"
                     /protein_id="BAU71907.1"
                     /transl_table=11
                     /translation="MSEFLHFFVDPELLDRYGLRLLDGLLVTAKLVAISFSLGLVLGL
                     LLALARNSGSRALRGFAGGYIYLFRGSPLLAQLFLLYYGVGSFREFWQDLGLWWFFRD
                     AWFCALLAFTLNTAAYQAEIFRGSLLAIAPGQYEAASALGLSRRTTFFRVVLPQSLLV
                     AVPPLGNELILMIKASAIASLVTIHDLMGVAKAGFSRTFDFQLYLWAAVLYLVLVELI
                     RRGLLRVEGRLGRHLN"
     CDS             238419..239660
                     /codon_start=1
                     /EC_number="1.4.99.1"
                     /locus_tag="KF707C_2200"
                     /product="D-amino acid dehydrogenase small subunit"
                     /protein_id="BAU71908.1"
                     /transl_table=11
                     /translation="MDCDILVLGAGIVGVSTALHLQARGRDVCLVDRAEPGSGTSHGN
                     AGLIERSSVIPYAFPRDLGALLRYGLNRQPDVRYSPTYLPRLAPWLAAYWYQSAPRRL
                     EAASRAMLPLVERSVEEHDQLVAAAGLEHLIRAKGWMDIYRSPEALARAADEARSLDR
                     FGLRYEILDGDALRRREPHLGPVAAGGIHWHDPKTVLDPGALVRGYAELFVRRGGRLL
                     TGDARGLTRRGDAWCLSVGDLDLQAPQVVVALGPQSGDLFRQLGYRIPLAIKRGYHMH
                     YAPVEGAGLDHSICDAQSGYVLAPMARGIRLTTGIEFAHPDAPANEIQLRRAERLARE
                     LLPLGRRLDAEPWLGRRPCLPDMRPVIGAAPRHPGLWFNFGHAHHGLTLGPVSGRLLA
                     EVMTGERPFTDPTPYGAQRFG"
     CDS             239777..240499
                     /codon_start=1
                     /locus_tag="KF707C_2210"
                     /product="amino-acid ABC transporter"
                     /protein_id="BAU71909.1"
                     /transl_table=11
                     /translation="MVLEGLEKQYGDFSVLKGIDLVVRPGERIVLCGPSGSGKSTLIR
                     CINRLEGASGGRILVNGCDLMADPRRGSEVLREVGMVFQHFNLFPHMSVLDNCTLAPM
                     SVRGLSRAEAEERAREYLRKVGIESHAHKYPSQLSGGQQQRVAIARALCMEPKIMLFD
                     EPTSALDPEMVGEVLDVMVKLAGSGMTMLCVTHEMGFARQVAERVLFLEGGRIVEDSP
                     PETFFNAPKSERAKAFLSQILH"
     CDS             complement(240632..241828)
                     /codon_start=1
                     /locus_tag="KF707C_2220"
                     /product="LSU m5C1962 methyltransferase RlmI"
                     /protein_id="BAU71910.1"
                     /transl_table=11
                     /translation="MSLPSLRLKANADRRLRAGHLWVYSNEVDVVATPLTGFQPGDQA
                     ILEAAGGKALGVVALSPNNLICARLVSRDVKHSLDKSLLVHRLNVALSLRERLFDKPF
                     YRLVYGDSDLLPGLVVDRFGDHLVVQLASAAMERNKAAVLDALVQVLKPRGVLWKNDS
                     SARDAEGLERYVDTAFGVVPEWVALEENGVKFEAPVLEGQKTGWFYDHRMNRARLAPY
                     AKGKRVLDLFSYIGGWGVQAAAFGASEVFCVDASGFALDGVERNATLNGVAEKVTCVE
                     GDVFEALKELKAAEERFDVVVADPPAFIKRKKDLKNGEAAYRRLNEQAMRLLNKDGIL
                     VSASCSMHLPEDDLQNILLGSARHLDRNIQLLERGGQGPDHPVHPAIAETRYIKSLTV
                     RLLPNA"
     CDS             242005..242871
                     /codon_start=1
                     /locus_tag="KF707C_2230"
                     /product="predicted signal transduction protein"
                     /protein_id="BAU71911.1"
                     /transl_table=11
                     /translation="MSQELSAEQIRQVLQGISVPPQPQIMVDLQMEQVMPSPDLRSIA
                     KLISQDPGLSGALLKIVNSPFFGLTNRIASIQQAVNLLGCNTVINLINAQSIKGEMSD
                     ETIVTLNRFWDTAQDVAMTSLTLAKRIGYQSPDEAYALGLFHNCGIPLMLKRFPDYML
                     VLEEAYASAGPERRVVDTENRLLNTNHAVVGYFTARSWRLPEHLCEAIANHHNALSII
                     TDDSGRDAQLKTLLAILKMAEHICASHLVLGNQAEDYEWLSIRSQVLDYVGLSEYDFE
                     NLKETIRELGVN"
     CDS             242897..243709
                     /codon_start=1
                     /EC_number="3.2.2.23"
                     /locus_tag="KF707C_2240"
                     /product="formamidopyrimidine-DNA glycosylase"
                     /protein_id="BAU71912.1"
                     /transl_table=11
                     /translation="MPELPEVETTRRGIAPYLEGQRVSRVIVRERRLRWPIPEDLDVR
                     LSGQLILRVERRAKYLLLGAEAGTLISHLGMSGSLRLVEAGLAAGKHEHVDIELESGM
                     ALRYTDPRRFGALLWSQDPLNHELLRHLGPEPLTDLFDGDRLFQLSRGRSMAVKPFIM
                     DNAVVVGVGNIYASEALFAAGIDPRREAGSISRARYLKLAEAIKRILAQAIECGGTTL
                     RDFVGGDGKPGYFQQELWVYGRGGEFCRQCGSTLREIRLGQRASVYCPRCQR"
     CDS             243772..244350
                     /codon_start=1
                     /locus_tag="KF707C_2250"
                     /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
                     /protein_id="BAU71913.1"
                     /transl_table=11
                     /translation="MSGNYLPRNPIAEAIGHGVLRLMGWRIEGRLPPLDKFVVIGAHH
                     TSNWDFVLFLAVKFVLRLNARWFGKHTIFRWPFGGLLQRWGGVPIHRHLKLNSVDQAV
                     ERFRESREFMLVISPEGTRKRVERWKMGFYHIARGAGVPIVPAALDYVNRRVVIGEPF
                     SPTGDEQADLRQLLAFFRPYVPKKPDYAFNGD"
     CDS             244421..244759
                     /codon_start=1
                     /locus_tag="KF707C_2260"
                     /product="cation/multidrug efflux pump"
                     /protein_id="BAU71914.1"
                     /transl_table=11
                     /translation="MNLFRSTAAVLALTTGLLALPAHAEVVQENVSGDPMYTANAPSG
                     YSMAGDILIARPLLIGATVIGAGLFIISLPFSALGGNVGEAAEQLVGVPAQEAFVRCL
                     GCTLSGYKAD"
     CDS             244885..246735
                     /codon_start=1
                     /locus_tag="KF707C_2270"
                     /product="sodium-dependent phosphate transporter"
                     /protein_id="BAU71915.1"
                     /transl_table=11
                     /translation="MKDYARLLLLVLAAAGLIASFWFSSGWLELCAGLALFLFGMQCL
                     EEGLRQLAGGKLEQLLARSTATSFKGLMFGICGTLLLQSSTLVSLLTIAFISAGLIQL
                     AGGIAILFGANLGATSGIWLLALAGQNLSLSPLALPLLVFGVLGGFLGEKSKAAGRIV
                     LGIAFIFLGIDQIKEGFASFGDGLDLTAYQADGLAGSLLFALVGLLLTLVLQSSHATL
                     MLTLAALAGGQLDLAQGFAIAIGSNVGSSVTTAFVGSLGGNRSGQRLALAHVLFNLVT
                     CSLAFVLLAPLSWLVGLIAERTGLGTNELIQLAMFHSLINAMGVLLFWPLQGRLAQQL
                     VRWLPERAEPQVLITELAAGPEEPQRTRARYLNDRALDSVDAASSAVVRELRHLGRLS
                     LEVICHALYLPVDQLARVQGDESLLQGRPERHHLDAEALYQRHIKGVYADLLSFMGRL
                     DLPLDEAHQQFWVSSQLAALQLVDAVKDAKHLQKNLGRFLDQEHSPVREAYVDLRRHL
                     LVMLHELRELGRSELPEEAWSQRLRWLDDQAAAFDGRFRARLFNAVRLGEMDGLQTSS
                     LMNDLGYASRIFQSLRNVLMLGEGQALFRELRRLGRDDETLIVLDVGRPS"
     CDS             complement(246743..248440)
                     /codon_start=1
                     /EC_number="2.3.2.2"
                     /locus_tag="KF707C_2280"
                     /product="gamma-glutamyltranspeptidase"
                     /protein_id="BAU71916.1"
                     /transl_table=11
                     /translation="MGRLVRGACRGALLATLLLLGGVAQAAGPGRAAVATPHPSATVA
                     GLETLAQGGNAFDAAVAIAAALAVAEPYGSGLGGGGFFLLRQAGDKPVYRFLDARERA
                     PLAAHAKLYLRDGKPDPALSLDGPLAAAIPGLPAALADLAGHYGRLPLADTLTPAIRL
                     ARDGISVDRIYRERAGFRLAAMRDDPETARLFLDHKGEVPEEFSLLRQPELANTLERM
                     ARYGKAGFYSGPVAEKLVRGVNAAGGIWSLEDLDRYRTVEREPIRFPLAEGRELISAP
                     PPSAGGIALAQSLAMLQQLPWREADRVQRTHYVVEALRRAYRDRGLLGDPDFVAIPTA
                     RLLDASYLKQLAQGIDPRRATPSSALPPSPSWREGDHTTHFAVIDKDGNAVAATLSIN
                     LPFGAAFTVPGTGVLLNDEMDDFAANPQGANAYGLAASQANAVGSGKRPLSSMSPTFI
                     ESASEFTAFGTPGGSRIPSMVLLSVLEYLDGQPVSRWPAVARYHHQYLPDVIEHEPGA
                     FSSDESAELRARGHALKPLGRNYGNQQVLYWNKEKGSLEAASDPRGVGRADLLEEPR"
     CDS             complement(248444..248695)
                     /codon_start=1
                     /locus_tag="KF707C_2290"
                     /note="iron-sulfur binding"
                     /product="4Fe-4S ferredoxin"
                     /protein_id="BAU71917.1"
                     /transl_table=11
                     /translation="MSLKITDDCINCDVCEPECPNGAISQGEEIYVIDPNLCTECVGH
                     YDEPQCQQVCPVDCIPLDEAHVESKDELMQKYLKLTGKA"
     CDS             complement(248836..249315)
                     /codon_start=1
                     /EC_number="2.7.7.3"
                     /locus_tag="KF707C_2300"
                     /product="phosphopantetheine adenylyltransferase"
                     /protein_id="BAU71918.1"
                     /transl_table=11
                     /translation="MNRVLYPGTFDPITKGHGDLIERASRLFDTVIIAVAASPKKNPL
                     FSLEQRVALAREVTKHLPNVEVVGFSTLLAHFVKEQNANVFLRGLRAVSDFEYEFQLA
                     NMNRQLAPDVESMFLTPSEKYSFISSTLVREIAALGGDITKFVHPAVAAALAERFKR"
     CDS             complement(249408..251003)
                     /codon_start=1
                     /locus_tag="KF707C_2310"
                     /note="FIG022869, GMC family"
                     /product="oxidoreductase"
                     /protein_id="BAU71919.1"
                     /transl_table=11
                     /translation="MPVPDLFAEGLARGWKTHDGSRLERDLTLEADVAIVGSGAGGGT
                     TAEILSAAGLKVLLIEEGPLKTSTDFKMQEAEAYPALYQEGIGRMSKDGAITILQGRA
                     VGGTTLVNWTSSFRTPDPTLEHWAREHGVKGLSPAEMAPWFEKMEQRLGVAPWMFPPN
                     ANNDVIRLGCEQLGYHWKVIPRNVRGCWNLGYCGMGCPTNAKQSMLVTTIPATLDKGG
                     ELLYLARADKLLLEGDRVSGLECLALDERCVAPTGRRITVRARHYVLSGGGINTPALL
                     LRSRAPDPHGRVGKRTFLHVVNFSAATFDRLINPFYGAPQSIYSDHFQWDDGATGRMS
                     YKLEVPPLHPALTSTLLGRFGTDNALRMEQLPHTNVMLALMRDGFHPDSAEGTVELRG
                     DGSPVLDYRMTDYTWDGIRRAFHVMAEIQFAAGARAVLPLHNDARHVTRLDEARRLID
                     ELPLALYRTRLGSAHVMGGCAMGEDPTRAVADSLGRHHQLANLSIHDGSLFPTSIGAN
                     PQLSVYGLSARLASALAERLGKA"
     CDS             complement(251058..251603)
                     /codon_start=1
                     /locus_tag="KF707C_2320"
                     /note="FIG028932"
                     /product="hypothetical protein"
                     /protein_id="BAU71920.1"
                     /transl_table=11
                     /translation="MSETTLDTPGLSRRNLLKVGLFGSAFLATAGLTASLTGCSASVP
                     ASGYAALRDADLPFLRALVPVMLDGAVPAGRMADAVTGTLESLDHALHRLSPEMLRLT
                     RQLFDVLALPVTRGPLTGVWGRWENASAEDIRQFLGRWENSSIGLLKMGHASLLQLVM
                     MAWYGRPESWAHCGYPGPPQV"
     CDS             complement(251632..253062)
                     /codon_start=1
                     /EC_number="1.2.1.3"
                     /locus_tag="KF707C_2330"
                     /product="aldehyde dehydrogenase"
                     /protein_id="BAU71921.1"
                     /transl_table=11
                     /translation="MVADLAYLQHSQQQISQLEALFQRQREAFRAHPMPSAEQRIQWL
                     RSLAELISSERDALIAAVSSDFGNRSADETLLAEIMPSLHGIHYARKRLRKWMKPSRR
                     AVGLAFQPAAARVVYQPLGVVGVIVPWNYPLFLAIGPLVGALAAGNRVMIKMSESTPA
                     TSRLLKELLARIFPEDLVAVVEGEAEVGVAFSRQPFDHLLFTGATSIGRHVMRAAAEN
                     LTPVTLELGGKSPAIVSAEVPLADAAERIAFGKTLNAGQTCVAPDYVLVPEDRVDGFI
                     EAYREVVQRFFPKLADNPDYTAIINERQLGRLKGYLADAEAKGAKLVPLFPEGEDRRL
                     PHTLVLNATDDMKLMQEEIFGPLLPVVPYRRIDDAFAYINARPRPLALYYFGYGKAEQ
                     QRVLHETHSGGVCLNDTLLHVAQDDMPFGGIGPSGMGHYHGHEGFLTFSKAKGVFIKQ
                     RFNAAKLIYPPYGKAIQKLVYRLFVR"
     CDS             253316..253981
                     /codon_start=1
                     /locus_tag="KF707C_2340"
                     /note="TetR family"
                     /product="transcriptional regulator"
                     /protein_id="BAU71922.1"
                     /transl_table=11
                     /translation="MAPRTKTRDRIVLESLGLFNTQGERNVTTNHIAAHLGMSPGNLY
                     YHFRNKQEIITELFGQYEARVDAFLRVPEGRAVTVEDKTFYLESLLAAMWDFRFLHRD
                     LEHLLESDAELAVRYRQFAQRCLDHALGIYRGFVEAGILLMTPAQTEALTLNSWIIIT
                     SWVRFLCTTRGESADISQDLLRRGIYQVLALEGGYLAPEAQPAVKALYEKLYVPLDAI
                     VPA"
     CDS             complement(253948..254988)
                     /codon_start=1
                     /locus_tag="KF707C_2350"
                     /note="alpha/beta fold family functionally coupled to
                     Phosphoribulokinase"
                     /product="hydrolase"
                     /protein_id="BAU71923.1"
                     /transl_table=11
                     /translation="MPAFHQQVTAHSSFQPAWWLPGPHLQTLWSPFFRVPAQLERQRE
                     RLWLEDGDFLDLDWHGPHEADRPLVLVLHGLTGSSASHYVLGLQQELAARRWASVALN
                     WRGCSGEPNRLPRGYHSGVSEDLAATIAHLRACRPLAPLYAVGYSLGGNVLLKHLGET
                     GLDCGLQGAVAVSVPYRLDQCADRIALGFSRVYQAHFMREMVAYVKTKRQLFTHQGQS
                     EHLSALDRLGTLDGMRTFWDFDGRVTAPLHGFDDAHDYYRRASSRYYLGGIRIPTLLI
                     QSADDPFVFRHSLPEAQELSATTRMELHARGGHVGFVEGSPRKPAFYLERRIPDWLDS
                     CRQAGTMASSGT"
     CDS             complement(255003..255626)
                     /codon_start=1
                     /EC_number="2.1.1.171"
                     /locus_tag="KF707C_2360"
                     /product="16S rRNA (guanine(966)-N(2))-methyltransferase"
                     /protein_id="BAU71924.1"
                     /transl_table=11
                     /translation="MRKPNAKPARPGHGGQGQLRIIGGEWRSRRFAFPDGPGLRPTPD
                     RVRETLFNWLAPHVEGARVLDPFAGSGALFLEALSRGAEQALALDLNPDSVAALRGHL
                     DVLRCGKGQLLQSDALRYLDTQAPSPFDLVFLDPPFNLGLLAPVCELLENRGWLAPRA
                     WVYTESETPPSALGLPSNWRLHREKKAGQVYYALWQRSAETGHLPDV"
     CDS             complement(255626..257113)
                     /codon_start=1
                     /locus_tag="KF707C_2370"
                     /note="FIG015287"
                     /product="zinc protease"
                     /protein_id="BAU71925.1"
                     /transl_table=11
                     /translation="MSDRNGLRYGLLGLALIVLLGLLGFIADRPNSSATAETAAPPST
                     PGLESLAELNGNAPGRRRLEIQSWKTTEGTRVLFVAAPELPMFDLRLTFAAGSSQDGD
                     LPGLATLTNAMLNEGVAGKDVTAIAEGFESLGAEFGNGAYRDMAIASLRSLTKPELRT
                     PALELFTQVVGAPDFPEDALARIKNQMLAGFQYQKQNPGRLAGLELFEQLYGQHPYAH
                     PSDGTEASIPGITVDQLRAFHRKAYAAGNLVIALVGDLSRAEAEAIANQVSRALPKGP
                     ALPKLPEPAAPKAGVHHIEFPSKQTHLMLAQLGIDRNEPDYAALYIGNQILGGGGFGT
                     RLMDEVREKRGLTYGISSGFTAMQVKGPFMIGLQTRAEMSQGTLALIQDIVRRYLAEG
                     PTRKELEDAKREIAGSFPLSTASNADIVGQLGAIGFYDLPLTYLEDFMTQVQALDVAQ
                     VKAAMARHLDPDQFVIVTAGPTVSQQDLPPPTDKPADLPSGVPEH"
     CDS             complement(257106..258461)
                     /codon_start=1
                     /locus_tag="KF707C_2380"
                     /note="FIG015547, M16 family"
                     /product="peptidase"
                     /protein_id="BAU71926.1"
                     /transl_table=11
                     /translation="MKGIARQAAGLLICALCLPALTLAADTQPTHEFTLDNGLKVVVR
                     EDHRAPVVVSQLWYKVGSSYETPGQTGLSHALEHMMFKGSRKLGPGEASRILRELGAE
                     ENAFTSDDYTAYYQVLARDRLGVAFELEADRLASLRLPPEEFAREIEVIKEERRLRTD
                     DKPSAKAFERFKAMAYPASGYSIPTIGWMADLDRMKVEELRHWYQSWYAPNNATLVVV
                     GDVTADEVKGLAQRWFGDIPRRAVPPAKRPLELATPGERRITLHVRTQLPSLVMGFNV
                     PGLATAPEARQVHALRLISALLDGGYSARLPSRLERGEELVSGASAWYDGFSRGDSLF
                     VVSATPNVQKSRTLAQAEAGLWRELEALKRTPPSAEELQRVRAQVIADLVYQRDSITS
                     QATTIGQLETVGLSWKLMDQDLAALEAVTPADIQAAARTFFTRDRLSVAHVLPEESGH
                     E"
     CDS             259588..261321
                     /codon_start=1
                     /EC_number="2.7.7.49"
                     /locus_tag="KF707C_2390"
                     /product="retron-type RNA-directed DNA polymerase"
                     /protein_id="BAU71927.1"
                     /transl_table=11
                     /translation="MKTQLETSVTSASFDEDMTWHSLDWASIQTSVRKTQLKIAQATR
                     EGNWRRVKRLQRMLTHSFHGRCLATKRVTENRGRKTPGVDGATWGSPQAKLQAVIRLS
                     KKRGYRPQPLRRVWIPKPGKQEKRPLGIPTMIDRAWQALHLLALEPVVESTSDLKSYG
                     FRPDRSTADAMVELFALLSRQDSPQWILEGDIKGFFDNINHDWLCRNVPMDRVVLRKW
                     LRAGVIDRRQFTATQAGTPQGGIISPCLANATLNGLEAQLKRHLAEKLGVKKAEKTKV
                     QVVRYADDFVITAASKELLESEVKPWVEQFLSVRGVELSQAKTQITHIHEGFDFLGWC
                     FRKYVPKSPYGKAKLLIKPSKKNASAFYRKVAEIIKSSGAMTQEALIGQLNPVLKGWA
                     QYHSAVVAKQTFSRLDHLIHWRVWRWAKRRHPNKSVDWIRNKYFHSIDGRSWVFAQPY
                     KGGKGEQRFRQLYTLAKTAIVRHKRLPGEYHPYDAEHELKWEALRVQRMQHKLRYRGQ
                     VVRLFARQKGKCALCGYPVSKETGWHDHHVIRRVDGGPDTLDNRVLLHPNCHALIHSQ
                     RKQVNLLHSGL"
     CDS             complement(261373..261489)
                     /codon_start=1
                     /locus_tag="KF707C_2400"
                     /product="hypothetical protein"
                     /protein_id="BAU71928.1"
                     /transl_table=11
                     /translation="MPGPLRRPGKSGSPVPLSGPGPPKNRACGFHRTRLKPT"
     CDS             261529..262899
                     /codon_start=1
                     /locus_tag="KF707C_2410"
                     /note="TC 3.A.5.1.1"
                     /product="signal recognition particle receptor protein
                     FtsY"
                     /protein_id="BAU71929.1"
                     /transl_table=11
                     /translation="MFGSNDDKKAPAQAGEKKSLFGWLRKKPQEAAPAPAEPVAPAQA
                     ESPVDSVPSPVSAEAPASPAADPAPAAPETPAPAPLVIEAPAPVTEIPAASVVEIPAA
                     PQPAAPAPAPAPAPAPEAAAAPSALEPAQATPVPSASVASAEPAKAGFFARLKQGLSK
                     TSASIGEGMASLFLGRKAIDDDLLDEIETRLLTADVGVEATSAIVQSLTQKVARKQLA
                     DADALFRALQEELAALLRPVEQPLNIDGARAPYVILVVGVNGVGKTTTIGKLAKKLQQ
                     DGKKVMLAAGDTFRAAAVEQLQVWGERNNIAVIAQHTGADSASVIFDAVQAAKARGVD
                     VLIADTAGRLHTKDNLMEELKKVRRVIGKLDETAPHEVLLVLDAGTGQNAINQAKQFH
                     QAVNLSGLALTKLDGTAKGGVIFALAKQFALPIRYIGVGEGIDDLRTFEADAFVKALF
                     AERESA"
     CDS             262896..263564
                     /codon_start=1
                     /locus_tag="KF707C_2420"
                     /note="TC 3.A.5.1.1, ATP-binding protein FtsE"
                     /product="cell division transporter"
                     /protein_id="BAU71930.1"
                     /transl_table=11
                     /translation="MIRFEQVGKRYPNGHVGLHELSFRVRRGEFLFVTGHSGAGKSTL
                     LRLLLAMERPTTGKLLLAGQDLSTITNSQIPFLRRQIGVVFQNHQLLFDRTVFDNVAL
                     PLQIHGLSKPEIAKRVGIALERVSLADKAELYPADLSTGQQQRVGIARAVVHRPALLL
                     ADEPTGNLDPRLAAEIMGVFEDINRLGTTVLIASHDLALIARMRHRLLTLQRGRLIGD
                     GEAV"
     CDS             263561..264580
                     /codon_start=1
                     /locus_tag="KF707C_2430"
                     /product="cell division protein FtsX"
                     /protein_id="BAU71931.1"
                     /transl_table=11
                     /translation="MSAKQIPPPKPAERVGATPRNVESPDRQDDGPDFRTLLLAWLES
                     HRASLMDSLRRLGRQPIGSFFTCLVMAIALSLPMGLSLLLSNVERLGGSWQRAAQISL
                     FMKIDASESQGQKLRDEIAAMPDVAEAEWISREQALAELQQQSGLGEALKELPENPLP
                     GVVLVTPREVDKAGLEALRQRLAEMPGIEQAQLDLVWVERLSAILKLGERFVFGLAVL
                     LILALLLVIGNTIRLHIENRRTEIEVIKLVGGTDGYVRRPFLYMGAIYGTGAGLLAWL
                     VLAYGLNWLNDAVVRLAGLYGSDFALAGVPLGDGLSLLVGAVLLGYIGAWLAVARHLS
                     ELAPR"
     CDS             264695..265549
                     /codon_start=1
                     /gene="rpoH"
                     /locus_tag="KF707C_2440"
                     /product="RNA polymerase sigma factor RpoH"
                     /protein_id="BAU71932.1"
                     /transl_table=11
                     /translation="MTTSLQPVYALAPGANLEAYVHAVNGIPLLTVEQERELAERLFY
                     QQDLEAARQMVLAHLRFVVHIAKSYSGYGLAQADLIQEGNVGLMKAVKRFNPEMGVRL
                     VSFAVHWIKAEIHEFILRNWRIVKVATTKAQRKLFFNLRSQKKRLTWLNNDEVHAVAD
                     TLGVEPHEVREMESRLTGQDMAFDPAADADDDAAFQAPAHYLEDHRYDPARQLEEADW
                     SDSSTANLHEALEGLDERSRDILYQRWLAEEKATLHDLAAKYNVSAERIRQLEKNAMN
                     KLKGCIQA"
     CDS             265608..266210
                     /codon_start=1
                     /locus_tag="KF707C_2450"
                     /product="hypothetical protein"
                     /protein_id="BAU71933.1"
                     /transl_table=11
                     /translation="MPLPLLRSSHLTLFAVIAALFFALALWMSRQGADAEPMPWLTTW
                     GTDVIEPLADDQLSLTQLAGQAPGELWLQPRAGGPRLVYRAQLDREEGAWRLEAQLGL
                     TASEHESLARALGKSTDEQPLSGAMLDQLGGHRVAVLNLVPMAVIPAARIAASLGAPR
                     LRLRTGEGEAWIYPRQGLSVHLLDDQVQLLHLVPREAMKH"
     CDS             complement(266229..266921)
                     /codon_start=1
                     /EC_number="2.4.2.-"
                     /locus_tag="KF707C_2460"
                     /product="monofunctional biosynthetic peptidoglycan
                     transglycosylase"
                     /protein_id="BAU71934.1"
                     /transl_table=11
                     /translation="MFSTIRRRLFKLLLWFAAASVLLVILFRWIPPPGTMLMVERKVA
                     SWIDGKPIDLRRDWVAWDDLPDNLKIAVIAAEDQKFAEHWGFDVPAIRAALAHNERGG
                     SVRGASTLSQQVAKNLFLWSGRNWLRKGLEVWFTGLMELFWPKQRILEVYLNSAEWGN
                     GVFGADAAARHHFGVPAARLSRQQAALLAAVLPNPRQWSASRPSGYVARRASWIRRQM
                     AQLGGASYLERL"
     CDS             266988..267362
                     /codon_start=1
                     /gene="thiS"
                     /locus_tag="KF707C_2470"
                     /product="hypothetical protein COG2363"
                     /protein_id="BAU71935.1"
                     /transl_table=11
                     /translation="MARLFLLLSAFAGFTGVALGAFAAHGLKSRLSPEHLAVFQTGTH
                     YQLIHALALFGVALLSLHLPGRLVNLAGGFFAFGILLFSGSLYLLTLSGIGKLGIITP
                     FGGLAFLAGWLCLGLAAWRSLT"
     CDS             267465..267665
                     /codon_start=1
                     /gene="thiG"
                     /locus_tag="KF707C_2480"
                     /product="sulfur carrier protein ThiS"
                     /protein_id="BAU71936.1"
                     /transl_table=11
                     /translation="MRILLNGESFELPDGQTVADLLNRLDMAGRRVAVELNLDIVPRS
                     QHGETVLREGDRIEVVHAIGGG"
     CDS             267748..268542
                     /codon_start=1
                     /locus_tag="KF707C_2490"
                     /product="thiazole biosynthesis protein ThiG"
                     /protein_id="BAU71937.1"
                     /transl_table=11
                     /translation="MSQTPIDKPFTLAGRTYQSRLLVGTGRYKDLEETRVAIEASGAE
                     IVTVAVRRTNLGQNPGEPNLLDVISPEKYTILPNTAGCYDAEEAVRTCRLARELLDGH
                     NLVKLEVLADQKTLFPNVVETLKAAEVLVKDGFDVMVYTSDDPIIARQLAEIGCIAVM
                     PLAGLIGSGMGICNPWNLRIILEEAKVPVLVDAGVGTASDATIAMELGCEAVLMNTAI
                     AHAQHPVLMAEAMKHAIVAGRLAYLAGRMPRKLYASASSPLDGMIR"
     CDS             268589..269341
                     /codon_start=1
                     /EC_number="2.1.1.33"
                     /locus_tag="KF707C_2500"
                     /product="tRNA (guanine46-N7-)-methyltransferase"
                     /protein_id="BAU71938.1"
                     /transl_table=11
                     /translation="MLQVSLTGFPTMIEEQGLPAAADETRHHRTIKSFVMRAGRMTEG
                     QQRGLDQGWPKYGLELADGLRDFDALFGRSAPRTFEIGFGMGHATLEMAANAPDQDFI
                     GVEVHRPGVGALLNGALSQGLTNIRVYSCDALEVLRDCVADASLDRVLLFFPDPWHKS
                     RHHKRRIVQPAFAELVRQKLKVGGVLHMATDWEHYAEHMLEVMNAAPGYRNLAEDGRF
                     VPRPDERPVTKFERRGERLGHGVWDLKFQRID"
     CDS             269493..270839
                     /codon_start=1
                     /locus_tag="KF707C_2510"
                     /note="FIG002188"
                     /product="hypothetical protein"
                     /protein_id="BAU71939.1"
                     /transl_table=11
                     /translation="MLLKTFGYLLLAGCVLQAHAQVDATQAARLGQDLTPLGGERAAS
                     ADGVIPAWDGGLATPPAGYQRGMHHPDPYAGESPRLVIDGRNASEYDALLTPGHKALL
                     AQHPDYRLRVFPTHRSAAAPQRIYDATRFNAENGRLIAGGNGVEGVAAGIPFPIPANG
                     LEAIWNHILRYRGEQVHFTTNQAAVLANGSYNLLKLERDIYFVYGREGMTPANLENTL
                     FFYKYRVVAPAKLSGSALVVQETLDQVLSIRKAWRFNRGERRVRRLPMLAYDTLQPDT
                     NGMATADVVDAYNGAPDRYEWQLLGKREMLVPYNSYALHQKGIPYERILKTGYVNPDL
                     LRYEQHRVWVVEASLRKGFTHPYAKRRFYLDEDSWQILAVDLYDRDGQLIGLQESHPI
                     SYYDVPMFGGTLESLYDFVGNRYFVDGLDNNEPMYDFNAPLSPRDFTPQALRREGN"
     CDS             complement(270941..271195)
                     /codon_start=1
                     /locus_tag="KF707C_2520"
                     /note="FIG00954500"
                     /product="hypothetical protein"
                     /protein_id="BAU71940.1"
                     /transl_table=11
                     /translation="MKPIKHLYLHFQDGQRLALRFPQQSADPIDVARGLRRQLESPFL
                     SIEVDGDLLLIPRESIKYLQISPAPPALPQATITGAELIN"
     CDS             complement(271248..271571)
                     /codon_start=1
                     /locus_tag="KF707C_2530"
                     /note="glucose/maltose/N-acetylglucosamine-specific"
                     /product="phosphotransferase system IIC components"
                     /protein_id="BAU71941.1"
                     /transl_table=11
                     /translation="MDVVLDLIATLSRWSRGHLNDIALAIMATLLVLFGPSINAWVQQ
                     RIGSLNFLFRTLLFVLLCAVGYGLAMIYLTPWLVKGLGYFNNYTLAPVLLLVFFVIGV
                     IADRN"
     CDS             complement(271629..272834)
                     /codon_start=1
                     /locus_tag="KF707C_2540"
                     /note="similar to coproporphyrinogen III oxidase,
                     oxygen-independent, clustered with
                     nucleoside-triphosphatase RdgB"
                     /product="radical SAM family enzyme"
                     /protein_id="BAU71942.1"
                     /transl_table=11
                     /translation="MSAAKGSGQRDGMPSSPGPVSPVFQLPPLALYVHIPWCVRKCPY
                     CDFNSHAAGSELPEEAYIDALLADLEQDLHHVHGRELTSIFFGGGTPSLFSANALGRL
                     LDGVEQRVPFARDIEITLEANPGTFEQAKFAAYRQLGINRLSIGVQSFQEAKLKALGR
                     IHDGGEAIRAADMARKAGFDNFNLDLMHGLPDQSLDDALSDLRTAIAQGPTHLSWYQL
                     TMEPNTVFWSQPPTLPEDDVLWDIQEAGQALLAEHGYAQYEVSAYAREGRRARHNLNY
                     WTFGDFLGIGAGAHAKLSSPDGRIMRSWKTRLPKDYLDPAKHYLAGERVLEADELPFE
                     FLMNVLRLTDGAPVELFTQRTGLPLDVLAAGRAEAEARGLLSTDRERLTATAQGQLFL
                     NDLLQQFLP"
     CDS             complement(272831..273427)
                     /codon_start=1
                     /EC_number="3.6.1.15"
                     /locus_tag="KF707C_2550"
                     /note="dHAPTP, dITP, XTP-specific"
                     /product="nucleoside 5-triphosphatase RdgB"
                     /protein_id="BAU71943.1"
                     /transl_table=11
                     /translation="MMPFNELVLASHNAGKLKELQAMLGDSVKVRSIAEFTDVEPEET
                     GLSFVENAILKARNAARVSGLPALADDSGLAVDFLGGAPGIYSARYANGQGDAANNAK
                     LLEVLADVPEAERGAQFICSLALMRHADDPLPILCEGSWRGSILFEPRGDQGFGYDPL
                     FWVPECSCSAAELAPVDKNRLSHRARAMALLKQRLGLQ"
     CDS             complement(273424..273843)
                     /codon_start=1
                     /locus_tag="KF707C_2560"
                     /note="FIG003551"
                     /product="hypothetical protein"
                     /protein_id="BAU71944.1"
                     /transl_table=11
                     /translation="MRRLALFLVALCLALPAAAERKQTFGDVEVHYNAFNSSFLQPDI
                     AAAVGLTRSKTQGVVNVAVLKAGKASTAQVSGQVKNLLGRVTPLQFKQVTEGEAIYYL
                     AQFPTGEREMLNFTLTVQLGDEASHSFSFDQEFFPDE"
     CDS             complement(273861..274481)
                     /codon_start=1
                     /locus_tag="KF707C_2570"
                     /product="methionine biosynthesis protein MetW"
                     /protein_id="BAU71945.1"
                     /transl_table=11
                     /translation="MRADLEIIQDWIPAGSRVLDLGCGRGELLAYLRDTKQVSGYGLE
                     IDPENIAHCIDRGVNVIEQDLDKGLGNFASNSFDVVVMTQALQAVHYPDRILREMLRV
                     GRQCIITFPNFGHWRCRWYLARNGRMPVSEFLPYTWYNTPNIHFCTFKDFEELCREMH
                     VKVLDRLAVDHEHRHNLPSRLWPNLMGEIGIYRVSGPGLTDHRVAV"
     CDS             complement(274485..275624)
                     /codon_start=1
                     /EC_number="2.3.1.31"
                     /locus_tag="KF707C_2580"
                     /product="homoserine O-acetyltransferase"
                     /protein_id="BAU71946.1"
                     /transl_table=11
                     /translation="MPTAIPADSVGLVTPRVQRFTEPLALACGRSLADYELVYETYGE
                     LNANRSNAVLICHALSGHHHAAGYHSMEDRKPGWWDSCIGPGKAIDTNRFFVVSLNNL
                     GGCNGSTGPSSLNPATGAPFGADFPVMTVEDWVNSQARLADALGIAQWAAVVGGSLGG
                     MQALQWTISYPERVRHCLAIASAPKLSAQNIAFNEVARQAILTDPEFHGGHFQEQGVI
                     PKRGLMLARMVGHITYLSDDAMGEKFGRGLKSEKLNYDFHSVEFQVESYLRYQGEEFS
                     GRFDANTYLLMTKALDYFDPAAAHDGDLARTLAGAKADFCVMSFTTDWRFSPARSREI
                     VDALMAARKNVSYLEIDAPQGHDAFLMPIPRYLQAFSSYMNRIAV"
     CDS             complement(275735..277723)
                     /codon_start=1
                     /locus_tag="KF707C_2590"
                     /note="FIG00954467"
                     /product="hypothetical protein"
                     /protein_id="BAU71947.1"
                     /transl_table=11
                     /translation="MSMERLGQQVDAYVGWKRELLREITRYRSWLERNRLISDTLSTR
                     LERAQRLLRTDHITLAFVGEFSRGKTELINCLFFSEYGQRILPSQAGRTTMCPTELFH
                     DPRSERSYIRLLPIESRMAEASVAQFKRAPRHWVNIPLDPSDPDNMVQAFAQVARTKP
                     MPVEQAIQLGFHPDMLEATGRPGEVLVPAWRHAMVNFDHPLLRKGLRILDTPGLNALG
                     SEPELTLSMLPSAQAIVFLLSADTGVTASDMDIWQQHIRQLDEDTQAHLFAVLNKIDV
                     LWDDLAGEGFVQNAIRRVQETTARQLGISSEDVLPLSAKQALLAKVRNDSELLARSRV
                     GALEGLLCDRIISQKERLMEENVSNQLMALLQNSLHVLNLRLEKVREQQAMLDTHQQD
                     NGQMLFELTARTKEDHARHHRRLLGLKTNQRLLKRQGEALRSAARAERLDEHLERLRR
                     ELTGSWTTLGINQGILKFFHAVEMDLRSLEHEADLANKMVAAIYQRHNEENPLQGVEA
                     PQFNVQRYLRELAQLREKADQFRLHPITLLTEQNQLGKRFFDTLVLELVGMHQRLRLE
                     VSQWASEALTPLMQHTLEHKQLLETHMLRLKALAQETQLTRQRGQQLERYTEELEQQI
                     AEANDMLRTFRRPSPMQRMAKVVNLPLAAHRRRGSESA"
     CDS             complement(277939..278235)
                     /codon_start=1
                     /locus_tag="KF707C_2600"
                     /product="UPF0235 protein VC0458"
                     /protein_id="BAU71948.1"
                     /transl_table=11
                     /translation="MTWYRWAGEDLILDCHLQPKASRDEFAGLHGERLKIRLTAPPVD
                     GKANAHLMAFLAEAFGVAKSQVSLESGELNRQKRIRIQKPRTLPDLPGLTARPS"
     CDS             complement(278232..278825)
                     /codon_start=1
                     /locus_tag="KF707C_2610"
                     /note="involved in response to extracytoplasmic stress
                     (osmotic shock)"
                     /product="integral membrane protein YggT"
                     /protein_id="BAU71949.1"
                     /transl_table=11
                     /translation="MTGLNTAAIYVIQTLGSLYLLIVLLRFILQLVRADFYNPLSQFV
                     VRATKPLLNPLRKIIPGFGGLDLASLVLAILVQLLLMIVTLTLMGYGVGGYLLQLLIW
                     SIIGVTSLFLKVFFFALIISVILSWVAPGSHNPGAQLVNQLCEPLLMPFRKLLPNLGG
                     LDISPIFAFIALKLLDMLVIGNLAAMTGMPQILSPFL"
     CDS             complement(278840..279658)
                     /codon_start=1
                     /EC_number="1.5.1.2"
                     /locus_tag="KF707C_2620"
                     /product="pyrroline-5-carboxylate reductase"
                     /protein_id="BAU71950.1"
                     /transl_table=11
                     /translation="MSTPRIAFIGAGNMAASLIGGLRAKGVDAERIVASDPGAEQRAK
                     VSAEHGIQVLGDNAEAVKDADIVVLSIKPQVMKAVCQALAPSLQPGQLVVSIAAGITC
                     ASLAAWLGPRPIVRCMPNTPALVGQGASGLFANAEVSATQRQQAGELLAAVGIALWLD
                     DEKLIDAVTAVSGSGPAYFFLLMEAMTAAGEKLGLPRETAEQLTLQTALGAARMAVSS
                     DVDAAELRRRVTSPNGTTEAAIKTFQAGGFEALVQQALNAADRRSAELAEQLGQ"
     CDS             complement(279673..280365)
                     /codon_start=1
                     /locus_tag="KF707C_2630"
                     /note="proline synthase co-transcribed bacterial homolog
                     PROSC"
                     /product="hypothetical protein YggS"
                     /protein_id="BAU71951.1"
                     /transl_table=11
                     /translation="MSTIADNIAKVRARIREAAQASGREHSSVGLLAVSKTKPAAAIR
                     EAFACGVTDFGENYLQEALAKQAELGDLDLTWHFIGPIQSNKTKAIAEHFHWVHSVDR
                     LKIAERLSAQRPPALPPLNVCLQVNVSGETSKSGCAPEELPALAAAVAELPNLRLRGL
                     MAIPEPTEDVAAQHAAFARLRQLQAALNPSLDTLSMGMSHDLEAAISEGATWVRIGTA
                     LFGARDYGQPAN"
     CDS             280531..281565
                     /codon_start=1
                     /locus_tag="KF707C_2640"
                     /product="twitching motility protein PilT"
                     /protein_id="BAU71952.1"
                     /transl_table=11
                     /translation="MDITELLAFSAKQGASDLHLSAGLPPMIRVDGDVRRINLPPLDH
                     KQVHALIYDIMNDKQRKDYEEFLETDFSFEVPGVARFRVNAFNQNRGAGAVFRTIPSK
                     VLTMEDLGMGEIFKKVSDVPRGLVLVTGPTGSGKSTTLAAMLDYLNSTKYHHILTVED
                     PIEFVHESKKCLINQREVHRDTLGFNEALRSALREDPDIILVGEMRDLETIRLALTAA
                     ETGHLVFGTLHTTSAAKTIDRVVDVFPAEEKSMVRSMLSESLQAVISQTLLKKIGGGR
                     VAAHEIMIGTPAIRNLIREDKVAQMYSAIQTGGSLGMQTLDMCLKSLVAKGLVSRESA
                     REKAKSPENF"
     CDS             281605..282750
                     /codon_start=1
                     /locus_tag="KF707C_2650"
                     /product="twitching motility protein PilT"
                     /protein_id="BAU71953.1"
                     /transl_table=11
                     /translation="MEFEKLLRLMVEKGASDLFVTAGVPPSMKVNGKIMPVSKNAMSP
                     EMTRETVLGVMNEQQRRDFAQHHECNFAISARGIGRFRVSAFYQRNLVGMVLRRIETS
                     IPTIDELKLPEVLKKLALTKRGLVLFVGATGTGKSTSLAAMIGHRNKNSSGHIISIED
                     PIEFIHQHQNCIVTQREVGLDTESFEVALKNTLRQAPDVILIGEVRTRETMDHAIAFA
                     ETGHLCLATLHANNANQALDRIINFFPADRQQQVWMDLSLNLKAIVAQQLVPTPDGKG
                     RRAVIEVLINTPLAADLIRKGEVHELKPLMKRSTEQGMQTFDQALYNLYAQGEITYED
                     ALLHADSANDLRLMIKLDSETDGEHLQHMSEGLSLQVSEEDPGRRFR"
     CDS             282855..283250
                     /codon_start=1
                     /locus_tag="KF707C_2660"
                     /note="FIG00955003"
                     /product="hypothetical protein"
                     /protein_id="BAU71954.1"
                     /transl_table=11
                     /translation="MNTRLDTHSKVIGYLLWIFGFLGSHRFYYGKPVTGTIWFFTLGL
                     FFIGWIIDLFLIPSMDREASLRFNAGQYDYNVAWILLTFLGIFGVHRMYQGKWISGIL
                     YLLTGGFFLLGVLYDFWTLNSQISVLNAR"
     CDS             complement(283358..283681)
                     /codon_start=1
                     /locus_tag="KF707C_2670"
                     /product="hypothetical protein"
                     /protein_id="BAU71955.1"
                     /transl_table=11
                     /translation="MKRLPLLLALFTIGAQAATFEKDKKAFFARQEQLDKRCEAARQV
                     LLDREKGNIFNECINAKRGTATVETCKRRAERFDANRIGGSPRHHELPECIEAFNHRR
                     NKPST"
     CDS             complement(285210..285338)
                     /codon_start=1
                     /locus_tag="KF707C_2680"
                     /product="hypothetical protein"
                     /protein_id="BAU71956.1"
                     /transl_table=11
                     /translation="MVFKEDATLGINYNVPAGTTCANLPTYANAPVPVYLRLVSPK"
     CDS             complement(286734..286934)
                     /codon_start=1
                     /locus_tag="KF707C_2690"
                     /product="hypothetical protein"
                     /protein_id="BAU71957.1"
                     /transl_table=11
                     /translation="MLCNLKGNPSIDSVTCSHWSSLATMAFKEGSQIGVYYNVPAGTT
                     CANLPTYANAPVPVYLRLVSPK"
     CDS             complement(287195..291127)
                     /codon_start=1
                     /locus_tag="KF707C_2700"
                     /product="hypothetical protein"
                     /protein_id="BAU71958.1"
                     /transl_table=11
                     /translation="MNKHLPRYLAALWLASTALSLPAIAAEESFNEAAVGAYQEPGHA
                     NNRDFSGNQQVDSIDPFTGALKILVRDLLIPGNGGLDIEVLRNYQSVTNDAGPYSNGY
                     RERTPFGTGWDLHFGRLWVSRTYGYLNQSDNNQGCQINNQIASNLNPILELPDGTRQI
                     LANGNGRDHAFITKERWIGRCLPRSLNKGDGGLIVISPDGRKYLFDKKGTVSPDQQLR
                     SYFVTRIEDPDGNFLTFAYNIGTHNLFGRHHLLKSIQASDGRSVNFTYRDETGMRPVL
                     ESIVANGATIRFSYVDANWSVGARPHYLESVSYPDGTGWSYSYNDASTLTGAQPGRFS
                     MASMTSPTGLRTRYTYEYRQMGPNPAEKLNVINRRTLSGIQGAAPAEQVWEYQYSKGR
                     VPNNDQTLVKGPTQCIGYEHVGTDTLANGASGVNRGLWKVGALVRKFTAARAGTGCGP
                     ALRTETYAWSSQDISSQHEVRRYNLLVEDRTRAALLASRVIAQDGASYTTQYSYDAYG
                     QPLTVTEKGQMQRTTTYTYIRPGGLWMLGKVASQAVSGIPGSITYGYTNTGRLAQQTR
                     YGVTTRFGYTPAGDLASETDANGRVTRHIGHLRGVPLQTTLPNGGVIRRTVNPTGTLA
                     SITEPLGRVTRYSYDTMNRLVAVQMPKGGAGNIAISYSFGAGGVTETLKRANYVRVRH
                     YNGLGQMISQKESGGSAPIVTTATYRADGRKASQSLPGYHQASASIQSFQYDGLGRRT
                     QVRHPDGTFHTTSYGPGNTETQRDERANVTTLTHLAFGEPSERLLAKMAQPGGITTAI
                     GRDSLGRITSLEQGGLARRYTYDARGFLASESNPETQTTVYGYDAVGNRTSRKVGAAA
                     ADTFSYDSMDRLIKVTHPGNQIFTFSYDLAGRLLSQTSYQGNTWNYTYDAHDLLASET
                     LVLKNPSRTLGFRYAHNVLDHLQTITYPSGLKVDYAPDAYGRATRAGAFASAISYHPS
                     GQLSALTYGNGRKLSQTLDSRRLRVTERHVGGPDLPLRLRYAYDAGSNLTQITDLQNS
                     AYTQTLGYDALNRLASARGIWGTASFAYNTRGDLARQTLGGGTINYNYDAQGRLAGLS
                     GSLSARFGYDVRGNVLRARGEYGYDHAGHMTWLCLSPRVDCTSTPDERYTYDAAGRRV
                     TTSISQGALRVSVYGRNGQLLRDDDTSGGVREYIHVAGELVAHREQCPDLDSDFDGMP
                     DCYERRLGLDPQDARDGRMDSDGDGLSNADEYRLGTKLRNADSDNDGMPDGWEYQHKL
                     NPLDLTDAHLDANGDGISNLKGYQQGISPSRPDWPAQVPLMHRIPAGG"
     CDS             complement(291185..291370)
                     /codon_start=1
                     /locus_tag="KF707C_2710"
                     /product="hypothetical protein"
                     /protein_id="BAU71959.1"
                     /transl_table=11
                     /translation="MRDQAGGETPHALEHRTGDGGPPWVPTKGWWARPLHFRQTINEL
                     SDKTTSLSRQGRPALYP"
     CDS             291383..292753
                     /codon_start=1
                     /EC_number="4.2.1.22"
                     /locus_tag="KF707C_2720"
                     /product="cystathionine beta-synthase"
                     /protein_id="BAU71960.1"
                     /transl_table=11
                     /translation="MNSARPAVLDLIGNTPLVQVSRFDTGPCTLLLKLESQNPGGSIK
                     DRIGVAMISAAERDGRLKPGGTIVEATAGNTGLGLALVGRAKGYRVVLVVPDKMSTEK
                     VLHLKAMGAEVHITRSDVGKGHPEYYQDLAGRMAAEIPGAFFADQFNNPANPLAHEST
                     TGPEIWQQTGQDVDAIVVGVGSAGTLTGLTRYFRRVQPELEMVLADPVGSVMAEYVRS
                     GTLGPVGSWAVEGIGEDFIPGIADLSSVRHAYSISDEESFAHARELLRAEGIPGGSST
                     GTLLAAALRYCREQKSPKRVVSFVCDTGTRYLSKVYNDQWMTDQGLLARKRYGDLRDI
                     IARRFEDGRVISVGADDTLLTAFQRMRLADVSQLPVLRGGRLVGVIDESDILLGVHAD
                     ATHFREPVASVMTTRLETLAPDASLAELQAELDRGLVAIIADDSAFHGLITRFDLLNH
                     LRRTLA"
     CDS             292750..293934
                     /codon_start=1
                     /EC_number="4.4.1.1"
                     /locus_tag="KF707C_2730"
                     /product="cystathionine gamma-lyase"
                     /protein_id="BAU71961.1"
                     /transl_table=11
                     /translation="MSPQVDRRQLAFATRVIHAGQAPDPSTGAIMPPIYANSTYAQES
                     PGVHKGLDYGRSHNPTRWALERCVADLEGGSQAFAFASGLAAIGTVLELLDAGSHIVA
                     SNDLYGGTFRLFERVRRASAGHRFSFVDFSDIAQIGAAIGDDTRMLWVETPSNPLLRL
                     ADLAAIVALCRGRGIILVADNTFASPWVQRPLDLGFDLVVHSTTKYLNGHSDVIGGIA
                     VVSSDNRCEPLRERLGFLQNAVGSIAGPFDAFLTLRGVKTLALRMERHCDNALELAGW
                     LERQPQVARVHYPGLASHPQHPLARRQMHGFGGMISLDLATDLAGARRFLEAVRLFTL
                     AESLGGVESLIEHPAIMTHASIPAEIRAQLGIGDSLIRLSVGVEDVEDLRADLAQALG
                     RL"
     CDS             complement(294084..296465)
                     /codon_start=1
                     /EC_number="3.5.1.11"
                     /locus_tag="KF707C_2740"
                     /product="penicillin acylase II"
                     /protein_id="BAU71962.1"
                     /transl_table=11
                     /translation="MKRTLTALAVMIAAAAAGATWYSESGRPVRDGELALAHLQAPVT
                     VRYDERGVPHIQAGNEADLYRALGFVHAQDRLFQMEMLRRLARGELAEVLGARLVDTD
                     RLFRTLGIRAHADEYARRMDRNSPAYQALVAYLDGINQYQDSRPAPVEFDLLGIDKRP
                     FTVEDTLSVAGYMAYSFAAAFRTEPVMTYVRDELGTDYLKAFDLDWHPEGVVGQPLAS
                     ADWQDLNHLARLSQQALVEAGLPQYEGSNAWAVSGSRTASGKPLLAGDPHIRFAVPAV
                     WYEAQLSYPGFELYGHHQALNPVASLGHNRQFAWSLTMFQNDDLDLIAEKTNPDNPQQ
                     VWYQGRWVDLESREESIQVKDGESVSLTLRRSPHGPIINDALGAAAGKTPIAMWWAFL
                     ETENPILDAFYELNRADSLDKARTAASKIHAPGLNLVWANADGDIGWWAAAKLPQRPD
                     GVNPVFILDGSSGESDKPGYLPFSANPQEENPERGYIVSANYQPLSPTGVAIPGYYNL
                     PDRGQRLDQRLAEPGIKWDLQNSQALQLDTATGYGPRLLAPLLADLRAAAADDGEKAL
                     VEQLANWQGDHPLDSQAATLFNQFVYELARTAMRDELGDNFFGSLLQTRVLDTALPRL
                     AADADSPWWDNRGTPHKESRADGVKAAWQASLAHLKKTLGDDPAAWNWGKAHTLTHSH
                     PLGQQKPLDLLFNVGPFPAPGGHEVPNNLSHRVGPAPWDVFYGPSTRRLVDLADAEHA
                     LGINPLGQSGVPFDRHYKDQAEAYIRGEYLPMHFSEEDVKANSQGTLKLVPAG"
     CDS             296578..297618
                     /codon_start=1
                     /locus_tag="KF707C_2750"
                     /note="AraC family"
                     /product="transcriptional regulator"
                     /protein_id="BAU71963.1"
                     /transl_table=11
                     /translation="MPASSPDRLDALPLTHSATLRRLLYEALSDLGLDPGQVYLGINQ
                     HRRLRPPPADGRLHHDDAPQFWLAADALCGDPDIGLHLGEAMKPRLLDVVGYLLLASR
                     DLEEALVSFLRFQHILSGGFVAQMRVEGDHARLVIDLNYLGYSSLRQQMECLALLFTK
                     LLGSITDGEFRLLGVEFRHPRPARVSEHQRLFGLMPAFGCEHDVLVFPAALLKRPSRT
                     ANPDLHRLLWGHAETQLAALAGNDLLNRLRYLLEVRLGRASCTLEACAAELGMSAGAL
                     QRALAEQGANLRRLRESVQRGRAMELLREGRTLREVARGCGFSELSPFYRAFRRWYGA
                     TPDHWRARLGPA"
     CDS             complement(297615..298190)
                     /codon_start=1
                     /locus_tag="KF707C_2760"
                     /product="thiol-disulfide isomerase and thioredoxins"
                     /protein_id="BAU71964.1"
                     /transl_table=11
                     /translation="MPIAHSRPLKIGLIALACVIALVLAYRWYESRFIRPFNPQPTVF
                     TGEHLQLPRELAGKGPIRLVHFWDPACPCNAGNQQHLAELIQRFAPQGVAFYALQKPG
                     SRGQLPPGLEALEPLTEVPGSEQLPAVPAVGIWDRDGNLAYFGPYSEGAVCTSDNSFI
                     EPVLDALIDNRPVSVGGTLAAGCFCGWRSPL"
     CDS             298310..299251
                     /codon_start=1
                     /EC_number="3.1.1.5"
                     /locus_tag="KF707C_2770"
                     /product="lysophospholipase"
                     /protein_id="BAU71965.1"
                     /transl_table=11
                     /translation="MSDSIQPDLLRPLLRPLAVGAADLRQAQGYRAFYRLDFSDRHPG
                     VEARLGCMEAAGYSLVTQLWLPPTPRATLVVLHGYYDHMGLYGHLVEWALGLGLAVIA
                     CDLPGHGLSSGTRASIGDFAEYQAALGALLAEAESLGLPQPWHLAGQSTGGAILLDYL
                     LTGEARPELGETLLFAPLVRPRAWGWSKFSYRLLRPFVEGIPRRFSVNSGDAEFIDFV
                     HRRDPLQPQTLPTAWVGALSRWIPRIERAAPSRRRPLVIQGDADMTVDWRHNLQVLEA
                     KFDRPEVLMLEGAGHHLVNEVPAYRQRYFDFLGERLG"
     CDS             complement(299286..300038)
                     /codon_start=1
                     /locus_tag="KF707C_2780"
                     /product="hypothetical protein, FIG00953078"
                     /protein_id="BAU71966.1"
                     /transl_table=11
                     /translation="MRLLFAITLLLVGLPALADDHATLYQAAGWPEQRAHFNDALSAA
                     QQRYQQTLPPAVYQALVENSNRRFQPQAIDQRAQDALRNQLADPRPALAFFQSPLGRK
                     IIAAETLATRRDQLAKHANGLPRIEADATRRLLIRHLAQALPAREAGAEVSLALAGVA
                     ADSLSQMLPGLLGGAQAQGMIDGQRQRLMDQIGNDLDNTLLYVYRDLSDPELEEYVTF
                     AQSAEGKAYYQAALAAVRAGLAVGRDAASLAQ"
     CDS             300267..300860
                     /codon_start=1
                     /locus_tag="KF707C_2790"
                     /note="2OG-Fe(II) oxygenase family"
                     /product="oxidoreductase"
                     /protein_id="BAU71967.1"
                     /transl_table=11
                     /translation="MLAPIINELVTQSWSCQPLALPRELTAALATECRARHRAGELAP
                     ASVGRGEGQQVLEGVRGDCIHWLEPGQSAASDTYLAWMDDLRQRLNQELFLGLEDFEC
                     HFAFYPPGACYQRHLDRFRDDDRRAVSVVAYLNEDWRAEQGGALRLYLDEGERDVLPE
                     EGTLVVFLSGEVPHEVLPATRDRLSLAGWFRRRGGVL"
     CDS             300954..301451
                     /codon_start=1
                     /EC_number="2.4.2.1"
                     /locus_tag="KF707C_2800"
                     /product="purine nucleoside phosphorylase"
                     /protein_id="BAU71968.1"
                     /transl_table=11
                     /translation="MQKILVSRCLLGQRVRYDGGAHGPFDLLERWQAEGRVVPLCPEV
                     AGGLPTPRAPAEIPGGRGAGVLDGELPVMTVDGEDVTAEFLAGARIALDLVATHGIRI
                     ALLKARSPSCGNRENYDGSFSGTRVAGEGVTAAALRRAGVEVFSEEEFAAAAARLAEL
                     ERDRT"
     CDS             complement(301654..302883)
                     /codon_start=1
                     /EC_number="1.1.1.95"
                     /locus_tag="KF707C_2810"
                     /product="D-3-phosphoglycerate dehydrogenase"
                     /protein_id="BAU71969.1"
                     /transl_table=11
                     /translation="MSKTSLEKSKIKFLLLEGVHQNAVDTLKAAGYTNIEYLKGALSG
                     EELKEKIADVHFIGIRSRTQLTEEVFDCAKKLIAVGCFCIGTNQVNLSAARERGIAVF
                     NAPYSNTRSVAELVLAEAILLLRGIPEKNASCHRGGWIKSAANSFEIRGKKLGIIGYG
                     SIGTQLSVLAEALGMQVYFYDTVTKLPLGNATQVGNLYELLGLADIVSLHVPELPSTQ
                     WMIGEKEIRAMKPGGILINAARGTVVKLDALAEAIKDEHLIGAAIDVFPVEPKSNDEE
                     FESPLRGLDRVILTPHIGGSTAEAQANIGLEVAEKLVKYSDNGTSVSSVNFPEVALPS
                     HPGKHRLLHIHQNVPGVMSEINKVFADNGINISGQYLQTDEKVGYVVIDVDAEYSDLA
                     LEKLQHVNGTIRSRVLF"
     CDS             302911..303051
                     /codon_start=1
                     /locus_tag="KF707C_2820"
                     /product="hypothetical protein"
                     /protein_id="BAU71970.1"
                     /transl_table=11
                     /translation="MTEAGRGGSGLLPGKSAVGRDSRGAYASMISFSLARLRPESFSG
                     RP"
     CDS             303048..304463
                     /codon_start=1
                     /locus_tag="KF707C_2830"
                     /product="D-2-hydroxyglutarate dehydrogenase"
                     /protein_id="BAU71971.1"
                     /transl_table=11
                     /translation="MNDLRVPLMTNVALIEELKTLVEPGKVLTDAASLDAYGKDWTKH
                     FAPAPSAIVFPKTVEQVQSIVRWANQHKVALVPSGGRTGLSAAAVAANGEVVVAFDYM
                     NQILGFNEYDRTVVCQPGVVTEQLQNFAEEKGLYYPVDFASAGSSQLGGNIGTNAGGI
                     KVIRYGMTRNWVAGLKVVTGTGELLELNRDLIKNATGYDLRQLFIGAEGTLGFVVEAT
                     MRLDRAPKNLTAMVLGSPDLDSIMPVLHAFQSKLDLTAFEFFSDKAMAKVLARGDVPA
                     PFETECPFYALLEFEAASEEIANDALATFEHCVEQGWVLDGVMSQSEQQLQNLWKLRE
                     YISETISHWTPYKNDISVTVSKVPAFLHDIDAIVEANYPDFEVVWFGHIGDGNLHLNI
                     LKPENLSKDEFFAKCATVNKWVFETVEKYNGSISAEHGVGMTKRDYLGYSRSEAEIAV
                     MKAIKAVFDPNGIMNPGKIFN"
     CDS             304521..305186
                     /codon_start=1
                     /locus_tag="KF707C_2840"
                     /product="fumarylacetoacetate hydrolase family protein"
                     /protein_id="BAU71972.1"
                     /transl_table=11
                     /translation="MSYQHQYVDGTPIHFSLGKVVCVGRNYAEHARELNNPVPTEPLL
                     FIKPGSCVVPLAGGFSIPQDRGSVHYEAEIAVLIGKPLSRHPDEEEVRDAISGFAPAL
                     DLTLRDVQARLKDKGLPWEIAKSFDGACVLAPFVPGDAPERLDDIGIRLTINGEVRQD
                     GNSRDMLNPILPLIQHMAGHFSLQPGDVILTGTPVGVGPLHQGDELVLELVGHSAFES
                     RVL"
     CDS             305276..306205
                     /codon_start=1
                     /locus_tag="KF707C_2850"
                     /product="outer membrane protein"
                     /protein_id="BAU71973.1"
                     /transl_table=11
                     /translation="MSSRLPSPFRHRVLLGLAASFAIGAALTRYMHWDDRALVWLSEH
                     RLTQAQRADSIWLPGYQVVLQGKPLAGLEEDETSDLAYNPVTGTLFTVTGKAPTLVEI
                     SRTGDVLRKIPLKGFSNPEGVAVLEGGHVAVTDERRRTLSIFELDPQTRELTAGSTPE
                     FDLGFPDSGNKGFEGIAWDPAKGRLILGKERGPVALFSLGSDGNDALDDGLRPLPSYG
                     LGMRNLSALSVDPRTGHLLVLSAQSNLLLELDEQGEPVSFISLLGGMNGLEARIPRAE
                     GVAMDERGDIYVVSEPNLFYVFRKNLLAGADRG"
     CDS             306312..306659
                     /codon_start=1
                     /locus_tag="KF707C_2860"
                     /product="protein ygiW precursor"
                     /protein_id="BAU71974.1"
                     /transl_table=11
                     /translation="MKAKYLALLAAPLFSTAVFASSYTGPGATSQITTVAAALEASDD
                     APVVLQGQIVRRIKGDIYEFKDATGTMKVEIDDEDWPPMSIDDKATVRLTGEVDRDLM
                     GREVDVEFVERVN"
     CDS             complement(306806..308194)
                     /codon_start=1
                     /locus_tag="KF707C_2870"
                     /product="putrescine importer"
                     /protein_id="BAU71975.1"
                     /transl_table=11
                     /translation="MTQSSSLGGNTRLPDEFTHSAQGTSLRRILGLPALVFFGLVYMV
                     PLTIFTTYGVVTEMTGGRTALAYVVTLAAMIFTALSYSYMVRRYPIAGSAYSYSSLSF
                     GPGAGFLTGWCLLLDYLFLPMINYLVIGIFLNIAFPEVPAWVFVVGFIGLVTALNILG
                     ISSVSGMSNLIVTAQLVFVLVFLAMAGKSLMDGPIDFMAPLMGDGSQPGLAPIMAGAA
                     VLCLSFLGFDAVSTLAEEARDPRRDIPRAIVITTLSAGVLFFVLAAIAQLVFPGSTFK
                     DADAAANEVMLAAGGQFLAAFFTAAYVAGAAGSALASQASVSRILYSMGRDGILPRRL
                     FGTLSARFMTPTVAILVVSLVSLLAVVIDLATLASMISFGALVAFSAVNLAVIRTYLF
                     DGRPRQPGDLLRYGLVPLVGFGLIAWLWTSLSGLTLMLGLAWFALGLAYLALQTRGFR
                     RPAPRVQFSDHP"
     CDS             308186..308389
                     /codon_start=1
                     /locus_tag="KF707C_2880"
                     /product="hypothetical protein"
                     /protein_id="BAU71976.1"
                     /transl_table=11
                     /translation="MGHSASLRSLRAAFGRLVAWRAIRAHASPGPLRIRSCASRQYGG
                     SPGVHREGRALRRGRARDMFISL"
     CDS             308676..309599
                     /codon_start=1
                     /locus_tag="KF707C_2890"
                     /product="outer membrane protein"
                     /protein_id="BAU71977.1"
                     /transl_table=11
                     /translation="MRSLLTPWRLVAALLLLVLLLLGVAAQQFRLFERGLFVLQEWRH
                     ASEWRERSIWLPDYRVVIEAKPIEGLSDDVSALTYDPDRHSLFTVTNQKPEIIELSLD
                     GHLIRRIELVGFGDPEAIEYISKGVYVITDEREQRLLKVRVDEGTTRVDAAASQQLSL
                     GIGLSGNKGFEGLAYDTTGRRLFVAKERDPVRIYEIHGFPHTNPDKPFAVHVVDDPKR
                     DARLFVRDLSSLQYDDRSGHLLALSDESRLVLELNADGLPISTLSLLRGMHGLKRGVP
                     QAEGVAMDNDGNLYLVSEPNLFYVFSRQVAD"
     CDS             complement(309600..309932)
                     /codon_start=1
                     /locus_tag="KF707C_2900"
                     /note="FIG00959217"
                     /product="hypothetical protein"
                     /protein_id="BAU71978.1"
                     /transl_table=11
                     /translation="MAGKFHLTKASNGQYHFNLNAGNGETILSSELYKARDSALNGIE
                     SVRSNAPREGAFEQRTASNGKFYFVLKATNGQVIGQSQMYASAASASAGVESVKKNAP
                     DATLVDDA"
     CDS             complement(310019..310690)
                     /codon_start=1
                     /EC_number="5.3.1.6"
                     /locus_tag="KF707C_2910"
                     /product="ribose 5-phosphate isomerase A"
                     /protein_id="BAU71979.1"
                     /transl_table=11
                     /translation="MTQDQLKQAVAQAAIDVILPRLDKTSIIGVGTGSTANFFIDLLA
                     QHKMAFDGAVASSEATAQRLKSHGIPVYDLNSVSDLEFYVDGADESNERLELIKGGGA
                     ALTREKIVAAVARTFICIADESKLVPLLGTFPLPVEVIPMARSHVARQLVKLGGDPVY
                     REGVLTDNGNIILDVYNLQIDSPVKLEEQINAIVGVVTNGLFAARPADLLLLGTRDGV
                     KRLGA"
     CDS             310831..312345
                     /codon_start=1
                     /EC_number="4.3.1.19"
                     /locus_tag="KF707C_2920"
                     /product="threonine dehydratase biosynthetic"
                     /protein_id="BAU71980.1"
                     /transl_table=11
                     /translation="MLEEYVKKTLTSRVYDVAVETPLQPARQLTERLGNQVLLKREDL
                     QPVFSFKIRGAYNRIAQLTPEELARGVVTASAGNHAQGVALAAREMGIKATIVMPRTT
                     PELKVQGVRARGGKVVLHGDAFPDALAHSLKLVEEKGYVYIHPYDDPDVIAGQGTVAM
                     EILRQHPGRLDAIFVPVGGGGLIAGIAAFVKYLRPEVKVIGVEPDDSNCLQAAMAAGE
                     RVVLGQVGLFADGVAVAQIGQYPFDICKDHVDEVITVSTDEICAAIKDIYDDTRSITE
                     PAGALAVAGIKRYVEREGARGQTLVAIDSGANINFDRLRHVAERAELGEKREAIIAVT
                     IPERPGSFKAFCEAIGKRQITEFNYRYNTDSEAHIFVGVQTHPETDPRAALVENLRQQ
                     GFPVLDLTDNELAKLHIRHMVGGHAARVSGELVFRFEFPERPGALFNFLSKLGGRWNI
                     TMFHYRNHGAADGRVLAALQVPEEERDQVRAALDAIGYPYWDESDNPAYRLFLG"
     CDS             312410..312868
                     /codon_start=1
                     /locus_tag="KF707C_2930"
                     /product="predicted integral membrane protein"
                     /protein_id="BAU71981.1"
                     /transl_table=11
                     /translation="MENYLLFRILHGLATLLFFGGLAGLAWYGWRAFRSGDAARIGAQ
                     LRHILLFGVPLLILVAVSLPVSGWWMVDLAGLPLGQTWLLGGAILYLFGCIAWLLLFG
                     RLARLREQALDASGPMSPPVQRSLRFGAAYGLFGLLLFGAVVALMVTKPL"
     CDS             312887..313348
                     /codon_start=1
                     /locus_tag="KF707C_2940"
                     /product="hypothetical protein"
                     /protein_id="BAU71982.1"
                     /transl_table=11
                     /translation="MTLYYLLKTAHGLLAAVLLGAALAGLLFAHRAARSGSAGQIAST
                     FSSLVHLELWFIGSSAVLLPLSGLALARVGGWPIGQSWLLWSAGLYLVAALCWVPLLW
                     LQIRIRNRARRALRDGLAPELASLAAWRFRLASLALLLLIAVYALMVVKPL"
     CDS             complement(313335..314015)
                     /codon_start=1
                     /EC_number="3.1.3.3"
                     /locus_tag="KF707C_2950"
                     /product="phosphoserine phosphatase"
                     /protein_id="BAU71983.1"
                     /transl_table=11
                     /translation="MRLALFDLDNTLLGGDSDHAWGDFLCRRGILDRVAYKARNDAFY
                     QDYLAGRLDIRAYLDFSLEILGRTEMARLDQWHREFMAECIEPIVLPRAEALLAEHRA
                     AGDRLVIITATNRFVTAPIARRLGVEHLLATECEMAGGRYTGRTTDVPCFREGKVTRL
                     ARWLGETGLTLEGSAFYSDSMNDLPLLERVTHPVAVDPDPALRAEADRRGWRVISLRH
                     AGPPATGA"
     CDS             314161..314640
                     /codon_start=1
                     /EC_number="3.6.1.-"
                     /locus_tag="KF707C_2960"
                     /product="adenosine (5')-pentaphospho-(5'')-adenosine
                     pyrophosphohydrolase"
                     /protein_id="BAU71984.1"
                     /transl_table=11
                     /translation="MIDSDGFRPNVGIILANDVGQVLWARRINQDAWQFPQGGINPRE
                     TPEEALFRELNEEVGLEEQDVKILACTRGWLRYRLPQRLVRTHSQPLCIGQKQKWFLL
                     RLQSDENKVRMDLTGKPEFDGWRWVSYWYPLGQVVTFKREVYRRALKELAPRLLAQD"
     CDS             314663..316942
                     /codon_start=1
                     /locus_tag="KF707C_2970"
                     /note="FIG001592, phosphorylase, nitrogen regulation
                     associated"
                     /product="phosphocarrier protein kinase"
                     /protein_id="BAU71985.1"
                     /transl_table=11
                     /translation="MLNTLRKIVQEVNAAKDLKAALAIIVQRVKEAMGSQVCSVYLLD
                     PESNRFVLMATEGLNKRSIGKVSMAPNEGLVGLVGTREEPLNLEHAADHPRYRYFAET
                     GEERFASFLGAPIIHHRRVMGVLVVQQKERRQFDEGEEAFLVTMSAQLAGVIAHAEAT
                     GSIRGLGRQGKGTQEAKFVGVPGAPGAAVGTAVVVLPPADLEVVPDRSVDDIDAEIER
                     FKQALEAVREDMRRLSSKLETQLRPEERALFDVYLMMLDDASIGLEVKRVIRTGQWAQ
                     GALRQVVMEHVTRFELMDDAYLRERASDVKDLGRRLLAYLQEERKQNLVYQDNTILVS
                     EELSPAMLGEVPEGKLVGLVSVLGSGNSHVAILARAMGIPTVMGVVDLPYSKVDGIEM
                     IVDGYHGEVFTNPSAELRKQYSEVVEEDRQLVKGLDALRSLPCETLDGQRMPLWVNTG
                     LLADVTRAQERGAEGVGLYRTEVPFMINERFPSEKEQLAIYREQLAAFHPLPVTMRTL
                     DIGGDKALSYFPIKESNPFLGWRGIRVTLDHPEIFLVQVRAMLKASEGLDNLRILLPM
                     ISGTHELEEALHLIHRAWGEVRDEGVDIPMPPVGVMIEIPAAVYQTRELARQVDFLSV
                     GSNDLTQYLLAVDRNNPRVADLYDYLHPAVLQALKKVVDDAHAEGKPVSICGEMAGDP
                     AAAVLLLAMGFDSLSMNATNLPKVKWLLRQVTLSKARELLAQLLTIDNPQVIHSSLSL
                     ALRNLGLGRVINPAATIQA"
     CDS             317022..318062
                     /codon_start=1
                     /locus_tag="KF707C_2980"
                     /product="diguanylate cyclase/phosphodiesterase (GGDEF &
                     EAL domains) with PAS/PAC sensor(s)"
                     /protein_id="BAU71986.1"
                     /transl_table=11
                     /translation="MEKLDPEPLDHCYGTTLEEVERTLRFALDIVSDGIWDWNIRTNH
                     VKRSPGWYSMLGYPQDGLPEDVDTWKSVIHPGDYERVMRNFQAYVSGESQIYAEDYRC
                     RCRDGSYLWVSDHGRFVEFDEDGRPTRMIGAHRDIHRRKMASLELQRKNEELLALNRR
                     LESLVAERTEELRRTNEALAQQVATAMRLSETDPLTQVSNRRHFERALHGEWQRFQRH
                     GHATALLMFDLDHFKRINDQYGHQIGDRALVAVSRSVRGALREEDCFARWGGEEFIAL
                     LPETDLESALRLAERLRQRVPQADPGLPRALTASFSVAAMQAGEGIESLLKRLDDGLY
                     RAKLRRDCIEAC"
     CDS             complement(318122..319393)
                     /codon_start=1
                     /EC_number="3.5.2.3"
                     /locus_tag="KF707C_2990"
                     /product="dihydroorotase"
                     /protein_id="BAU71987.1"
                     /transl_table=11
                     /translation="MRTHILGARLIDPASGHDQVTDLFLEGGKVAAIGQAPAGFQAEK
                     TLGAKGLVAAPGLVDLSVALREPGYSRKGTIASETLAAVAGGVTSLCCPPLTRPILDT
                     PAVAELILDRAQEAGHAKVFPIGALTKGLAGEQLSELVALRDVGCVAFGNGLASFVSN
                     RVQRRGLEYAATFDLTVIFHAQDASLAEGGLAHEGPTASFLGLAGIPESAETVALARD
                     LLLVEQSGVRAHFSQITSARGAEMIAQAQARGLPVTADVAMYQLILTDEALMDFSSLY
                     HVQPPLRTRADRDALREAVKAGVITAIASHHQPHEPDAKLAPFGATEPGISSVELLLP
                     LAMTLVQDGLLDLPTLLARLTSGPARALRLPAGRLAVGAPADLVLFDPEATTLAGETW
                     KSRGDNCPFIGHCLPGQVRYTLVDGRIIFQG"
     CDS             complement(319393..320400)
                     /codon_start=1
                     /EC_number="2.1.3.2"
                     /locus_tag="KF707C_3000"
                     /product="aspartate carbamoyltransferase"
                     /protein_id="BAU71988.1"
                     /transl_table=11
                     /translation="MPTDAKRPLQLNDQGQLRHFLSLDGLPRELLTELLDTADSFLEV
                     GARAVKKVPLLRGRTVCNVFFENSTRTRTTFELAAQRLSADVITLNVSTSSTSKGETL
                     FDTLRNLEAMAADMFVVRHADSGAAHFIAEHVCPDVAIINGGDGRHAHPTQGMLDMLT
                     IRRHKGDFENLSVAIVGDILHSRVARSNMLALRTLGCRDIRVIGPKTLIPVGVEQYGV
                     KVYTDLSEGLKDVDVVIMLRLQRERMQGGLLPSEGEFYRLYGLSTQRLALAKPDAIVM
                     HPGPINRGVEIESAVADGAQSVILNQVTYGIAVRMAVLSMAMSGQAAQRQLNQDAEEL
                     N"
     CDS             complement(320437..320949)
                     /codon_start=1
                     /EC_number="2.4.2.9"
                     /locus_tag="KF707C_3010"
                     /note="Pyrimidine operon regulatory protein PyrR"
                     /product="uracil phosphoribosyltransferase"
                     /protein_id="BAU71989.1"
                     /transl_table=11
                     /translation="MTLPNPAELLPRMASDLHAHLKARQILEPRFIGIRTGGVWVAQA
                     LLEQLGEKGPLGTLDVSFYRDDFTQNGLHPQVRPSELPFEIEGQHLVLIDDVLMSGRT
                     VRAALNELFDYGRPASVTLVCLLDLNARELPIRPDVVGATLSLGATERVKLLGPAPLS
                     LERQDLASPA"
     CDS             complement(320963..321403)
                     /codon_start=1
                     /locus_tag="KF707C_3020"
                     /product="putative Holliday junction resolvase YggF"
                     /protein_id="BAU71990.1"
                     /transl_table=11
                     /translation="MGETRPLRLLLGFDYGTRQIGVAVGQAITGQARELKVLKAQNGV
                     PDWQQVEALIREWQPDAIVVGLPLNMDGTPSEMSARAEKFARRLNGRFNLPVFTHDER
                     LTTFEAKGQRLAQGQRDGYRERPVDALAAALLLEGWLAENPSQS"
     CDS             complement(321403..321969)
                     /codon_start=1
                     /locus_tag="KF707C_3030"
                     /product="UPF0301 protein YqgE"
                     /protein_id="BAU71991.1"
                     /transl_table=11
                     /translation="MKSAPSYLKHHFLIAMPHMADPNFAQTVTYLVEHNEQGAMGLVI
                     NRPNGLSLSDVLEQLRMDYTPPARCQGLPIFAGGPVQTDRGFVLHPTGHSYQATLELG
                     ELALSTSQDVLFAIADGSGPEKSLVALGYAGWDAGQLEAELADNAWLTCPADLPILFD
                     TPAEQRLSAAAARLGVNLSLLTAQAGHA"
     CDS             complement(322067..322948)
                     /codon_start=1
                     /locus_tag="KF707C_3040"
                     /product="TonB protein"
                     /protein_id="BAU71992.1"
                     /transl_table=11
                     /translation="MTSSAHPTAGVRPADRLGFTLFLAAVLHVAVILGVGFTLGDPQQ
                     ISKSLEITLATFKSEEKPKEADFLAQANQQGSGTLEHKATPKTTEVAPFQDKEIRKAT
                     PPTAPTQAPRKEAPKAAVATTKPQPQKTTVKREQTRPQPEARPAPTFDSSQLSAEIAS
                     LEAELDKERQLYAKRPRIHRLSAASTMRDKGAWYKEEWRKKIERIGNLNYPDEARRQR
                     IYGNLRLLVSINRDGTLYEVQVLESSGQSVLDQGAMRIVRLAAPFAPFTGDLADIDRL
                     EIIRTWRFERGDRLSSN"
     CDS             complement(323048..324019)
                     /codon_start=1
                     /EC_number="6.3.2.3"
                     /locus_tag="KF707C_3050"
                     /product="glutathione synthetase"
                     /protein_id="BAU71993.1"
                     /transl_table=11
                     /translation="MSVRLGIVMDPIAKISFKKDSSLAMLLAAQERGWSLFYMEQQDL
                     YQKNGEARTRMRPLKVFLDPERWFELEAEDDIPLADLDVILMRKDPPFDNEFVYSTYL
                     LEQAERAGVLVVNRPQSLRDCNEKFFATLFPQLTPPTLVSRRADILREFAEEQRDIIL
                     KPLDGMGGSSIFRHRAGDPNLSVILETLTAHGSQQIMAQRYLPAIVDGDKRILMIDGE
                     PVPYCLARIPAAGETRGNLAAGGRGEARPLTERDREIAATVGPTLREKGLLFVGLDVI
                     GDHLTEINVTSPTCIREIDKAYDTRIGARLMEAIEQKLKAAGRTPQA"
     CDS             324286..324693
                     /codon_start=1
                     /locus_tag="KF707C_3060"
                     /product="twitching motility protein PilG"
                     /protein_id="BAU71994.1"
                     /transl_table=11
                     /translation="MEQHSEGLKVMVIDDSKTIRRTAETLLKKVGCEVITAVDGFDAL
                     AKIADSHPNIIFVDIMMPRLDGYQTCALIKNNSAFKSTPVIMLSSKDGLFDKAKGRIV
                     GSDQYLTKPFSKEELLGAIKTHVPDFTPVEQAS"
     CDS             324739..325104
                     /codon_start=1
                     /locus_tag="KF707C_3070"
                     /product="twitching motility protein PilH"
                     /protein_id="BAU71995.1"
                     /transl_table=11
                     /translation="MARILIVDDSPTEMYKLTAMLEKHGHQVLKAENGADGVALARQE
                     KPDAVLMDIVMPGLNGFQATRQLTKDAETSHIPVIIVTTKDQETDKVWGKRQGAKDYL
                     TKPIDEDTLIKTLNTVLAG"
     CDS             325163..325699
                     /codon_start=1
                     /locus_tag="KF707C_3080"
                     /product="type IV pili signal transduction protein PilI"
                     /protein_id="BAU71996.1"
                     /transl_table=11
                     /translation="MSESRTPFQLLLEIDQRCRALAAGLPAQQQVVRSWSGIGFRMGE
                     RHFVAPMGEVSEVLHEPRYTSLPGVKSWVRGVANVRGRLLPIMDLCGFFGGELSPLRK
                     QRRVLVVDHQEIFAGLIVDEVFGMQHFLVDAFSEERPLLEASIQPFIHGVFHRERPWL
                     VFSPHVLARHQAFLEVAV"
     CDS             325839..327887
                     /codon_start=1
                     /locus_tag="KF707C_3090"
                     /product="type IV pilus biogenesis protein PilJ"
                     /protein_id="BAU71997.1"
                     /transl_table=11
                     /translation="MKRLNAGNLLSGVRSTSLIAGLFVVLIIAIVLLFANFAYLNTQA
                     NYDKEYISHAGELRVLSQRIAKNSSEAAAGKAEAFAQLKDARNDFDKRWNILTKGDAS
                     AGLPAAPAAVEDEMGAVQKDWDNLRKNADAILASEQTVLSLHQVAATLAETIPQLQVE
                     YEEVVDILLESGAPASQVSVAQRQSLLAERILGSVNKVLAGDEDSVQAADMFGRDASL
                     FGRVLSAMLEGNAAMDISKVTNTEALERLQEISELFEFVSGSVDEILETSPELFQVRE
                     SANTIFSGSQILLDKASGLTTGFENLAAGRGLNTLAGYILGALALGAIILIGLVMVQS
                     TRSRLAETAAKNERNQAAILRLLDEIADLADGDLTVAATVTEDFTGAIADSINYSIDQ
                     LRELVETINLTAVQVAAAAQETQATAMHLAEASEHQAQEIAGASAAINEMAVSIDQVS
                     ANASESSAVAERSVAIANKGNEVVHNTITGMDNIREQIQDTSKRIKRLGESSQEIGDI
                     VSLINDIADQTNILALNAAIQASMAGDAGRGFAVVADEVQRLAERSSAATKQIEALVK
                     TIQTDTNEAVISMEQTTSEVVRGARLAQDAGVALEEIEKVSKTLAALIQNISNAARQQ
                     ASSAGHISNTMNVIQEITSQTSAGTTATAKSIGNLAKMASEMRKSVSGFKLPDTQDIA
                     "
     CDS             327950..328810
                     /codon_start=1
                     /EC_number="2.1.1.80"
                     /locus_tag="KF707C_3100"
                     /product="chemotaxis protein methyltransferase CheR"
                     /protein_id="BAU71998.1"
                     /transl_table=11
                     /translation="MQPGGVWALKPLADMTHEEFQDWQKLLEERTGVVVNDRRRTFLQ
                     ANLSARMRELGVTDYASYYRQVTDGPRGAVEWSNLLDRLTVQETRFFRHGPSFELLAD
                     YLRGRIETGLSRPLEIWSLGCSSGEEPYSLAMVAAEALAGTPWPDHFAVTGTDISLSA
                     LAKAREGVYGARRLEPLATELAERYFQALDAGRYKVVPSLAARVCCARLNVLELAKAP
                     MSGMDVIFCQNLLIYFRRWRRRDILNRLAERLAPGGLMVLGVGEVVGWEHPELEPVAN
                     EQVLAFTRKG"
     CDS             328820..336406
                     /codon_start=1
                     /locus_tag="KF707C_3110"
                     /product="still frameshift probable component of
                     chemotactic signal transduction system"
                     /protein_id="BAU71999.1"
                     /transl_table=11
                     /translation="MTDRHDYVALEWVKGEIAETLKQARQALEDFVENPQDPTRMRFC
                     LNYIHQVQGTLQMVEFYGAALLAEEMERLALALMEGRTANRGEALEVLMQAILQLPPY
                     LDRIQSARRDLPMVLLPLLNDLRAARGDNLLSETSLFAPDLSSVMPALSVDSLARMRT
                     AELPALLRKLRQMLQTALVGVIRNQDLATNLGYMARVFARLESLCQDAPLGTLWPIAS
                     GLVEGLANGSVVNGSSVRNLLRQVDKELKRLLEQGADGFNQAAPEELVKNLLFYIAKA
                     PAQSPRIRALKARYRLDEALPDTAVVDEERARLAGPDRDAMRSVVAALCEELVRVKDS
                     LDLFVRSDRSAVTDLDALLPPLKQIADTLAVLGFGQPRKVILDQIDVIHGLSLGQREP
                     SDAVLMDVAGALLYVEATLAGMVGPAEEGGGEESHLPTTDVAQIHQLVIKEARNALEQ
                     AKDAIIEFIASQWNHEHLARVPELLTQARGGLSMIPLPRAATLLEACNRYIQEQLLAR
                     KAVPNWQSLDTLADAITSVEYYLERLSEDHAAQGDLILDVAEESLAALGYPVQQKPSI
                     LDPVADVEPPAPLADPLQDIEVLAAEETELSQHLELDEEPASLMPDPLPEDAEVSVDA
                     AAPQAPDDFDSDFGLGASPDAAVMPAAEGLANDDNWRLGEPETRPAEGFDLSLDAPLE
                     RTGGESPEAQAGELLASDDNWSLGEPELLPSEGFDFSLDAPLEATVDAPIPDRANEWD
                     LAELDAALLPHRNDPLPSLDLTELDSLPADADAPVVRSEDWQGLDLDMPLEFEPVQPQ
                     PSFDLADLEALAPAQPGEPAALDPQGDGEALPSLDFDELELLPVDEPLAGLEALSLDD
                     LPAPLEWDEAALAELGLPDVELPAAPDPVPEAPEVPAERPLSLADVMAAPVPAFNPPA
                     REVPPTLLPPPADEEPVDDELQEVFIEEAGEVLETLAEYLPRWHAADDDRDALGEVRR
                     AFHTLKGSGRMVRALVIGELSWSVENLLNRVLDRSIEASEPVHQVVQEVVDLLPALVQ
                     EYADKAQRQRDDVDLLAATAHALAKGQPLPKSDAPGSEQAVGPVGEAQAHVITDSGEA
                     LDPQLLEIFRNEAELHLDTLAGFLKACDQELPQAVNDDLQRALHTLKGSAHMAGILPI
                     AEIATPLEKLAKEYKTNLLSIDLSEAELLKDALALLRVGVAQLDSAPLEPIPGTEALL
                     ERIRRLHQERLDAANAARRNDKGESRDPQMISLFLAEGMDILLDAEDLLRRWREHPAE
                     RQELGALLEELTTLAHGAEMAELPQIETLCEALLDVYGAVDESSLPVSERFFSEAEAA
                     HEALIGMMDQVAAALEVTPRPERVQALHALLQEAVDPVALASLEPDAAPDAVDDALSG
                     SNPAEAPIDEVPLDEVPAALDQEMVDIFLEEAVDILDSAGKALERWLGEPGNMSALLS
                     LQRDLHTLKGGARMAEIRPIGDLAHELESLYEGLVDRRHNHSPRLSGLLQDSHDCLAR
                     LLEQLQAGRPLAEPAQLIRDIRGYRQGGAQSLSAAVVEPLPEAFEDAFPEFDAADDPP
                     AANDAGAESSSEDEMETELALALDEGEPRPLVEEPARYGGESLGLDREQDPELVEIFL
                     EEGFDILDSAGAALQRWIEDPDNLLEVEALQRDLHTLKGGARMAEIGPIGDLSHELEF
                     LYEGLCSGRLRASPELFLLLQACQDRLGEMLDAVRARRPLPDGRPLIEAIQRWRANPA
                     EQLAMPSSVHLQPAVEDELEAVAEADILDIFLEEADDLLEAMETAIGRWEESREDGSQ
                     LDELLRNLHTLKGGARLAGQRRLGDLSHDLEQYLIEIQQQGAPWPESLFLDLQSGYEG
                     LQAELDTLRQQLDQSLAEDQPGARGPGNEPGPVALAAPIVAASVAPDVPQEERVLPFV
                     RRAQEAAQEAAARRAPQELVKVPAELLEGLVNLAGETSIFRGRVEQQVSDFSFTLTEM
                     EATIERVRDQLRRLDTETQAQILSRYQAEAERAGYEEFDPLEMDRHSQLQQLSRALFE
                     SASDLLDLKETLAARNRDAETLLLQQARVNTELQEGLMRTRMVPFDRLVPRLRRIVRQ
                     VASELGKQVEFVVGNAEGEMDRTVLERMVAPLEHMLRNAVDHGIETAEARRAAGKPET
                     GTIRLNLGREGGDIVLTLEDDGAGIRLEAVRRKAIERGMMDADADLSDHEVLQFILEP
                     GFSTAEQVTQISGRGVGMDVVHSEVKQLGGGMSIDSTPGVGSRFLIRLPFTVSVNRAL
                     MVLSGEDLYAIPLNTIEGIVRVSPYELEAYYQPGAPRFEYAAQAYELKYLGDLLDNGQ
                     QPKLVGQSLPLPVILVRSSEHAVAVQVDALVGSREIVVKSLGPQFAGVHGISGATILG
                     DGRVVVILDLLATIRSRHAHLAQPLPRSASVAQLPAETDLVRPPLVMVVDDSVTVRKV
                     TSRLLERNGMNVLTAKDGVDAIALLQEQRPDILLLDIEMPRMDGFEVATLVRHDERLK
                     DLPIIMITSRTGEKHRERALAIGVNEYLGKPYQESQLLDSIQHLVKRT"
     CDS             336403..337434
                     /codon_start=1
                     /EC_number="3.1.1.61"
                     /locus_tag="KF707C_3120"
                     /product="chemotaxis response regulator protein-glutamate
                     methylesterase CheB"
                     /protein_id="BAU72000.1"
                     /transl_table=11
                     /translation="MTEKTSARIAVLADTSLQRHVLQQALTGNGYQVVLNSDPARLDE
                     AALGACEADLWLVDLALSEDSPLVDNLLEHASAPVLFGEGHAPERHSEHYPRWERRLF
                     GKLKKLVGDPAVAVGPSLQTLLADAQRPARLELPRALANTPLVSGEPARQVWLLAASL
                     GGPAAVKDFLDALPGGLPVGFLYAQHIDATFESALPQAVGRHSQWHVNLVRPGEPVRC
                     GEVVVVPIAQELAFDEDGRVQLADRPWPEPYSPSIDQAMLNLGQQFGADCGVIAFSGM
                     GSDGSAAAAYLKRQGGLIWTQSADSCACSSMPDSLREGGYSSFSGNPRELAAKLVEHL
                     AASLNQDSP"
     CDS             337431..337901
                     /codon_start=1
                     /locus_tag="KF707C_3130"
                     /product="chemotaxis signal transduction protein"
                     /protein_id="BAU72001.1"
                     /transl_table=11
                     /translation="MTQVVTQQTGASSLTGLLLPLSDRALLVPNVALAELIPYRAPQA
                     SPGLPAWLLGQIAWRDLRLPLLSFEAAAGGEVRVGPGARVAVLNALGGRPHVKFIALL
                     LQGIPRSLRLEENLPRANAPLSVLELDAVQLGTDLARIPDLMALEQMLADAGLI"
     CDS             complement(337963..338682)
                     /codon_start=1
                     /EC_number="2.1.1.-"
                     /locus_tag="KF707C_3140"
                     /product="ribosomal RNA small subunit methyltransferase E"
                     /protein_id="BAU72002.1"
                     /transl_table=11
                     /translation="MRLSRFFIDAPLSLGQHELPEAQAHYIGRVLRLAAGDAVQLFDG
                     SGQEFRGELVEVGKKRVQVELREAFAGLAESPLRVHLGQGLSRGERMDWAIQKATELG
                     AVEITPLVSERCEVRLKDERADKRLAHWRQVAISACEQCGRSVLPVIHAPVALADWQR
                     QVEADLKLVLHPVAAPLASHARPGTLAFLIGPEGGLSDTEVESAKAAGFHAARLGPRV
                     LRTETAPVVALSVAQQLWGDF"
     CDS             complement(338762..340168)
                     /codon_start=1
                     /EC_number="2.6.1.62"
                     /locus_tag="KF707C_3150"
                     /product="adenosylmethionine-8-amino-7-oxononanoate
                     aminotransferase"
                     /protein_id="BAU72003.1"
                     /transl_table=11
                     /translation="MGLNADWMQRDLAVLWHPCTQMKDHERLPVVPIRRGEGVWLEDF
                     EGKRYLDAVSSWWVNVFGHANPRINQRIKDQVDQLEHVILAGFSHQPVVELSERLVKI
                     TPKGLDRVFYADNGSSGIEVALKMSYHFWRNQGLERKKRFVTLTNSYHGETVAAMSVG
                     DVALFTETYKSLLLDTLKVPSPDCYLRPEGLCWEEHSRAMFAHMERTLAEHHQEVAAV
                     IVEPLIQGAGGMRMYHPVYLKLLREACDRYGVHLIHDEIAVGFGRTGTMFACEQAGIA
                     PDFLVLSKALTGGYLPMAAVLTSETVYQGFYDDYQTLRAFLHSHTYTGNPLACAAALA
                     TLDIFEQDRVIERNRALAMRMAQSTAHLVDHPHVAEVRQTGMVLAIEMVQDKAAKTPY
                     PWQERRGLKVFQHALERGALLRPLGNVVYFLPPYVITPEQIDFLAEVATEGIDIATRD
                     AVSVPVAADLHPNHRDPG"
     CDS             340331..341800
                     /codon_start=1
                     /EC_number="1.4.3.4"
                     /locus_tag="KF707C_3160"
                     /note="flavin-containing"
                     /product="amine oxidase A"
                     /protein_id="BAU72004.1"
                     /transl_table=11
                     /translation="MPAAWRALAFIIVGGLSATALAKDKQPSAIVIGGGMAGLTSAYE
                     LQQKGWQVTLLEARPSLGGRSALATSEWIGSARLQPTLYRYLDQFKVKAVPAPDYVRT
                     PGYLVAGRYFSEADLLKEAPSTLEGLKRFDKSLDDLAASIEDPLKPLANHTLQSLDAI
                     TVARWLEKLNLPPTAKALVEQRIRSRYDEPSRLSLLYLAQQARVYRGLPDTEMRSARL
                     PGGSQVLAQAMAKRLKTIKTNARVSAIVQDKDGVTVKVGGTGYTADYVVLAVPLPALG
                     RISQTPSLSALQLKALKDINYGWRDQMLLKFRKPVWGKSRLSGEVYSDQGLGMLWVEP
                     ALKGGANLLVNLSGDNARLMQAFGDRQMVDQVLIRFDKLYPGAREQFKGYELRRYGKD
                     ALAGGAYLAYGPGEISLYWRLWEQPLGRVVFAGEHTDALYPGTLEGALRSGERAAAQV
                     IDLKAGKSVGPVETVAEARPAPRPVAREEKKGFFSRLFD"
     CDS             342212..342766
                     /codon_start=1
                     /locus_tag="KF707C_3170"
                     /product="cytochrome B561"
                     /protein_id="BAU72005.1"
                     /transl_table=11
                     /translation="MQWRNTSSRFGLVSIVLHWGVALVFFGLFGLGLWMVGLDYYSSW
                     YKTGPDIHKGVGILLFLVMLARLVWRFVSPPPPALPNHGAMTRLGSKVGHLVLYVGLF
                     ALMISGYLISTADGRGIQVFGLFEVPATLTAIPDQEDVAGLIHEYLAWGLLIFAGIHA
                     LAALKHHFIDRDATLTRMFGRAAK"
     CDS             342798..343373
                     /codon_start=1
                     /locus_tag="KF707C_3180"
                     /product="protein yceI precursor"
                     /protein_id="BAU72006.1"
                     /transl_table=11
                     /translation="MLKKSLAALTLGAALFAGQAMAADYTIDKEGQHAFVNFKIGHLG
                     YSYIYGTFKDFDGTFSFDAKNPEASKVKVTLKTASVDTNHAERDKHIRSGDFLNVSKN
                     PTATFESTSVKSTGEGTADVTGNLTLNGVTKPVVVKATFVGEGSDPWGGYRAGFEGST
                     RIKLKDFDIQKDLGPASQEAELIISFEGVRS"
     CDS             complement(343524..345482)
                     /codon_start=1
                     /locus_tag="KF707C_3190"
                     /product="ATP-dependent RNA helicase RhlE"
                     /protein_id="BAU72007.1"
                     /transl_table=11
                     /translation="MSFASLGLSEALVGAVEAAGYAQPTPVQQRAIPAVLQGRDLMVA
                     AQTGTGKTAGFALPILELLFPDGHPDKSQRHGPRQARVLVLTPTRELAAQVHDSFRLY
                     ARDLSLNSACIFGGVGMNPQIQALSKGVDLLVACPGRLLDLAGQGNVDLSHVEILVLD
                     EADRMLDMGFIHDVKKVLARLPAKRQNLLFSATFSKDIVELANKLLHDPERIEVTPPN
                     TTVERIEQRVFRLPASHKRALLAHLITLGAWEQVLVFTRTKHGANRLAEYLTKHGLPA
                     AAIHGNKSQNARTKALADFKANEVRILVATDIAARGLDIDQLPHVVNFELPNVEEDYV
                     HRIGRTGRAGRSGEAISLVAPDEDKLLKAIERLTKQKIPDGDMLGFDPANVEVERPEA
                     RPPKPERQPRANKPKREPKEKDKAPVAQGVAEGQDTEAGSEGGDGKPRKSRNRRRGKG
                     KGQGQEQGQQPAAAQQKQQPRQPKQKQPRAQSQGAPQSPADRDPEEFLDDEVDNFGNR
                     VDYVSPYPPKGQDQRKRRGGQAPGQGQRQQGQGQGQNRSGGGGQGRSNQGGNPGQRQG
                     GQGGQKQRQGKAAKGGRGNAPRRDDQLVSRGRDEPAVQDPRASKPAPKIIMKESRADR
                     FPTPEQLEELQQQSRPRGEKPALLTRNR"
     CDS             complement(345665..346426)
                     /codon_start=1
                     /locus_tag="KF707C_3200"
                     /product="periplasmic binding protein, putative"
                     /protein_id="BAU72008.1"
                     /transl_table=11
                     /translation="MPVARLLLLTLLACLGLAARAEPLRIVSEPWAPYVYEEHGEIRG
                     LDYEASAEVFRRLGVEVEWSLQPWKRCLMELESGQADGVLDIFHTDERESWMVYPAEP
                     LSKVEFVLFHDRQRPYPFNRLDDLRGLKVGVSPGYWYADPQFRTSPLFTREAAPTHEA
                     NLGKLVRDRVDLVVNDRLAGRFLIHKMGLAGKVGEHARVISRDRLYLSFRRTPELERL
                     AGRFSAELLRFKQEPAYAQLKSRYQATAASLDGNR"
     CDS             complement(346578..347423)
                     /codon_start=1
                     /EC_number="1.5.1.20"
                     /locus_tag="KF707C_3210"
                     /product="5,10-methylenetetrahydrofolate reductase"
                     /protein_id="BAU72009.1"
                     /transl_table=11
                     /translation="MSQDRRYSFEFFPAKTEAGHEKLLATARNLASCKPDFFSCTYGA
                     GGSTRDRTLQTVLQLDGEIQVPTAPHLSCVGDSKAELRALLAHYKDAGIQRIVALRGD
                     LPSGMGMASGELRHANDLVAFIRAETGDHFHIEVAAYPEVHPQARNFEEDLKHFVNKV
                     NAGASSAITQYFFNADSYFYFVERARRQGVEIPIVPGIMPITNYSKLARFSDACGAEI
                     PRWVRKQLEAYGDDVASIQAFGEQVITEMCERLLQGGAPGLHFYTLNQAEPSLALWRN
                     LKLPR"
     CDS             complement(347487..348896)
                     /codon_start=1
                     /EC_number="3.3.1.1"
                     /locus_tag="KF707C_3220"
                     /product="adenosylhomocysteinase"
                     /protein_id="BAU72010.1"
                     /transl_table=11
                     /translation="MSAVMTPADFTDYKVADISLAAWGRRELIIAESEMPALMGLRRK
                     YAASQPLKGAKILGCIHMTIQTGVLIETLVALGAEVRWSSCNIFSTQDQAAAAIAAAG
                     IPVFAWKGETEAEYEWCIEQTILKDGQPWDANMVLDDGGDLTEILHKKYPQMLEKIHG
                     ITEETTTGVHRLLDMLKAGTLKVPAINVNDSVTKSKNDNKYGCRHSLNDAIKRGTDHL
                     LSGKQALVIGYGDVGKGSAQSLRQEGMIVKVSEVDPICAMQACMDGFEVVSPYKDGLN
                     DGTPDSIDAALLGKIDLIVTTTGNVNVCDANMLKALKKRAVVCNIGHFDNEIDTAFMR
                     KHWAWEEVKPQVHKIHRTGNVGFDPLNDDYLILLAEGRLVNLGNATGHPSRIMDGSFA
                     NQVLAQIHLFEQKFADLPADEKAKRLTVEVLPKKLDEEVALEMVKGFGGVVTRLTPQQ
                     ADYIGVDASGPFKPDTYRY"
     CDS             complement(348942..349205)
                     /codon_start=1
                     /locus_tag="KF707C_3230"
                     /product="hypothetical protein"
                     /protein_id="BAU72011.1"
                     /transl_table=11
                     /translation="MPGATPRFGSGEPATRTRIEHARRGENPCGRSRCAHPDAGRRKT
                     LGSPVGAAIIRRFQTAGAARPFPPPFRGALQQARPVRLGRGVA"
     CDS             349308..350882
                     /codon_start=1
                     /locus_tag="KF707C_3240"
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="BAU72012.1"
                     /transl_table=11
                     /translation="MSATSLFDSLLRSVGLRTLNQQFLFSYALMFLLAVTASVALYLS
                     MSVSPETINVAGAQRMLSQKMTKEALLLRQGAIPRATLDATIAQFDQAHRDLLQGNPA
                     RNISALQEPAIARQMRQVGQLWAAFRPQLERGEGDLATLESASLNLLREMNKAVGLMA
                     AHAENSQRRQMWLAFACVIGILLLVVLGRQFGLRPLIHRLGELEGALTRVGQGDFTQP
                     LVGQRQDNEIGRIVAGYNLMREQVRGLLGQVKETGGHTRQHVDTVVTAAQAASDGVRL
                     QHENLDQVATAMNEMSATVAEVARHAAHAAESARNADGCAKAGQQAVQRSSLLIGALS
                     TQMAASAGQMNALRDETEGVGKVLEVITGIAEQTNLLALNAAIEAARAGEAGRGFAVV
                     ADEVRTLASRTQQSTGEIQAMIQRLQDGAQQAVSALQDSNRLVSENLSHIEQASEVLG
                     SIVVAVDSISAMNTQIATAAEEQSQVAQDIDQRVTEISSLAERSRDDAHSVMQASQRI
                     QGEVQELNGHLDHFRT"
     CDS             351075..351539
                     /codon_start=1
                     /locus_tag="KF707C_3250"
                     /product="cytochrome c556"
                     /protein_id="BAU72013.1"
                     /transl_table=11
                     /translation="MILPMNAKKFLILAALCLGLAACGGVDPNSPLGKRQAIFKDMLR
                     TSEDLGGMLRGRIAFDDDRFAQGAVRLEELSRQPWQHFPQAHEGDADSAARDEVWQRQ
                     ERFQALARELEAATVQLASAVKVRPFTAQGVAPLVQKVEDGCEACHQEFRAY"
     CDS             complement(351533..353200)
                     /codon_start=1
                     /EC_number="6.5.1.2"
                     /locus_tag="KF707C_3260"
                     /product="DNA ligase"
                     /protein_id="BAU72014.1"
                     /transl_table=11
                     /translation="MPRRIVPLTLALLPILATPCPRWTPDRAATELELLASQIGQWNL
                     DYHRLGRSSVDDELYDQARARLELLRDCFPEVAPEPPDPLAGNRGPLPHPVPQTGLDK
                     LGGPDSLEAWLGQRRDLWVQPKVDGVAVTLEYRKDRLVRAISRGDGRHGQDWSAQARR
                     IPAIPKLLPGLGDAVLQGELYWRLADHVQAERGGQGARGKVAGLLNRRELKTADAAGI
                     GLFVWDWPDGPMDMEARLDGLERLGFVDAKALTRPVAGADEVAAWRQRWYRSPLPFAS
                     DGVVIRQGRRPAASRWKPEPPHWAVAWKYPYGKALAEVRAVTFRVGRTGRITPLLRLQ
                     PVELDGRRIRQLGLGSLERWQALDVRPGDQVAIVLAGLTIPRLDSVVLRAAERAPVAV
                     PDAGRHHALSCFRPSPGCEEQFLARLEWLGGKGGLDLRGLGRGTWARLGLEGMLDWLG
                     LDAETLQARPGIGRARAQALQASFTAARQRPFTRWLKALGLPPSGGAALQGDWQELSE
                     RTALDWQSRDGLGPVRAERLVAFFQHPEVQALAATLQAEGISGFAPQ"
     CDS             complement(353382..353642)
                     /codon_start=1
                     /EC_number="2.5.1.6"
                     /locus_tag="KF707C_3270"
                     /product="S-adenosylmethionine synthetase"
                     /protein_id="BAU72015.1"
                     /transl_table=11
                     /translation="MITGIWRWGRGALDCQHRPSIAIHQNGRTAATAAAPSPARTRPR
                     STAAYGHFGRNPYEMTYGDDTFTAFTWERTDKAEALRAAAGL"
     CDS             complement(353821..355566)
                     /codon_start=1
                     /locus_tag="KF707C_3280"
                     /product="hypothetical protein"
                     /protein_id="BAU72016.1"
                     /transl_table=11
                     /translation="MLDQRIITALGSRPWKVLQVLLFVSLSKLTFVAAPILLGHIVDG
                     LTSERSYSERIPILLVAFCIAGAVQVVINPLQSLHLSRLVQDCVYESSLQWARSVMGK
                     EFEVFSSLRIGGLINTVDRGITAYERLLGFLLISGVPLAIEIAIVGGVLLFYGGIGVF
                     FTVLCTALSYLYLNHRIIRWRRCHIDNLNDQEDEVASSFAQTFTAAKAIKCEGTPESA
                     FLSLDNAYRNYALSAVRIGFSASILGSVKALFICLSTAGILLFGFVDQLSAAPFMTVG
                     EMVAMFTIATAFFNNVASVAEAHRFTDQFSSDQRRFQQILDLQDFRKNTCLDDKKETE
                     VEVLTLEPFSVQRPEANLLELVEPLSIMKGESIAIVGSSGAGKTTLLEALAGVLVEST
                     NTLKLDSAYLSSFSSKDQFSLLRYCPQSPCILSGNITDSALFGQACDQAELAYYLRLI
                     ALPRLASELRTFEIENQGTNLSGGELKRLSLLRVIMRPGAFNLFDEPTASLDAASAER
                     VWSLLFERFKGRALICATHDLESLSRFDRVLVVHAGRIIAVGEWSELSGNERITSILK
                     QQIQENDSERKFDRD"
     CDS             complement(355571..356746)
                     /codon_start=1
                     /locus_tag="KF707C_3290"
                     /product="hypothetical protein"
                     /protein_id="BAU72017.1"
                     /transl_table=11
                     /translation="MDIHNYERENLGASRILILKNCFKSLGLDSVIDKIDESIAIAAL
                     YAQGKLIAEGAGKGKSCEIGALAEAFEHYCLQNEILNETPIEAAKIAKQHALHSDGVI
                     QSLSCFNEHVEVVKFKSLFGEDEIAIPQLLVSPRDALPEGICHKIIERYATNSGTALG
                     CSFEEAILHGLNEVIERHILSLLMLDSIGEECEVKIHEISKKNINCLLSCIDFKPHGS
                     IRVYFVDELLGSFFCLAVRDGEEDTFSLPQIGSGCSQSFLLAFSRAVFELVQAETLYG
                     YEERCIDEQAIRIISRSKRLEGLRKMRPISSKVTDYLPEPNGKFPNRPREQVNSALNS
                     LKRSEFAPYYRVLNEMASSVFVVQVYVPGMERFNLIRSGKWVAPHAALLHSPFDKES"
     CDS             complement(358309..359499)
                     /codon_start=1
                     /EC_number="2.5.1.6"
                     /locus_tag="KF707C_3300"
                     /product="S-adenosylmethionine synthetase"
                     /protein_id="BAU72018.1"
                     /transl_table=11
                     /translation="MSEYSLFTSESVSEGHPDKIADQISDAVLDAIIAQDKHARVACE
                     TLVKTGVAIIAGEVTTSAWVDLEELVRKVIIDIGYDSSDVGFDGATCGILNIIGKQSP
                     DINQGVDRAKPEDQGAGDQGLMFGYASNETDVLMPAPICFSHRLVERQAEARKSGLLP
                     WLRPDAKSQVTCRYENGKVVGIDAVVLSTQHNPDVKYSDLREGVMELIVKHVLPAELL
                     HKDTQFHINPTGNFVIGGPVGDCGLTGRKIIVDSYGGMARHGGGAFSGKDPSKVDRSA
                     AYAGRYVAKNIVAAGLAERCEIQVSYAIGVAQPTSISINTFGTGKISDEKIVQLVREH
                     FDLRPYAITRMLDLLHPMYQPTAAYGHFGRNPYEMTYGDDTFTAFTWERTDKAEALRA
                     AAGL"
     CDS             complement(359519..360520)
                     /codon_start=1
                     /locus_tag="KF707C_3310"
                     /note="ArsR family / Methyltransferase fusion"
                     /product="transcriptional regulator"
                     /protein_id="BAU72019.1"
                     /transl_table=11
                     /translation="MSLRVPQIRHDDSDELAALCKAGGDPLRLNVLRALANDSFGVLE
                     LAQIFATGQSGMSHHLKVLAQAGLVATRREGNAIFYRRALAQSERIGGTLHAALLAEV
                     DDLALPADITARIAEVHAQREAVSRDYFARTADKFQAQQDLIAGLPQYRDSVLAVLDA
                     LGFGAEASALEVGPGDGGFLPDLARRFARVTALDNSPAMLDLARTRCQEEGLGNVELR
                     LADALNDPQAAADCVVLNMVLHHFAAPADAMKQLAQRVQPGGSLLVTELCSHNQSWAR
                     EACGDLWLGFEQDDLARWANAAGLTPGESLYIGLRNGFQIQVRHFAKPDSRSELTHR"
     CDS             complement(360598..361479)
                     /codon_start=1
                     /locus_tag="KF707C_3320"
                     /note="LysR family"
                     /product="transcriptional regulator"
                     /protein_id="BAU72020.1"
                     /transl_table=11
                     /translation="MNLHHLKVFLAVAESGSISAGANRLFISQPAVTREIRDLEASVG
                     LALFDRRPRGVTLTEAGQRLLHYAQRIFALEAAAERELRDFADLDEGELRLGASATLG
                     SYLLPALIEDFHRRHPALSVELLVSNTHEVAAQLEDGRISLGFVEGAFDTDAFASQLL
                     DRDRLLPVAGPRHPLAGCPHLQPEDLAPHDHYLREPGSATRASVERAYRERGIELRVR
                     MSLGSSEALKRLVREGRGIAWLSPLMVRDELADGRLVRLDVDGLAIEREFHALWRPGQ
                     RLSPAPAAFLALARQPR"
     CDS             361586..362719
                     /codon_start=1
                     /locus_tag="KF707C_3330"
                     /note="malic acid transport protein"
                     /product="C4-dicarboxylate transporter"
                     /protein_id="BAU72021.1"
                     /transl_table=11
                     /translation="MPRPFTRLAEPFAFVRQFTPSWFAVTMGTGVLALVMASLPWGGA
                     PERRLAEGLWLFNGMLFLGFALLFGARLALFRDTLKPMLLHPVQSMFLGAVPMGLATF
                     INGLLLFGVPHWGARAVALAEALWWGDVALALGVALLVPYLMFTHQSHALEKLTAVWL
                     LPIVAPEVAAASAGGLAPHLAPEAARQVLVIGYLLWGLSLSLAFSLITLVLLRLTLHK
                     LPGSEFAATSWLPVGPLATGCLGLLSLGRAMPEAFAGTTLEGVAGVARDLGLMAGLLL
                     WGAAAWWLAMALLCTRRHLGQAMRFNLGWWGFTFPLGVFTLATFELAHRTGLGFFALA
                     GAVLALGLALIWLQVMVRTLAGLWHGELFRAPCLEAVTCPSGR"
     CDS             362823..364823
                     /codon_start=1
                     /EC_number="2.2.1.1"
                     /locus_tag="KF707C_3340"
                     /product="transketolase"
                     /protein_id="BAU72022.1"
                     /transl_table=11
                     /translation="MPSRRERANAIRALSMDAVQKANSGHPGAPMGMADIAEVLWRDY
                     LQHNPTNPEWANRDRFVLSNGHGSMLVYSLLHLTGYDLSIEDLKNFRQLHSRTPGHPE
                     YGYTAGVETTTGPLGQGIANAVGFALAEKVLAAQFNRDGHAIVDHNTYVFLGDGCMME
                     GISHEVCALAGTLGLGKLIAFYDDNGISIDGEVHGWFTDDTPKRFEAYGWQVIRNVDG
                     HDADEIKTAIETARKTGDRPTLICCKTVIGFGSPNKQGKEECHGAPLGNDEIALTRAA
                     LGWNHGPFEVPADIYAEWDAKAAGAAREAAWNERFNAYAAAYPELAAEFQRRIKGELP
                     ADFSAKADAYIAEVAAKGETIASRKASQNALNAFGPLLPEFLGGSADLAGSNLTLWKG
                     CKGVAADDASGNYLFYGVREFGMSAIMNGIALHGGFIPYGATFLVFMEYACNAVRMAA
                     LMKKRVLFVYTHDSIGLGEDGPTHQPIEQLGSMRLVPNLDTWRPADAVESAVAWKSAI
                     ERQDGPSALVFSRQNLPHQPRDAGQIANIARGGYVLKDSVGEPELILIATGSEVGLAA
                     QAFDKLTAAGRKVRLVSMPSTSVFDQQDAAYKQAVLPVQVGARIAIEAAHVDYWYKYV
                     GLEGRVIGMSSFGESAPAGALFEHFGFTVENIVATAEELLDV"
     CDS             364935..365984
                     /codon_start=1
                     /locus_tag="KF707C_3350"
                     /product="D-erythrose-4-phosphate dehydrogenase"
                     /protein_id="BAU72023.1"
                     /transl_table=11
                     /translation="MSSNSPFKVALNGYGRIGRCVLRALYERGGRDGFEIIALNDLAD
                     QASIEYLTRFDSTHGRFPGEVKVDGDCLHINGDCVKVLRSAEPEGIDWAALGVDLVLE
                     CSGQYTTRDEAERFTRAGAPRVLFSQPMASEADIDATVVFGVNQDSLAGDETLVSNAS
                     CTTNCGVPLLKLLDESVGLEYVSITTIHSAMNDQPVIDAYHHEDLRRTRSAFQSVIPV
                     STGLARGIERLLPELAGRIQAKAIRVPTVNVSCLDITLQTARDTSAAEINRVLREAAE
                     NGPLQGLLAYTELPHASCDFNHDPHSAIVDGSQTRVSGPRLVNLLAWFDNEWGFANRM
                     LDTAGHYLRVSAAPR"
     CDS             366013..367176
                     /codon_start=1
                     /EC_number="2.7.2.3"
                     /locus_tag="KF707C_3360"
                     /product="phosphoglycerate kinase"
                     /protein_id="BAU72024.1"
                     /transl_table=11
                     /translation="MTVLKMTDLDLQGKRVLIREDLNVPVKDGVVKSDARILASLPTI
                     KLALEKGAAVMVCSHLGRPTEGEFSEENSLKPVADYLSRALGREVPLVADYLGGVDVA
                     PGQVVLFENVRFNKGEKKNADELAQQYAALCDVFVMDAFGTAHRAEGSTHGVAKFAKV
                     ACAGPLLAAELDALGKALGNPARPMAAIVAGSKVSTKLDVLNSLSQVCDQLIVGGGIA
                     NTFLAAAGYKVGKSLHEADLVDTAKAIAAKVSVPLPVDVVVAKEFAETAVATIKAIAD
                     VADDDMILDIGPQTAAHFAELLKSSKTILWNGPVGVFEFDQFGEGTKALALAIADSPA
                     FSIAGGGDTLAAIDKYGVAERISYISTGGGAFLEFVEGKVLPAVDVLEQRAKA"
     CDS             367223..367540
                     /codon_start=1
                     /locus_tag="KF707C_3370"
                     /product="lipoprotein, putative"
                     /protein_id="BAU72025.1"
                     /transl_table=11
                     /translation="MRAAFALVATALVAGCASQEAPSDNWTRWVCDSQTEVLWRFADA
                     GRNSIDLRLGGGDIAHRLKREPSGSGALYSDGNLAFHTRGEEGLVYWVATDDLIGRGC
                     KAP"
     CDS             367651..368715
                     /codon_start=1
                     /EC_number="4.1.2.13"
                     /locus_tag="KF707C_3380"
                     /product="fructose-bisphosphate aldolase class II"
                     /protein_id="BAU72026.1"
                     /transl_table=11
                     /translation="MALISMRQMLDHAAEFGYGVPAFNVNNLEQMRAIMEAADKTDSP
                     VIVQASAGARKYAGAPFLRHLILAAIEEFPHIPVCMHQDHGTSPDVCQRSIQLGFSSV
                     MMDGSLREDGKTPADYEYNVRVTQQTVAFAHACGVSVEGELGCLGSLETGQAGEEDGV
                     GAEGILDHSQMLTDPEEAADFVKKTQVDALAIAIGTSHGAYKFTKPPTGDILAIDRIK
                     EIHKRIPNTHLVMHGSSSVPQDWLAIINEFGGDIKETYGVPVEEIVEGIKYGVRKVNI
                     DTDLRLASTGAIRRYMAQHPSEFDPRKFFSETVKAMRDICIARYEAFGTAGNASKIKP
                     ISLEGMFQRYAKGELDAKVN"
     CDS             368842..369336
                     /codon_start=1
                     /locus_tag="KF707C_3390"
                     /note="COG1451"
                     /product="predicted metal-dependent hydrolase"
                     /protein_id="BAU72027.1"
                     /transl_table=11
                     /translation="MHDLKYLRGYPADLLAQVARMRDAGRLGEYLERRYPGRHEVQSD
                     KALYGYAMELKQAHLRNAPAPDKVIYDNKLDVVHKALGLNTAISRVQGGKLKAKKEIR
                     VASLFKEAAPAFLEMILVHELAHLKERDHTKAFYQLCEHMLPGYHQLEFDLRVYLTWR
                     ELEG"
     CDS             369389..370144
                     /codon_start=1
                     /locus_tag="KF707C_3400"
                     /product="hypothetical protein"
                     /protein_id="BAU72028.1"
                     /transl_table=11
                     /translation="MLAIHRALCVILWVLGLVPFAGARELLAVSAEFPGIHFTAPDGT
                     PRGLGVDVLRMIAAERGDQVRFEIYPWARAQKMVEEGRADVLVGPYRTAARERRFQFV
                     EPGFYRDNLRFYVRRQSGYSWDGRVTSIQGRRIAIMHGWAYGARFDSLKPYLDLHVAP
                     SVELAFKLLMAERVDLVASNERDSRPRIAELGLEGDVSPLEPVIDTQVGYFALPRGES
                     QRPLREDIERILRRMRADGRLAELARPYAVPLP"
     CDS             370230..371087
                     /codon_start=1
                     /locus_tag="KF707C_3410"
                     /note="HD superfamily hydrolase"
                     /product="HD-GYP domain"
                     /protein_id="BAU72029.1"
                     /transl_table=11
                     /translation="MSAAESDYSVYRKVVTQLMNGEEQLPSLPMITLDIRRALTDPNV
                     TVAKLKQLISRDPALSALLMKHASSIMFRSSQPPRTLEDVIRLLGLQEVDRVTLVHSL
                     KSLFTLHSAAHKQLFIGVWGRLTRQAAVSAALARPLGIPSPDHALLASLLCDVGELAV
                     LSAFKDASQVPSAEVFTRLCREYGQSLSVIVLKKWAVDDAYIQVVRGARQWDLDSGPR
                     LSLVDLVNLGIWHALRDEHPAPRLPALGELAAYRKLAPPLDGLDAGGGLALVFAHQDS
                     IRRTASLLR"
     CDS             complement(371084..371317)
                     /codon_start=1
                     /locus_tag="KF707C_3420"
                     /product="hypothetical protein"
                     /protein_id="BAU72030.1"
                     /transl_table=11
                     /translation="MNGLSDVRLTLRAVELEREHCARVTGTPPMPGNRWSRFWMRLHT
                     RRALLALDDRALKDIGLSRAQALEEGRKPFWKS"
     CDS             371506..372921
                     /codon_start=1
                     /EC_number="2.6.1.1"
                     /locus_tag="KF707C_3430"
                     /note="GntR family domain/Aspartate aminotransferase"
                     /product="transcriptional regulator"
                     /protein_id="BAU72031.1"
                     /transl_table=11
                     /translation="MKLYIKLAETLGERIEQGYYRPGDRLPSVRALSQEHGVSLSTVQ
                     QAYRILEDGGLVEPRPKSGYFVPPRRQAPALPAVSRTPQRPVDVSQWNDVLDLVKRSA
                     RDSVIQLGRGMPDISSPTLKPLLRSLGRISRRQDGSGLYYDSIHGTEALREQVARLML
                     DSGCQVPPDDIVITTGCHEALSVAIRSTCEPGDIVAVDSPSFHGAMQTLKGFGMKALE
                     LPTDPLNGISLEALEMALEQWPIKLIQLTPSCNNPLGYIMPEARKRALLTLAQRYDVP
                     ILEDDVYGDLAYQYPRPRSIKSFDEDGRVLFCSSFSKTVAPGIRVGWIAPGRYLDRVL
                     HMKYISTGATATQPQLALAEFLGQGHYEPHLRRMRSQYQHSRDQMIDWVMRYFPEGTR
                     ASRPQGSFMLWVELAEDFDTLRLNRALLPKGVQIAAGSIFSASGKYRNCLRMNYSAKP
                     TPVIEAAVRAVGETIREMLGE"
     CDS             complement(372953..373402)
                     /codon_start=1
                     /locus_tag="KF707C_3440"
                     /product="transposase and inactivated derivatives"
                     /protein_id="BAU72032.1"
                     /transl_table=11
                     /translation="MPSKDQRRGGLSIPGQVHHITLTTAGRRPLFEDFSHARLVIAEM
                     RRLQEQNIVHSLAWVLMPDHLHWLLQLRGPIGLANAIKVFKGRSARRLGGVLETGGSI
                     WQAGFRDHALRRESDLIQVARDIVARPLRAGLVKRIGDYPSWDAQWL"
     CDS             complement(373565..375742)
                     /codon_start=1
                     /locus_tag="KF707C_3450"
                     /note="FIG00956403"
                     /product="hypothetical protein"
                     /protein_id="BAU72033.1"
                     /transl_table=11
                     /translation="MPSTPFVHTLRRLWAVDKFSYSLRVFIALTGSMALCWQQDRMDL
                     LIPLFLGIIASALAETDDSWQGRLTALLVTLGCFSIASLSVELLFPYPWVFVGALALA
                     SFGLTMLGALGERYATIASATLILSIYTMIGVDQRDGSPANLWREPVLLVAGAAWYGL
                     LSVLWQALFTHQPVQQSLARVFRELGQYLKLKSALLEPVRHLDQEARRLELARQNGQV
                     VAALNAAKEIILHRVGNGRPGPKVNRYLKLYFLAQDIHERASSSHHPYNELAEAFFHS
                     DVLFRCQRLLRQQGGACQALGRAIRMRQPFDYLDGTQALEDLNKSLEHLRIQSNPAWR
                     GLLRSLNALARNLATLDRLLTDASNPDALAEAQDASLLDRSPQGLMDVWERLKQHLTP
                     TSPVFRHALRMALALATGYGVLHLIHPEQGYWILLTTVFVCQPNFGATRRKLVQRIAG
                     TLLGLALGWALFDLFPNALVQSAFAVVAGVIFFATRATRYTLATAAITLLVLFCFNQI
                     GDSYGLFLPRLVDTLLGALIAGLAVIFILPDWQGRRLNQVVANTLSCNARYLRQIMQQ
                     YASGKRDDLAYRLARRNAHNADAALSTTLSNMLMEPGHFRKEADIGFRFLVLSHTLLS
                     YLSALGAHRSETPGEALAPTVETAAERIAASLDEIAGSLTEKRSVSIQCDEEDALARE
                     LAQLPEDMDDRPRLVQTELGLVCRQLGPLRTLAAHLLNEGKAG"
     CDS             375959..376708
                     /codon_start=1
                     /locus_tag="KF707C_3460"
                     /note="periplasmic component/domain"
                     /product="ABC-type amino acid transport/signal
                     transduction systems"
                     /protein_id="BAU72034.1"
                     /transl_table=11
                     /translation="MRNRCGVVLVALLLACTNTVAETLRIAADVWPPFADARLPGNGL
                     ATELVATALKRAGHRSEYVQAPWARVLRGVQLGEYDLVVNAWYSDERNVFGHFSRPYL
                     TNRILFLKRKGAPVEVRSPADLGRYSIAAVRGYSYLPGFDADVSLDKVMVKDFQMGAR
                     MLAAGRVDLTLEDELVARYYLNGELKGIRERLEFLPRPLSENGLHILVRRSHPRHEAL
                     VEDFDQAMDAMREDGTYAAIFARHGLPPPGN"
     CDS             complement(376716..378095)
                     /codon_start=1
                     /locus_tag="KF707C_3470"
                     /product="ATP-dependent 23S rRNA helicase DbpA"
                     /protein_id="BAU72035.1"
                     /transl_table=11
                     /translation="MTTTAFTSLPLSPATLANLESLGYRDMTPIQAESLPLILKGRDL
                     IAQAKTGSGKTAAFGIGLLEPLNPRFFGCQALVLCPTRELADQVTKELRRLARGHGNI
                     KVLTLCGGVPFGPQVGSLEHGAHVVVGTPGRVQEHLRKGTLVLDGLNTLVLDEADRML
                     DMGFYDSIADIIQQLPARRQTLLFSATYPDGIAQLARTFMRDPQQVKVEALHDDSQIE
                     QRFYEIDPRQRMEAVLRLLQANRPQSCVAFCATRQQCQELEAYLQQQGVSAQSLHGDL
                     EQRERDQVLALFANQSCSVLVATDVAARGLDIAGLELVINVELSRDPEIHIHRVGRSG
                     RAGEKGLALSLVAPAEAQRAQAIETLQQSPLNWQRLDELIVKNREPLLPPMSTLCISG
                     GRKEKLRPGDILGALTGEAGLPGSQVGKIAIFDFQAFVAVERGVARQALKRLSEGKIK
                     GRSYKVRIL"
     CDS             378331..379365
                     /codon_start=1
                     /locus_tag="KF707C_3480"
                     /product="periplasmic protein torT precursor"
                     /protein_id="BAU72036.1"
                     /transl_table=11
                     /translation="MRTFCALLLSFLVVVPVRATEWFPLPVNIDGREASYRPLTAASK
                     PWRICALLPHGMDRYWWGVAWGLDEESRRQGVHLGVYEAGGYQHAAMQKAQLARCIQL
                     AADAYVIAAINTRGLCAELDELARRRVPVIDLVNRIECPGVTARSQVDFAEMARAALN
                     YILEHSEGRPVRVGWLPGPQDAGWVLDAERGLAEASVEGRVVVVTGGYGPVDRSSQAV
                     LVRRLLAREPQLDYILGNAEAAAFAGQLVRTGGQRYKAQVVSLYATERVLEAIADGTV
                     LAAPTDSPVIQARVAVDLAVRALEGKGMPERVSPRIEVIDKRSLGRFDISHLMPPSGH
                     WMIRQELPEQ"
     CDS             complement(379446..381128)
                     /codon_start=1
                     /EC_number="1.1.99.1"
                     /locus_tag="KF707C_3490"
                     /product="choline dehydrogenase"
                     /protein_id="BAU72037.1"
                     /transl_table=11
                     /translation="MEFDYIIVGAGSAGNVLATRLTEDADVSVLLLEAGGPDYRLDFR
                     TQMPAALAFPLQGRRYNWAYETDPEPYMNNRRMECGRGKGLGGSSLINGMCYIRGNAL
                     DFDGWAKLPGLEDWTYLDCLPYFRKAETRDIGPNDYHGGDGPVSVTTPKAGNNPLFHA
                     MVEAGVQAGYPRTDDLNGYQQEGFGPMDRTVTPEGRRAATGRGYLDQARNRPNLTIVT
                     HALTDRVLFSGKRAIGVTYLQGNSDSAVTAHARREVIVCSGAIASPQLLQRSGVGPSA
                     LLRDLDIPVVHDLPGVGANLQDHLELYLQYACKEPVSIYPATKWWNQPAIGAQWMFLG
                     TGLGASNQFEAGGFIRTRPEFAWPNIQFHFLPVAINYNGSKGVQEHGFQAHMGSMRSP
                     SRGRIHLKSRDPRQHPSILFNYMSHEQDWQEFRDGIRLTREIMAQPALDPYRGRELSP
                     GVDKQSDAELDDFIRNHAETAFHPSCSCKMGTDDMAVVDGQGRVHGVDGLRVVDASIM
                     PEIITGNLNATTIMMAEKIADRIRGRQPLPRSTARYYVAGDKPVRGTPMRKL"
     CDS             complement(381225..382697)
                     /codon_start=1
                     /EC_number="1.2.1.8"
                     /locus_tag="KF707C_3500"
                     /product="betaine aldehyde dehydrogenase"
                     /protein_id="BAU72038.1"
                     /transl_table=11
                     /translation="MARFDEQKLYIGGGYVDATSGATFETVNPATGEVLAKVQRASKE
                     DVERAVASAIEGQKVWAAMTAMQRSRILRRAVDILRLRNDELAALETLDTGKPLAETQ
                     AVDIVTGADVIEYYAGLIPALEGEQIPLRETSFVYTRREPLGVVAGIGAWNYPIQIAM
                     WKSAPALAAGNAMIFKPSEVTPLTALKLAEIYTEAGVPDGVFNVLTGSGREVGQWLTE
                     HPQIEKISFTGGTSTGKKVMASASSSSLKEVTMELGGKSPLIIFDDADLDRAADIAVM
                     ANFFSSGQVCTNGTRVFVPKALAAAFEAKVLERVKRIRLGNPEDPSTNFGPLTSFAHM
                     ESVLGYIEAGRKEGARLVIGGERVSDGEFAKGAYVSPTVFADCRDDMTIVREEIFGPV
                     MSILTYKTEEEVIRRANDTDYGLAAGVVTRDLARAHRAIHKLEAGICWINTWGESPAE
                     MPVGGYKQSGVGRENGITTLAHYTRIKSVQVELGDYASVF"
     CDS             complement(382744..383337)
                     /codon_start=1
                     /locus_tag="KF707C_3510"
                     /product="HTH-type transcriptional regulator BetI"
                     /protein_id="BAU72039.1"
                     /transl_table=11
                     /translation="MPKVGMQPLRRTQLIHATLDAVDQVGMGDASISYIAKLAGVSNG
                     IISHYFQDKNGLLEATMRYLMGDLQDAVRKRRVAMGDDSARGYIRSIIDGNFDETQVN
                     GPAMKTWLAFWASSMHQPALRRLQRINDLRLYSNLCWQFRRELDPNSARAAARGLAAL
                     IDGLWLRGALSGEAFDTEQARHIAYEFLDQQLAKQAA"
     CDS             complement(383410..383553)
                     /codon_start=1
                     /locus_tag="KF707C_3520"
                     /product="hypothetical protein"
                     /protein_id="BAU72040.1"
                     /transl_table=11
                     /translation="MKADAKGRKTDPRLRPATNGFRRPKAWNQVRRTAASRSTARSIF
                     FVV"
     CDS             383572..385170
                     /codon_start=1
                     /locus_tag="KF707C_3530"
                     /product="high-affinity choline uptake protein BetT"
                     /protein_id="BAU72041.1"
                     /transl_table=11
                     /translation="MSQAPITTSPGKVRLNPVVFFGSTALILLLTVALITFPEDAGTL
                     LGKAQAWLSRSFGWYYMLAIGAYLFFVLYVAFSRYGQLRLGADDSKPDFSYGAWAGML
                     FSSGIGISLLYFAASEPIDHLFNPPEGQPGSQQAARQALQLTFLHWGVHGWAIYALVG
                     LAVGYFAYRHNKPLALRSALYPLFGERRMKGGVGNAVDCFGIFVTLLGLVTNLGIGSL
                     QVSSGLEYLFGLPHSQGALLAVILVMSAVATLAAVSGIEKGIRRLSNLNIILFSGLLV
                     FVLLAGQTLHLLNGFVQNLGDYLNGLVLKTFDLYVYTGQSGKSEEWMGLWTLFYWAWW
                     ISWAPFVGMFVARISRGRTVRELVSGVLLIPLGFTLAWLSVFGNSAIDLVMNQNAADL
                     GKAALEQPAMSIYLLLEHYPWSKVVIGLSICVGFVLFLTPADSGSVMLANLSREEGDL
                     DEDAPNWLRIFWSVVVTLATIGLLFAGNFTAMQTVVVLAGLPFSVVLLLYMFALLKQM
                     KADVAAQQPAPVPAKVVELRGEAA"
     CDS             complement(385761..386354)
                     /codon_start=1
                     /locus_tag="KF707C_3540"
                     /product="HTH-type transcriptional regulator BetI"
                     /protein_id="BAU72042.1"
                     /transl_table=11
                     /translation="MPKVGMQPIRRSQLIQATLEAVDQVGLADASIAYIARVAGVSNG
                     IISHYFQDKNGLLEATMRHLMSALSGAVRKRRAALRDDSPRAHLRAIVEGNFDDSQVS
                     GAAMKTWLAFWAASMHQPSLRRLQRINDHRLYSNLCCELRRALPQDQARIAARGLAAL
                     IDGLWLRGALSGDAFNIQQALQIAFDYLDQQLDKAEA"
     CDS             complement(386541..387398)
                     /codon_start=1
                     /locus_tag="KF707C_3550"
                     /note="glycine betaine/L-proline- binding/permease
                     protein"
                     /product="glycine betaine/L-proline ABC transporter"
                     /protein_id="BAU72043.1"
                     /transl_table=11
                     /translation="MRKLKSLCLKTLGVATLALGMGMVQAADKPTLKIGFVNGWDDSV
                     AASYVAGEILKEKLGYGIELKPVEPAIMWQGVARGDLDATLSAWLPATHGEYYAKLKD
                     KVVVLGSNYTGAKIGLIVPDYVQAKSIEDLNTYKADFDGKITGIDAGAGVMRRTEDAI
                     KQYNLDIKLMPSSGPAMATALTRAEKAQKPIVVTGWIPHWMFAKWKLRFLEDPKKVFG
                     DDEHVDTVVNPGLEAKAPEATAFLKKFSWSGEEVGAVMLAIREGAKPEAAAKDWIAKN
                     PQRVEEWLK"
     CDS             complement(387545..388489)
                     /codon_start=1
                     /locus_tag="KF707C_3560"
                     /note="TC 3.A.1.12.1"
                     /product="L-proline glycine betaine binding ABC
                     transporter protein ProX"
                     /protein_id="BAU72044.1"
                     /transl_table=11
                     /translation="MKKIKKVAALGLLACALAQGAWAQEPQSCKQVRFAEIGWADIAA
                     TTGVAMVLTEGLGYTPRKIMASVPIAFTGVKNKQIDVFLGYWAPSMDAVIEPFTKDNG
                     VKVLPTPNLEGAKYTLAVPTYAAESGLKSFQDIAKFKDQLGGKIYGIEPGNDGNLLID
                     KMIKGNQFGLGEFRMVESSEAGMLVQVQRAVKKKEPVVFLGWAPHPMNTQFDITYLAG
                     GDDVFGPDYGAAKVYTVVPPDYEARCGNVGKLLNNLQFTVEIESQLMEKILEKEDPVK
                     VATTWLKANPAALDKWLAGVTTFDGQDGAAAVKKHLGL"
     CDS             complement(388524..389408)
                     /codon_start=1
                     /locus_tag="KF707C_3570"
                     /product="glycine betaine ABC transport system, permease
                     protein OpuAB"
                     /protein_id="BAU72045.1"
                     /transl_table=11
                     /translation="MSEKLDLGSWVNDVVQHLLDNYSGAFESVGQVVSGFSELIERFL
                     MWPPAWVLIAVFVGLGLWRIGVKFALFTAASLILIVLTGFWEQTVVTLGLTFSSTLIS
                     LLLGIPLGIWAAKSERVAVVIRPILDFMQTMPAFVYLIPAAMLFGLGRVPGIIATVIF
                     AMPPAVRLTALGIRQVNKEIVEAGQSFGCTGWQLLYKVQLPNAMPSIMAGVNQTIMMA
                     LSMVIIASMVGAGGLGNDVLASIQRLDIGLGFESGMAVVLLAIILDRITESFGTRQAS
                     RGRMFGRLGARLQRQQAQ"
     CDS             complement(389411..390607)
                     /codon_start=1
                     /locus_tag="KF707C_3580"
                     /note="TC 3.A.1.12.1"
                     /product="L-proline glycine betaine ABC transport system
                     permease protein ProV"
                     /protein_id="BAU72046.1"
                     /transl_table=11
                     /translation="MQSGKIVVQNLYKVFGQQPQEAIDLLKQGWSKEKILAERGAVIG
                     VSDVSFSVNEGEIFVLMGLSGSGKSTLIRLINRLIEPTAGDVFIDGQNVAKLPKSQLI
                     DLRRRDMSMVFQSFALMPSRSVLDNAAFGLEVAGKGKKEREKRAMEVLEQVGLASFAH
                     KYPHELSGGMQQRVGLARALAVDPSMIIMDEAFSALDPLKRREMQDVLLDLQKKHSRT
                     IIFVSHDIEEAMRIGSRIGIMEGGKLIQVGTPQEIIENPANDYVRNFFNTVDTSRYLT
                     AGQLKSDSVPLFVHNGRAPDAQAVCQKLLAMDKHYAFIVDEKNNFRGSISLEKIALLV
                     EGGRTLELEQDLLKHIDPVPEDLPLDSVIQRLVINEGPIPVVDQSGRYSGAISKGRLL
                     SRLRGE"
     CDS             complement(391024..391980)
                     /codon_start=1
                     /locus_tag="KF707C_3590"
                     /note="TC 3.A.1.12.1"
                     /product="L-proline glycine betaine binding ABC
                     transporter protein ProX"
                     /protein_id="BAU72047.1"
                     /transl_table=11
                     /translation="MTRPTALSLAAALLATALFTSQASLAAADPERCGTVHFADVGWS
                     DITVTTAVTRHVLSELGYITKVKRLSVPDTYKAMSEGRVDVFLGNWMPSMENDIRPYL
                     ENGTVESLGANLTGAKYSLAVNQAAWDGGVRTFADLARHREQLGGRIFGIEPGNDGNK
                     LILKMIESDAFDLGGFKLMESSENGMLSQVKRADHLGQWAVFLGWEPHPMNNQLKLHY
                     LAGGDDWFGPDYGGATVHTNVRKGLTRECPNLGRLLANLKFSLAMENHLMEAILNSST
                     NRRREAKAWLQANPDTLARWLEGVTARDGGALPATLVQADTR"
     CDS             392287..393663
                     /codon_start=1
                     /EC_number="4.3.1.17"
                     /locus_tag="KF707C_3600"
                     /product="L-serine dehydratase"
                     /protein_id="BAU72048.1"
                     /transl_table=11
                     /translation="MAISVFDLFKIGIGPSSSHTVGPMRAAALFATALRERGLLELVQ
                     RVEVRLYGSLSATGVGHGTDRATLVGLMGEWPDQVDPKQIGPRIEALKASGQLLLDGR
                     HAVAFDWNRDLLLLEENLPYHPNAMTLVAEGDAGELHRDTYYSIGGGFVVDETQARSG
                     QLDQDSTELPYDFSSGEELLQLCRRHGLRVSELMMENEKAWRSEAEIRAGLLKLWDAM
                     QECVANGLGQEGILPGGLNVRRRAAKLHRSLQELGKPNVIGSTMSAMEWVNLYALAVN
                     EENAAGGRMVTAPTNGAAGIIPAVLHYYMRFNPEATEDDVVAYFLGAAAVGILCKKNA
                     SISGAEVGCQGEVGSACAMAAAGLAEILGATPAQLENAAEIGLEHNLGLTCDPVGGLV
                     QVPCIERNAIAAVKAINAAQMALRGDGEHFISLDRVIRTMRDTGADMHDKYKETSRGG
                     LAVSAIEC"
     CDS             394060..395163
                     /codon_start=1
                     /locus_tag="KF707C_3610"
                     /product="transcriptional regulator containing an amidase
                     domain and an AraC-type DNA-binding HTH domain"
                     /protein_id="BAU72049.1"
                     /transl_table=11
                     /translation="MSQFNQGAQPQNRVPQSIGFLLLDNFTLISLASAVEPLRMANHL
                     SGRELYRWHTLSQDGRPVSASDGLQITPDSGLDNAPSLDAVIVCGGVDIQHSVGREHV
                     QWLQSQARQGRQLGAVCTGSWALAKAGLLDGFECSVHWECLAAMQEAFPRAGITTRLF
                     SIDRNRNTSSGGTAPMDMMLHLIAREHGRELAAAISEMFIYERIRNEQDHQRVPLKHM
                     LGTNQPKLQEIVALMEANLEEPIDLDELACYVDVSRRQLERLFQKYLHCSPSRYYLKL
                     RLIRARQLLKQTAMSIIEVASVCGFVSTPHFSKCYREYFGIPPRDERAGQNANVVALM
                     PVPDELVRNAPSTAGVALTRAQGESTFASVRVV"
     CDS             complement(395274..395519)
                     /codon_start=1
                     /locus_tag="KF707C_3620"
                     /product="hypothetical protein"
                     /protein_id="BAU72050.1"
                     /transl_table=11
                     /translation="MMHADLIDQEDFRERLVALGISVPPGVTAEQACEQAVTGLSPER
                     AVALRRLVEELLGGSATLLPNVREAISRTLLPALVPR"
     CDS             complement(395549..396328)
                     /codon_start=1
                     /locus_tag="KF707C_3630"
                     /note="beta subunit"
                     /product="electron transfer flavoprotein"
                     /protein_id="BAU72051.1"
                     /transl_table=11
                     /translation="MPHDALKIVSLVSIGAHPTSGRARRADQDARAVELGLRLAGPRL
                     RVVHAGDPHEEALRSYLGMGLDELIVLEQGPRDDALHALGDFLQESGAQLVLTGSQAE
                     TGEGSGMLPYLLAERLGWPLVVGLAEVEKVDNGVAQVLQALPRGQRRRLKVRLPFLAS
                     VDNAAPTARQSAFGPARRGRIEAEDVELVEDVLFNEAQLQPARPRPKRLKVIKAKTGA
                     ERMKAATAKASGGGGQVLKDVSPQAGAEAIFKLLLEEGVLR"
     CDS             complement(396318..397550)
                     /codon_start=1
                     /locus_tag="KF707C_3640"
                     /note="alpha subunit"
                     /product="electron transfer flavoprotein"
                     /protein_id="BAU72052.1"
                     /transl_table=11
                     /translation="MSDIIRRDPRAEWIARNRLHPLHAAMQTQGQASWMGPNGLVRKN
                     PHVTAAGFIGPSGIKRIDRSGTQQGAAGKRSAATEVVQLPLHLIEQPAFYICVVPDMV
                     GGRLSAHDKDLLGLANKLAGSEGAVVAVVFGEDKESAFDTAGVDRLLRIGGGAFDGYA
                     PETRVLALSAVEAQLAPRHWLLPDSRTGGGELGRRLAAKLGERPATRVWQIANEQATG
                     RAGAGREDLVRKVPRLILAAAECAEPVSETRHEARALDLSTKIAHSLPRIEDLGPVAV
                     DPAQIPMAEAEFILSGGNGVKDWNLFHQAAVALGATEGASRVAVDDGFMPRNRQVGAT
                     GTWVTARVYLAVGISGAIQHLQGIGACDKVVAINMDPGCDMIKRADLSVIGDSGAVLA
                     ALIELASQYRQGGARDAA"
     CDS             complement(397621..399579)
                     /codon_start=1
                     /locus_tag="KF707C_3650"
                     /note="Iron-sulfur cluster-binding subunit YkgF"
                     /product="predicted L-lactate dehydrogenase"
                     /protein_id="BAU72053.1"
                     /transl_table=11
                     /translation="MLNTLLPLLLFAALGLAVLGAAKRFFMWRRGRPSKVDWIGGLLK
                     MPRRYLVDLHHVVERDKYMSKTHVATAGGFVLAALLAILVHGFGLHSRILGFALLAAT
                     TLMFVGALFVAKRRRNPPSRLSKGPWMRLPKSLLMFSASFFIATLPVAGILPEGFGGW
                     FLAGLLAIGVAWGVSELFFGMTWGGPMKHAFAGALHLAWHRRAERFGGGRSTGLKALD
                     LSDTSAPLGVEKPTDFTWNQLLGFDACVQCGKCEAMCPAFAAGQPLNPKKLIQDMVIG
                     LAGGNDASFAGSPYPGKPLGEHSGGPHQPIVSLEGKALVDAETLWSCTTCRACVEECP
                     MMIEHVDAIVDMRRHLTLEKGATPNKGAEVLENLIATDNPGGFAPGGRLNWAADLNLP
                     LMSDKQQVDVLFWVGDGAFDMRNQRTLRAFVKVLRAANVDFAVLGLEERDSGDVARRL
                     GDEATFQTLAKRNIATLAKYRFKRIVSCDPHSFHVLKNEYGALGGQYQVLHHSTFIDE
                     LVRAGALNLGQSKAASVTYHDPCYLGRYNGEYEAPRAVLKAIGIEVKEMERSGFRSRC
                     CGGGGGAPITDIPGKQRIPDMRMVDIKETGAELVAVGCPQCTAMLEGVVAPRPEIKDI
                     AELVAEVLIEAPVDAKKPSVAKAAVEVA"
     CDS             complement(399746..401806)
                     /codon_start=1
                     /locus_tag="KF707C_3660"
                     /product="DgcA Dimethylglycine demethylase subunit A"
                     /protein_id="BAU72054.1"
                     /transl_table=11
                     /translation="MAFEAMFQPIQIGKLTIRNRVLSTAHAEVIATDGGMTTERYVKY
                     YEEKAKGGIGLAICGGSSVVSSDSPQEWWSSVNLSTDRIIPHFQNLADAMHKHGAKIM
                     IQITHMGRRSRWDGFNWPTLMSPSGIREPVHRATCKTIEVEEIWRVIGDFAQAARRAK
                     AGGLDGVELSAVHQHMIDQFWSPRVNKRTDEWGGTFEGRMKFGLEVLKAVRAEVGPDF
                     CVGLRISGDEFHPDGLSHEDMKQIAKYYSDTGMLDFIGVVGSGADTHNTLANVIPNMS
                     FPPEPFLHLAAGIKEVVNVPVLHAQNIKDPNQATRILEGGYVDMVGMTRAHIADPHLI
                     AKIKMGQVDQIKQCVGANYCIDRQYQGLDVLCIQNAATTREYMGLPHIIEKTTGVKRK
                     VVVVGGGPAGMEAARVAAERGHDVTLFEKKDQLGGQITLAAKAPQRDQIAGITRWYQL
                     ELARLKVDLRLGTAADPDTILDLKPDVVVLANGGHPFIEQNEHWGAAEGLVVSAWDIL
                     EGKVEPGKNVLVYDTICEFGGMSAADYLSEKGAQVEIVTDDIKPGVAMGGTTFPTYYR
                     SLYPKEVIMTGDLVLEKVYREGDKVVAVLENEYTGAREERVVDQIVIENGVRPDESLY
                     YALKDGSRNKGQIDVDALFAIKPQPCLSQPGDGYLLFRIGDCGAPRNVHAAIYDALRL
                     CKDF"
     CDS             complement(401822..402352)
                     /codon_start=1
                     /locus_tag="KF707C_3670"
                     /note="FIG00953113"
                     /product="hypothetical protein"
                     /protein_id="BAU72055.1"
                     /transl_table=11
                     /translation="MAKHAPELPIEVDSETGVWTTDALPMLYVPRHFFVNNHMGIEAE
                     LGPERYAEILYKAGYKSAWHWCEKEAECHGLEGVAVFEHYMKRLSQRGWGLFQIQDID
                     LDKGTASVKLKHSAFVYVYGKVGRKVDYMFTGWFAGAMDQILQARGSSIRTVAEQVYS
                     GSEEGHDDGLFTVKPL"
     CDS             complement(402505..403482)
                     /codon_start=1
                     /EC_number="3.4.13.19"
                     /locus_tag="KF707C_3680"
                     /product="microsomal dipeptidase"
                     /protein_id="BAU72056.1"
                     /transl_table=11
                     /translation="MSPAELHADSIVIDGLIIAKWNRELFEDMRKGGLTAANCTVSVW
                     EGFQATVNNITASNKLIRENSDLVIPVRTTADIRKAKEQGKTGILYGFQNAHAFEDQI
                     GYVEVFKQLGVGIVQMCYNTQNLVGTGCYERDGGLSGFGREIVAEMNRVGIMCDLSHV
                     GSKTSEEVILESKKPVCYSHCLPSGLKEHPRNKSDEELKFIADHGGFVGVTMFAPFLA
                     KGIDSTIDDYAEAIEYVMNIVGEDAIGIGTDFTQGHGKDFFEWLTHDKGYARRLTNFG
                     KIVNPLGIRTVGEFPNLTETLLKRGMPERTVRKVMGENWVRVLKDVWGE"
     CDS             403462..403683
                     /codon_start=1
                     /locus_tag="KF707C_3690"
                     /product="hypothetical protein"
                     /protein_id="BAU72057.1"
                     /transl_table=11
                     /translation="MQFGWAHQAVPCYPRAESSAGALRGAYPRGIRRHRAKATGVLPK
                     ASSRSRMGKSGSEGDPQVRPLPVSCFDRL"
     CDS             403923..404405
                     /codon_start=1
                     /locus_tag="KF707C_3700"
                     /product="NAD-dependent formate dehydrogenase gamma
                     subunit"
                     /protein_id="BAU72058.1"
                     /transl_table=11
                     /translation="MPDESLHLPLVQRVLEREKDAPGALLPILHAIQDGAGYIPDVAV
                     PEIAHALNLSLAEVRGVISFYHDFRTTPPARHTLRLCRAESCQSLGAESLAAQLRDHL
                     QLDDHGTSADGRISLRPVYCLGACACSPALELDGRVHARVTPERLQALLEGCLEDGSC
                     "
     CDS             404399..405955
                     /codon_start=1
                     /locus_tag="KF707C_3710"
                     /product="NAD-dependent formate dehydrogenase beta
                     subunit"
                     /protein_id="BAU72059.1"
                     /transl_table=11
                     /translation="MLRLCIPCDSVARAVGADAVAEALVAEAGRRRLDVEVMRTSSRG
                     LYWLEPLLELDGPDGRLGFGPVTPEDVPSLLDALAGEGVHPLALGAVEEIPYLKSQQR
                     LLFARAGITRPLSLEDYRAHGGYEGLARAIALSGDEIVAAVLDSGLRGRGGAAFPAGI
                     KWRTVRGAVAEQKYVVCNADEGDSGTFADRMQMEGDPFLLIEGMTIAGLAVGATLGYI
                     YVRSEYPQAVQTLRAALEIAREAGYLGGDVAGSGRAFDLEVRVGAGAYICGEETALLD
                     SLEGKRGVVRAKPPLPALQGLFGQPTLVHNVLTLTSVPTILARGAQFYRDFGMGRSLG
                     TMPFQLAGNVRHGGLVERAFGLTLRELVEGYGGGTASGRPLKAAQVGGPLGAWVPPSQ
                     FDTPLDYEAFAAMGAMLGHGGVVVADDSLDMAQMARFALQFCAEESCGKCTPCRIGST
                     RGVEVVDRLLAAPDAAARDEQVILLKDLCDTLTYGSLCALGGMTAYPVTSALKHFPAD
                     FGLETSEADQ"
     CDS             405952..408828
                     /codon_start=1
                     /locus_tag="KF707C_3720"
                     /product="NAD-dependent formate dehydrogenase alpha
                     subunit"
                     /protein_id="BAU72060.1"
                     /transl_table=11
                     /translation="MINLFDPASDIDLGTPARESEVQVSLSIDGREISVPAGTSVMRA
                     AALLGTTIPKLCATDSLEAFGSCRMCLVEIDGMRGYPASCTTPVSEGMVVHTQTPKLA
                     TLRRNVMELYISDHPLDCLTCSANGNCELQTVAGQVGLREVRYGYDGANHLDEEKDVS
                     NPYFDYDPSKCIVCNRCVRACEETQGTFALTIEGRGFDSRVAAAGGDNFLDSECVSCG
                     ACVQACPTATLMEKSVVEMGQPERSVITTCAYCGVGCSFRAEMKGNELVRMVPDKNGQ
                     ANHGHSCVKGRFAFGYATHPDRITKPMIRKHITDPWQEVSWDEAVTYAASEFRRIQLK
                     YGRDSIGGITSSRCTNEETYLVQKLVRAGFGNNNVDTCARVCHSPTGYGLKQTLGESA
                     GTQSFDSVMQADVILVIGANPTDAHPVFGSQLKRRLRQGARLIVIDPRRIDLVDSPHA
                     RAEHHLALRPGTNVAMLNALAHVIVTEGLVNQDFVDARCESADFARWRDFVGKPENSP
                     EALGPICGVAPDDIRAAARLYATGGNAAIYYGLGVTEHSQGSTAVMGIANLAMVTGNI
                     GREGVGVNPLRGQNNVQGSCDMGSFPHELPGYRHVSNDSVRAQFEQAWGVTLQPDPGL
                     RIPNMFEAALGGTFKALYCQGEDIAQSDPNTQHVTAALSAMECVVVQDIFLNETAKFA
                     HVFLPGSSFLEKDGTFTNAERRISRVRKVMEPLGGKADWEATQLLANALGYRMDYKHP
                     SEIMDEIARLTPTFTRVSYAELDRHGSLQWPCNEAAPDGTPTMHIEEFVRGKGRFMLT
                     GYVPTEEKVNSRYPLLLTTGRILSQYNVGAQTRRTDNVAWHEEDRLEIHPTDAESRGI
                     HDGDWVGVGSRAGQTVLRAKVSERVAPGVVYTTFHFPESGANVITTDNSDWATNCPEY
                     KVTAVEVTKVFQPSEWQKRYQAFSDEQRRLLMERRRTERAEVRR"
     CDS             408825..409046
                     /codon_start=1
                     /locus_tag="KF707C_3730"
                     /product="NAD-dependent formate dehydrogenase delta
                     subunit"
                     /protein_id="BAU72061.1"
                     /transl_table=11
                     /translation="MSTDNLIKMANQIAQFFATEPDREQAVKGVQQHLQSFWTPAMRI
                     ELMAWQVEHHGECLHPLVQAALAEQGRAV"
     CDS             complement(409166..410134)
                     /codon_start=1
                     /locus_tag="KF707C_3740"
                     /product="transcriptional regulator containing an amidase
                     domain and an AraC-type DNA-binding HTH domain"
                     /protein_id="BAU72062.1"
                     /transl_table=11
                     /translation="MSQTFSFLLLPGFSMIGLMSAVEPLRVANRFRGGLYHWRLLSLD
                     GGPVQGSNGMSLNVEGGLDAPATGECLLVVAGFEPLACFGPRLSHWLNRADADGLRLG
                     GIDTGSFVLAEAELFTRQRLTLHWEAIEAFRERYPTLSVTQELFEIDGRRITSAGGTA
                     SLDLMLTLMARQHGEALALQVSEQFVLGRIRTHQDHQRMQIASRFNVHNRKLVQVIGE
                     MERHSETPLTTQALAERVGVTPRQLERLFRLHLDETPTGFYLGLRLEKARQLLRQTDM
                     AVLEIALACGFESSSYFSRCYRSRFATTPSRDRHEHPDQESGQDAG"
     CDS             410358..411296
                     /codon_start=1
                     /locus_tag="KF707C_3750"
                     /note="TC 3.A.1.12.1"
                     /product="L-proline glycine betaine binding ABC
                     transporter protein ProX"
                     /protein_id="BAU72063.1"
                     /transl_table=11
                     /translation="MNRLNLFAGCCLLALSTSAALAADDASCQKIRLGTVGWTDVVAT
                     TAVASELLASLGYQTTQTQASQQIVFAGIQKKQIDAFLGYWRPLMDDNIRPFVQSGSV
                     KVAATPSLADATAMLAVPSYAAEQGLRSFEDIARFKDQLDGKIYGIEPGTAANTNIQK
                     MIDENRFGLGDFKLVESSEAGMLSAVSRAVRNQKPIIFWGWKPHPMNIQMPITYLTGS
                     QDLFGPDDGAATVTNVTATDFAQRCPNADRLLANLRFTSEQEAQLMQPIMERQPAAKV
                     AREWLKANPDVVKGWLAGVTTFDGRSGIDSALASLK"
     CDS             411370..412257
                     /codon_start=1
                     /locus_tag="KF707C_3760"
                     /note="FIG004891"
                     /product="hypothetical protein in carnitine cluster"
                     /protein_id="BAU72064.1"
                     /transl_table=11
                     /translation="MNHEVIVTCAVTGAGDTVGKHPAIPVTPKEIAAAAIEAAKAGAT
                     VAHCHVRDPRTGKPSRDVALYRELVERIRESDTDIIINLTAGMGGDLEIGKGEQPLEF
                     GTGTDLVGPLERLAHVEALLPEICTLDCGTLNFGDGDFIYVSTPAQLRAGARRITELG
                     VKAELEIFDTGHLWFAKQMLKEGLLEDPLIQICLGIPWGAPADTTTMKAMADNLPPGV
                     TWAGFGIGRMQMPMVAQAMLLGGNVRVGLEDNIWLDRGVHASNGQLVERAIEIIERLG
                     GRALTPAEGREKMKLKRRG"
     CDS             412360..413325
                     /codon_start=1
                     /EC_number="1.1.1.108"
                     /locus_tag="KF707C_3770"
                     /product="carnitine 3-dehydrogenase"
                     /protein_id="BAU72065.1"
                     /transl_table=11
                     /translation="MSFVTRIKTFAALGSGVIGSGWVARALAHGLDVIAWDPAPGAEA
                     ALRARIANAWPALEKQGLAPGASQDRLRFVETIEECVRDADFIQESAPERLDLKLDLH
                     AKISAAARPDVIIGSSTSGLLPSEFYADAVHPERCVVGHPFNPVYLLPLVEVVGGEKT
                     ASEAVQAAIEVYTALGMRPLHVRKEVPGFIADRLLEALWREALHLVNDGVASTGEIDD
                     AIRFGAGLRWSFMGSFLTYTLAGGNAGMRHFMAQFGPALKLPWTYLPAPELTESLIDR
                     VVEGTADQQGERSIAELERYRDDCLLAVLGAIKSTKARHGFAFAD"
     CDS             413378..413854
                     /codon_start=1
                     /locus_tag="KF707C_3780"
                     /note="FIG143042"
                     /product="thioesterase-like protein"
                     /protein_id="BAU72066.1"
                     /transl_table=11
                     /translation="MSSALTTYRTTIPAEWVDYNGHLRDAFYLLIFSYGTDALMEVIG
                     LDEAGRAQTGHTLYTLECHLNYLAEVKLGAEVEVRTQLLGADAKRLHIHHSLHYPGQA
                     EALAASEQMLMNIDSEAGRSAPFAEAVAERVRGVVSEHDGLPRPVHVGRVMALPRR"
     CDS             413866..414831
                     /codon_start=1
                     /locus_tag="KF707C_3790"
                     /product="lipolytic enzyme"
                     /protein_id="BAU72067.1"
                     /transl_table=11
                     /translation="MSARYPLSPAMAEFVVRCQSFAAAGADIAAQRAAYDALCHAFTP
                     PRAPGVEWRDLRLGSVPVRLYRPRGTAPAAGWPVVLFIHGGGWMLGGLESHAFLCDHL
                     AARLPLALVAVDYRLAPEHPFPAPLEDCLEAWRALGSKTMELALDGDRMAVMGDSAGG
                     NLAAALCLALRDSGGPLPCAQALVYPALSAEPLSSHRNLADAPLLSGEDLAACIAAYL
                     PTPSTRRSPLASPLAAADLRGLPDAFVAVAEFDPLRDDGIHYARRLRADGIPLEFHAG
                     EGLVHGCLRGLGQVPEVDLLVLRLQAWFSRTLRLPRGVDQVVGSA"
     CDS             complement(414810..415442)
                     /codon_start=1
                     /locus_tag="KF707C_3800"
                     /note="LuxR family"
                     /product="DNA-binding response regulator"
                     /protein_id="BAU72068.1"
                     /transl_table=11
                     /translation="MSKVLLIDNQSMTRFATRVLLEREDYEVAGETDSGVEGLSLARS
                     LRPDLVILDIAIPKLDGLEVLGRLSAMDSNLKLLVLTSLPASLYANRCLQAGATGYLS
                     KQEPAVSLISAVRSVLSGYSLFPSTVYLPVSNQPGERNDNQLLDSLSDRELAVLQNLA
                     SGKNNKEIAEQLFISHKTVSTYKSRLMDKLKTRNQVDLIDFARRYALPTT"
     CDS             415892..419551
                     /codon_start=1
                     /locus_tag="KF707C_3810"
                     /product="hybrid sensory histidine kinase in
                     two-component regulatory system with EvgA"
                     /protein_id="BAU72069.1"
                     /transl_table=11
                     /translation="MRISLARTLPGVLLLVLSLFPLSPVRADRVSPVLTLASQQVADQ
                     QELEISESDWHWLRLKRELVLGVQAEGRAPLEIIERDGGYQGIAADTIALVGQLLGMQ
                     VRLRPYADPSALRRALDAGEIDLFVGDGERAWGEGLARSRPFATDRLALFRRAGDQRS
                     LPANLDGLTVSLVPAHSDALAQRYPGARLRMAESVDAGLAAVSFGQADLLLGDLLPVY
                     YQLNRGFYGLARFERFVEGPDPGISFIVRQADRPLLHGLDAALRTLGRTRLDALSRRW
                     VGSSVTPPPEPLQLSPEEARWVTRHPLVRLVIDDDMAPIAFFDDQGQLRGMVSDLLEQ
                     VSLRTGLRFEAISRAGGFARQIDALNAGDAELAILTPSKPREEQLRFTRPISSSPFVL
                     VGRADANGRAAPPEDGATGVLALGRGHVARDEMSLAYPGMALEEAGSSLDALNLVDAG
                     KADYALVSMSVAQYYSVRLFRHRLAVAALAPIEPATANFAVTRADTELHGILDRTLAS
                     LGPDELNGLYDRWRGTPAMSPQTWRDYGTLIQRILLVAALLLLLALAWVLRLRREVRR
                     RQAAERQLNDELRFIETLTDSMPPPLYVRDVEGRLLSCNRSYLESVGQPLERVRGRTA
                     PELPAGSFEAAPEFHRLYLQAMAEGRMIQGVHVIRLDGRTLWIDHWIQPFQDSEGQVK
                     GVICGWLDITEHRRLVQELEEAKNLADAASRAKTTFLATMSHEIRTPMNAVIGILELA
                     LKRAADQPIDRASIEVAYGSARSLLELIGDILDIARIESGRLSLAPRRANLRELVESV
                     ARVFDGLARQKRLSLELDIDSGIQGDVLVDGLRFKQILSNLVSNAIKFTDAGSVRLSI
                     AGDEPEPGLLRVLLRVEDTGIGISAEDQQRLFRPFAQVERRFQQGEGAGLGLVISRSL
                     CEMMGGRLSLSSTPGQGTRVLVELRLHRLDPVPEAVGTAPPPTGERRRLRVLVVDDHP
                     LNRQILGQQLGFLGHEVVEAEQGADALSIWREDPFDAVITDCHMPGMSGADLARAIRE
                     VERTAGREPSLILGLTADAQQEEMDRGILAGMDDCLVKPIGLDVLEDRLRGSGGGAPL
                     AEVADAPPPGAEGALTLFDLTPLAPLTGGDPGLIRNLLAELLETNRRDLEPLEALVDQ
                     GDAAALSELAHRLKGAGRVIRAAPLIEACMRLERACKVPEPLLSEMRGAAEGLRQAML
                     ELDAALTARLEGAGH"
     CDS             complement(419545..420729)
                     /codon_start=1
                     /locus_tag="KF707C_3820"
                     /product="probable two-component response regulator"
                     /protein_id="BAU72070.1"
                     /transl_table=11
                     /translation="MKNLSILVLEDEPFQRLVAVTALRELGLGQIHEAAEGAEALDVL
                     ATCGGVDIVLCDLRMAGMDGLAFLHHASQGGLARSVILSSGVDPELRQATRALVGCLG
                     LEFLGDLGKPFDMQRARRMIERHAHRQPDAPSTPRQPPTLEDILRGLEQDEFEAWFQP
                     KVHLRSGALAGAEVLARWRHPERGVLLPGQFLPLMESSGLIDRLFWQIFRQGLDLQRE
                     LSGRGRRVNLAFNLAPRQLEDREIATRVGQALEQTGLPGEGLTFELTETGLLEAPAAS
                     LESLVRLRLMGCGLAMDDFGAGYSSLDRLCELPFSQVKLDSAFVRKLTTQPRTGAIIS
                     GAVALAEAMDLSLVVEGVETTEQRERLLAMGCDLAQGFLFARPLDREGFRNLLATERP
                     SQ"
     CDS             420896..421531
                     /codon_start=1
                     /locus_tag="KF707C_3830"
                     /note="LuxR family"
                     /product="DNA-binding response regulator"
                     /protein_id="BAU72071.1"
                     /transl_table=11
                     /translation="MRSALIVDDHPVIRMAVRMLLERNGIQVLGEADNGVDALQLVRQ
                     HEPDIVILDIGIPRLDGLNVISRIRALDLESHVLVLTSQPAEGYCQRCMQAGARGFVS
                     KEEDLQNLVTAINAISAGFTFFPAEALAGGQVPGQGESELVGRLSNQELMVLQHLASG
                     LSNKEIADRMLLSNKTISTYKTRIQQKLNLGSLLDLIEFARRNDLCPRQRG"
     CDS             421818..422342
                     /codon_start=1
                     /locus_tag="KF707C_3840"
                     /product="fimbrial protein precursor"
                     /protein_id="BAU72072.1"
                     /transl_table=11
                     /translation="MKKIVSACTALLGLGFGGAAVAADGLITFNGYVSDKTCTIGQGS
                     GDKVVDLDPISLSALKDGGTAGHTRFTLEFTGCSATQVKAQFERNSPQIDPATGDLKN
                     VGSSNVQVRIFNADMERIDLRTNSNNDEWVSTTGTGGKSTATLSYYAAYQAPATGATQ
                     GNVNTYVEYSMNYQ"
     CDS             422397..423131
                     /codon_start=1
                     /locus_tag="KF707C_3850"
                     /product="chaperone protein fimC precursor"
                     /protein_id="BAU72073.1"
                     /transl_table=11
                     /translation="MFSNPSISRLLAVLLIAFGLPQAEASIVVNGTRFVYAAKQPEIS
                     VRASNEGTQPSLVQAWVDRGDPATRPEQADAPFLLMPPIFRLDPGKGQSLRLTFTGEA
                     LPADRESVFWLNVLDVPPQPQGEGGNFMQFAIRTRVKLFYRPVGLPGSAADAIEQVSW
                     RLSEGDSGRVLRATNASAFHVSFSDVALESGGQRYEAGDGMLPPFGTLDLPLPTQVGT
                     NASGKVVTHWINDYGAPIRSEAKLAP"
     CDS             423220..425820
                     /codon_start=1
                     /locus_tag="KF707C_3860"
                     /product="outer membrane usher protein"
                     /protein_id="BAU72074.1"
                     /transl_table=11
                     /translation="MCVSDPPHGRRFKLLASAIAAVVAAGDWRVVDADEAINPARYAV
                     FNPGFFGGSDDESVDLSRFSRPDALPPGTYRLDLYVNERWMGRHELRVEEDGEGEAAA
                     QRYCFRPEQVGALGIELSQLPDPQGARRMIAEQACIELDRLVPEAQVAIDLSELSARL
                     SIPQAYLRRQARGQVDPRDWDAGVTAAFIGYNASGYRNENSGVDSTQLNLGLNNGINL
                     GNWRLRSNGNYNRSSQDGGPTRSHYSNASTYAQRDLTALRSQLTLGDYYTPGDLFDSV
                     PFRGVQVGSDDRMLPDSQRGFAPVIRGVAETNARVTVRQGQSVLYETSVAPGPFLIDD
                     LYDSGYSGDLEVTVSEADGRQRSFIVPYASVAHLLRPGNSRFNLTAGEYRARGLASAP
                     RFAMGTYQRGISNQVSGYLGSIIAEKYIAAQVGVALSTDLGALAFDATQSRVSELPES
                     QGARVPKRGQSYRVTYSKLVDATRTSLSVAAYRYSSEGYLEFGDYAQFIGDPGSTLYR
                     QRSRLQANLSQPLGERYGNLYLSGSAQNYWNTGQSSDLTYQAGYSNGFNWGSIGVSAA
                     RTRMGAGYENQYLLSFSVPLGRGVRAPYLSTSVNHSSGRSNGQASLSGSLGERAQASY
                     SLYGSVNRDRGERSSSGGASAHYRAAAAELSAGYSQGTGYRQQNLGISGSLVAHPGGI
                     NLSQSQGDTLAIVEAKGAEGAYVSSDTGARVGPNGYAVVGNLTPYRRNHVVLDPVGTL
                     RNVELQITEQSVAPRHGAVVMLSYPTIVGAPVLLHILREDGQNPPLGSEVLDGEGRSL
                     ALVGQAGRAFLRGIEPKGVLRVRWGEGADKTCRLEYQLPEVDPSDSGIQQVEVRCVSL
                     NGRSEIALVE"
     CDS             complement(425995..426303)
                     /codon_start=1
                     /locus_tag="KF707C_3870"
                     /product="hypothetical protein"
                     /protein_id="BAU72075.1"
                     /transl_table=11
                     /translation="MKRPLQISLLVLVCATGLAQAEVRNPFQGRVSFTGMIVSGLCAT
                     PRQTWQAHIGRLNGISPAGQAAAPGRDDCAGITQTSSVSLTAVSSRRGEAGIITVTYN
                     "
     CDS             complement(427159..428526)
                     /codon_start=1
                     /locus_tag="KF707C_3880"
                     /product="mobile element protein"
                     /protein_id="BAU72076.1"
                     /transl_table=11
                     /translation="MAIQQALHQMPGKPGRDGAATGEARRGASSDEAGCPRHDQNHTG
                     SGLLQEVLTRENLQLALKRVRANKGVAGVDGLGIDETVEHLKTAWPAIRAQLLAGTYR
                     PSPVRRVLIPKPEGGERKLGIPTVTDRLIQQALLQILQPLLDPGFSDHSYGFRPGRSA
                     HQAVLAAQRYIHSGRNILVDVDLEQFFDRVDHDLLIARLSRKVTDRGVLRLVRAYLNS
                     GTLIDGVVVASERGTPQGGPLSPLLANVLLDEVDKELERRGHCFVRYADDANVYVRSL
                     KAGQRVMAVLRRLYDRLRLQVNERKSAIASAFGRKFLGYSFWLSAQGEIKRGVASQAL
                     QRFKSRIRQLTSRNGGRSVSQVVESLRPYLLGWKAYFGLSQTPRRWRGFDEWIRRRLR
                     AIQLKQWKTGRRTYRELRKLGAWPDLAAAIAGNSHRFWHNSVGLIHGVLTVAWFDRLG
                     LPRLC"
     CDS             complement(429246..430535)
                     /codon_start=1
                     /locus_tag="KF707C_3890"
                     /product="GbcA Glycine betaine demethylase subunit A"
                     /protein_id="BAU72077.1"
                     /transl_table=11
                     /translation="MDVTSTLSLGDPLEPARKATADMLKARDHSFSLPQPFYNDERLF
                     QIDMQEIFLKEWLIAGMTCEIPAKGNYLTLQVGDNPIIVIRGAEGQIHAFHNVCRHRG
                     SRLCVSDKGKVAKLVCPYHQWTYELDGRLLFAGTEMGADFDMKQYGLKPVHVKSAGGY
                     IFVNLSENPPAIDDFLSTLAHYMEPYDMENTKVAVQTTLREAANWKLVIENNRECYHC
                     NGSHPELLNTLLEWDDVTDPRASQAFKDQVAACTKAWDEEKIPYAHASFGLRNRIVRM
                     PLLEGTVSMTMDGKQGCKKLMGRIKNPDLGSMRILHLPHSWNHCMGDHMIVFTVWPIS
                     AQETVVTTKWLVHKDAVEGVDYDVARLREVWDATNDQDRRLAEENQRGINSTAYQPGP
                     YSKTYEFGVINFLDWYSERMLNNLGDTPATKLRQVNE"
     CDS             430899..431999
                     /codon_start=1
                     /locus_tag="KF707C_3900"
                     /product="GbcB Glycine betaine demethylase subunit B"
                     /protein_id="BAU72078.1"
                     /transl_table=11
                     /translation="MTNNFLNPVTTQTWTNGRHMVRCVKAIQETWDVRTFCFMADQPM
                     VFFFKPGQFVTLELEIDGQPIMRSYTISSSPSVPYSFSLTIKRVPGGKVSNWLHDNLK
                     EGDVLPVHGPVGLFNAIDFPADKVLFLSGGVGITPVMSMARWFFDTNGAVDMVFVHSA
                     RAPKDIIYHRELRHMASRIANFKLHLICEKYDIGETWSGYRGYLNRPMLDLIAPDFME
                     REIFCCGPTPYMAAIKRMLEAAGFDMKRYHEEAFGPTPPEIREEVKEHAAEAAEAAEV
                     PLADMNLVEFTGTGKSIRVAPGETVHSAAAKLGLHIPKACGMGICGTCKVLKTAGEVE
                     MEHNGGITDEDVAEGYILSCCSIPKGDVAIDY"
     CDS             432279..432884
                     /codon_start=1
                     /EC_number="2.5.1.18"
                     /locus_tag="KF707C_3910"
                     /product="glutathione S-transferase"
                     /protein_id="BAU72079.1"
                     /transl_table=11
                     /translation="MKLFYSPGACSLAVHIVLREIGNPFELERVDLGAHKTSTGDDYY
                     RSNPKGYVPLLELDDGQVLTEGPVICQYLCDQAGRTDLMPAAGSLPRYRVMEWQAFIS
                     SEVHKSLGALFNSALDDAAKATYAGMAHRRLQWISAQLGGRPYLTGDDFTAADAYLFT
                     VANWAGFVGMDISDCPDLKAFQARVAARPAVQAALKAEGLA"
     CDS             complement(432955..435000)
                     /codon_start=1
                     /locus_tag="KF707C_3920"
                     /product="translation elongation factor G-related protein"
                     /protein_id="BAU72080.1"
                     /transl_table=11
                     /translation="MANYSVESIRTVALVGHGDSGKTSLAEALLHASGTLANPGSLER
                     GDTVCDFDPLEREYRHSLASALAHCSHAGAEINLIDTPGYPDFIGQSIAALAAVETAL
                     VVVNAQNGIELTTRRMMALAAERGLCRLLVVNKIDAERVDLPGLLASLRDAFGKEVLP
                     LNLPAENGSRVVDCFFNPDGEADFSSVADAHQALVDQVVEVDEELMARYLEQGEIAPE
                     ALHEPFERALREGHLIPLCFTSARTGAGVTELLDILARLAPNPTEGNPPLLLKGEGAD
                     ARAFRARPDPEAHVLAHVFKVVIDPFVGKLGIFRVHQGTLVRDMQLFVGEGRKPFKLG
                     HLLRLQGKRHEEVTRLVPGDFGALTKVDEVEFGSVLHDSHDEDQIHLKPLDFPEPMQG
                     LAIEARRRGDEQRIAEVLARLQAEDPCVRLDYQASTQETVLRGMGELHLRYLLDRISG
                     TYKLEVETRPPRVPYREAPMRGAEGHSRHKKQTGGAGQFGEVFLRLEPLPRGSGFQFA
                     DEVKGGVIPSQFIPSVEKGVRSVLACGPLAGLPVEDVKITVHDGKHHPVDSKDIAFQA
                     AGRKAMLDALRAAGEAVLEPIVDIEVTTPEANLGDITTDLIGRRGQVTGTESLSQGLA
                     LIHGQVPLAELDGYAGRLKAITAGQGAFSMVLSHYHPAPQDVQQKLAGAYKAVQEED"
     CDS             complement(435811..436851)
                     /codon_start=1
                     /EC_number="4.1.2.5"
                     /locus_tag="KF707C_3930"
                     /product="low-specificity L-threonine aldolase"
                     /protein_id="BAU72081.1"
                     /transl_table=11
                     /translation="MTDQTQQFASDNYSGICPEAWHAMAEANRGHERAYGDDQWTARA
                     ADHFRQLFETDCEVFFAFNGTAANSLALASLCQSYHSVICSETAHVETDECGAPEFFS
                     NGSKLLLAKTVDGKLTPEAIREIALKRQDIHYPKPRVVTLTQATEVGTVYRPDEVRAI
                     SRVCKELGLNLHMDGARFSNACAFLGCTPAELTWKAGVDVLCFGGTKNGMAVGEAILF
                     FKRELAEDFDYRCKQAGQLASKMRFLAAPWVGLLQDGAWLNYGRHANACAQLLAELVA
                     DVPGVSLMFPVEANGVFLQMSEPALEYLRNRGWRFYTFIGAGGARFMCSWDTELDRVR
                     ELAADIRAAMAA"
     CDS             437046..437348
                     /codon_start=1
                     /locus_tag="KF707C_3940"
                     /product="hypothetical protein"
                     /protein_id="BAU72082.1"
                     /transl_table=11
                     /translation="MRHPSLLVLCLPLLASLPAVAADWSPGDRDHFVQECKTSAQASV
                     PADKLQRYCGCAADKVAAEFSAAELDALKVQKTPLPEATHQRLVKVSQACLSQLNG"
     CDS             complement(437453..437869)
                     /codon_start=1
                     /EC_number="1.1.1.35"
                     /locus_tag="KF707C_3950"
                     /product="3-hydroxyacyl-CoA dehydrogenase"
                     /protein_id="BAU72083.1"
                     /transl_table=11
                     /translation="MTDTLTYRGAVYPWHCDHMGHMNVMWYVGKFDEATWQLFSLLGL
                     APSRLRADDAGMAAVEQQIEYRRELHAGDVVSIHSRVLEIRDKSIRFHHEMRNDETGE
                     IAAVTTLVGVHLDTRARRARAFPADVRERALAWQGN"
     CDS             complement(437871..438770)
                     /codon_start=1
                     /locus_tag="KF707C_3960"
                     /note="alpha/beta hydrolase fold family"
                     /product="hydrolase"
                     /protein_id="BAU72084.1"
                     /transl_table=11
                     /translation="MTRPPADPRRLRLPGGRTLAYQCYGAADGRPLYYFHGFPGSRLQ
                     AALHDEEARAAGVLLVAAERPGFGHSDFQPGRTLLGWAEDMGFLADTLGHGRFGVLGV
                     SCGGPYALACAYRLGERLDYVGLLAGMGPMDIPALRQTQLPALKLMFGLARRHPCLAS
                     PMLALDRLLFRASPLRAVKALGKLLAEPDRQLLASDPALAEGFSRFLAEAYRQGIRGA
                     CSEAALIASPRGFEPETIRVPVHLYQSGQDRHVPEAMALHLQSRLPRSHLRRYPEEGH
                     LSIVIRQFRQVLADFQSSNREAN"
     CDS             439213..440217
                     /codon_start=1
                     /locus_tag="KF707C_3970"
                     /note="AraC family"
                     /product="transcriptional regulator"
                     /protein_id="BAU72085.1"
                     /transl_table=11
                     /translation="MTAYTPLPPTRPALESIGFLLLEDFSLIALAGALEPLRLANQLS
                     GRGLYRWRTLTLDGTPVRAANQMQVSPEGRLDDGAVPDVLILCGGDGPGTLSDPALLA
                     RLRSLAESGVHLGALGSASWPLAEAGLLQGYECSPAWSCRVDLRERFPGIALSPQPYV
                     LDRDRYTAVGGSAALELMLQLIGRNQGPALLGAISETLTFGQLRSDPAPPRLTLRDAL
                     ASAHPRLQEVIALMEANLEEPIDLDDLASFVELSRRQLERLFQKYLRCSPSRYYLKLR
                     LLRARQLLRQTPLPVVQVALGCGFLSAQNFSKCYREHFGIAPSNERLDKPQRCQAAMH
                     "
     CDS             complement(440383..440625)
                     /codon_start=1
                     /locus_tag="KF707C_3980"
                     /product="hypothetical protein"
                     /protein_id="BAU72086.1"
                     /transl_table=11
                     /translation="MHGGNPCCFHGFGAPDWWAVGSHCNRRPRRFFVRIRPQVGQIRR
                     GAARADRCAFVGANSFAKGSEAAPRDPRHQLARATD"
     CDS             440620..441831
                     /codon_start=1
                     /EC_number="3.5.3.3"
                     /locus_tag="KF707C_3990"
                     /product="creatinase"
                     /protein_id="BAU72087.1"
                     /transl_table=11
                     /translation="MQMPKTLRIRNGDKVRSTFSAQEYANRQARLRAHLAAENIDAAV
                     FTSYHNINYYSDFLYCSFGRPYALVVTQDDVISISANIDGGQPWRRTVGTDNIVYTDW
                     QRDNYFVAIQQALPKARRIGIEADHLNLQNRDKLAARYPEAELVDVAAACMRMRMIKS
                     AEEHVMIRHGARIADIGGAAVVEALRDQVPEYEVALHATQAMVRAIADTFEDVELMDT
                     WTWFQSGINTDGAHNPVTTRKVNKGDILSLNCFPMIAGYYTALERTLFLDHCSDDHLR
                     LWQVNVEVHEAGLRLIKPGARCSDIARELNEIFLKHDLLQYRTFGYGHSFGTLSHYYG
                     REAGLELREDIDTVLEPGMVVSMEPMIMLPEGLPGAGGYREHDILIVNENGAENITKF
                     PYGPEKNIIRK"
     CDS             complement(441968..442090)
                     /codon_start=1
                     /locus_tag="KF707C_4000"
                     /product="hypothetical protein"
                     /protein_id="BAU72088.1"
                     /transl_table=11
                     /translation="MPGVWTGAPRPSLKHTLSAAPRRSVPETNLTIACTSVVMS"
     CDS             442124..443467
                     /codon_start=1
                     /locus_tag="KF707C_4010"
                     /product="L-Proline/Glycine betaine transporter ProP"
                     /protein_id="BAU72089.1"
                     /transl_table=11
                     /translation="MSLSNQTLAYGQAGSQTAASERSTLRRAATASFMGNFVEWFDYA
                     AYGYLAAVIAVVFFPATDKTTGLLATFAVFAISFIIRPIGGIVWGHIGDRYGRRNALS
                     LSILIMSGATFCIALLPTYAQVGMLAPLLLLLIRLVQGFSASGEYAGAAAFLAEYAPD
                     DKRGFYTSLVPASTAAGLLFGSLFAALLYSQLDSEQLHEWGWRIPFLLAAPLGLIGRY
                     IRLHLQDTPKFREMEQALERKAGDHSVPIRELMGAQRARVLVAIGVTCLNAVAFYLIL
                     SYMPTYLSAEMGMTETDSFLASTVSLATYIGFIFLMGKLSDRFGRKTMLVLASLLFVG
                     ATVPLFGLLDGQGFAMILLIQIAFGLMLAMNDGTLPCFLAEIFPTRVRYSGFAFSFNT
                     ANALFGGTAPFLATWLIAETGDKLAPAWMLVAAAVVALLAMLAVRETANRALADD"
     CDS             443584..444366
                     /codon_start=1
                     /EC_number="3.5.2.10"
                     /locus_tag="KF707C_4020"
                     /product="creatinine amidohydrolase"
                     /protein_id="BAU72090.1"
                     /transl_table=11
                     /translation="MSKSVFVGELTWKEYEARVASGDAVLMLPVGALEQHGHHMCMNV
                     DVLLPTAVCQRVAERIGALVLPGLQYGYKSQQKSGGGNHFPGTTSLDGATLTGTVQDI
                     IRELARHGVRRLVLMNGHYENSMFIVEGIDLALRELRYAGIHDFKVVVLSYWDFVKDP
                     AVIQQLYPEGFLGWDIEHGGVFETSLMLALYPDLVDLDRVVDHPPATFPPYDVFPVDP
                     ARTPAPGTLSSAKTASREKGELILEVCVQGIAEAIGTEFPSS"
     CDS             444454..445848
                     /codon_start=1
                     /locus_tag="KF707C_4030"
                     /product="hypothetical protein"
                     /protein_id="BAU72091.1"
                     /transl_table=11
                     /translation="MSNSDAHKEYGLSQIKPEERSYGFADTVWTWFGSGINTGSWFFG
                     GMAASLGMVFVLQYSLLWLPLMMIPWAAVAYIGYRYGASTAVVARPSLGTKGSRLTGV
                     AQFLVLIGWPSVNSFIAAISLSHVFGAAFGWPVFGQPGSTWPMVLGILLTAVAQGIIT
                     FLGHEAIRYLERVAGVLLLVLGGWVSYIVLSQWNLSDLMAFRVENPAHSVAFYIDLAF
                     GFSWTWAQVADFSRFSRTGKAATLGSWLGLNVGQGWFMLIGAIGTIGVALQTGNIDPN
                     NSDPSSTLATLGLGLVSFLVLIFATVSTNVTVLYGSGMGLLGAFKGLTPKKALAIIVV
                     LQLGLCFVPMGFDSFLHYFETFLGVIGGLFIPLWTIILVDYFCIRGARISDRDLFAES
                     AGAYYGANGWNPAGIAALVLGFLVYFVLAHVFKDVAEQITASFPAILVSGLAYWLLAK
                     KPVAALDSGLERDA"
     CDS             complement(445937..446956)
                     /codon_start=1
                     /locus_tag="KF707C_4040"
                     /note="AraC family"
                     /product="transcriptional regulator"
                     /protein_id="BAU72092.1"
                     /transl_table=11
                     /translation="MAVATPAAPSVSPTPAPSRVAGIKTYGFLLIPNFTTIGFASAIE
                     TLRMANLAAKRTLFRTLLIAADHGPVQASNGMRVVPDHDIEDAPPLDALFVVGSNPIP
                     ARYDRRLLNWVRRLSQQHVALGGICTGSHLLASAELLKGYRCTVHWEDIEQLKERFPG
                     IVISNQLFELDRDRYTCSGGTASLDMTLQLIAREPGGVEIATQAAELLLCDRMRGARE
                     QQRIPLRQRLGHAQPKLSQIVAIMEANLEEPLELEELAQLNEVSVRQLERLFHKYLDR
                     TPSQYYLELRLNRARDLLLRSESQVRDIALACGFASPAHFSKCYSRFFGHSPRGERKQ
                     SPLHD"
     CDS             447370..448623
                     /codon_start=1
                     /EC_number="2.1.2.1"
                     /locus_tag="KF707C_4050"
                     /product="serine hydroxymethyltransferase"
                     /protein_id="BAU72093.1"
                     /transl_table=11
                     /translation="MFSKQDQIQGYDDELFSAMQEEERRQEDHIELIASENYTSKRVM
                     EAQGSGLTNKYAEGYPGKRYYGGCEFVDKVEQLAIDRAKQLFGADYANVQPHSGSQAN
                     SAVYLALLNAGDTILGMSLAHGGHLTHGAKVSSSGKLYNAVQYGLDTATGLIDYDEVE
                     RLALEHKPNMIVAGFSAYSKTLDFPRFRAIADKVGALLFVDMAHVAGLVAAGLYPNPL
                     PYADVVTTTTHKTLRGPRGGLILARKNDEIEKKLNSAVFPGAQGGPLMHVIAAKAVCF
                     KEALEPGFKEYQAQVIKNAQAMAKVFIDRGYDVVSGGTDNHLFLVSLIKQGLTGKDAD
                     AALGRAGITVNKNAVPNDPQSPFVTSGVRIGTPAITSRGFKESQSTELAGWICDILDH
                     LGDADVEAQVAKQVAGLCADFPVYR"
     CDS             448639..449889
                     /codon_start=1
                     /EC_number="1.5.3.1"
                     /locus_tag="KF707C_4060"
                     /product="sarcosine oxidase beta subunit"
                     /protein_id="BAU72094.1"
                     /transl_table=11
                     /translation="MQRYSGFGLFKHSLSHHENWQRMWRNPTPKPVYDVIIVGGGGHG
                     LATAYYLAKEFGVKNVAVVEKGWLGGGNTARNTTIVRSNYLWDEAAQLYEHAMKLWEG
                     LSHDLNYNVMFSQRGVYNLCHTLQDMRDSARRVNANRLNGVDGELLDAKQVAEEIPYL
                     DCSKNTRYPIMGSTVQRRGGVARHDAVAWGYARAADALGVDLLQNTEVLGFRKQDGAV
                     IGVETNRGFIGAKRVGVVTAGNSGHMAKQAGFRLPLESHPLQALVSEPIKPIIHSVIM
                     SNAVHGYISQSDKGDLVIGAGIDGYNGYGQRGSYGTIEHTLQAIVEMFPILSRVRMNR
                     QWGGIVDTTPDACPIISKTPVKNLFFNCGWGTGGFKATPGSGHVFAASLARGEMHPLA
                     KPFSIDRFHTGALIDEHGAAAVAH"
     CDS             449901..450227
                     /codon_start=1
                     /EC_number="1.5.3.1"
                     /locus_tag="KF707C_4070"
                     /product="sarcosine oxidase delta subunit"
                     /protein_id="BAU72095.1"
                     /transl_table=11
                     /translation="MLHIFCPYCGELRSEEEFHAKGQAHIPRPLDPNACTDEEWGDYI
                     FFRDNPRGIHHELWVHAAGCRKYFNVTRHTISYEILETYKIGEKPSVTESTTGEKKTA
                     SAGVTA"
     CDS             450224..453244
                     /codon_start=1
                     /EC_number="1.5.3.1"
                     /locus_tag="KF707C_4080"
                     /product="sarcosine oxidase alpha subunit"
                     /protein_id="BAU72096.1"
                     /transl_table=11
                     /translation="MSQVNRLPKGGRIDRSQPLTFTFNGQNYQGYNGDSLAAALLANG
                     VDIVGRSFKYSRPRGIVAAGAEEPNAILQLGAAENAQVPNIRATQQALYAGLVATSTN
                     GWPSVNNDVMGILGKVGGGMMPPGFYYKTFMYPQNLWLTYEKYIRKAAGLGRSPLEVD
                     PDIYDHMNQYCDVLVVGSGPAGLAAALAAGRSGARVILADEQEEFGGSLLDTRETLDG
                     KPASEWVAKVIAELETLPEVTLLPRATVNGYHDHNFLTIHQRLTDHLGEVAPRGQARH
                     RVHRVRAKRVVLAAGAHERPLVYANNDVPGNMLAGAVSTYVNRYGVAPGRQLVLSTNN
                     DYAYRVVLDWLDAGQQVVAVADARSNPRGTWVEEARARGVRILTGSAVVEARGSKRVS
                     GARICAIDVKGHRVTSPGEVVDCDLIVSSGGYSPVVHLASHLGGKPVWREDILAFVPS
                     EGGFQQRHCAGAVNGVFALGDVLADGFEAGAKAAAEAGFKAIEGTVPKTEKRKEEATL
                     ALFQVPHDKSTARAPKQFVDLQNDVTAAGIELATREGFESVEHVKRYTALGFGTDQGK
                     LGNINGLAIAARSMGISIAEMGTTMFRPNYTPVTFGAVAGRHCGNLFDPKRYTAMHSW
                     HLKQGAEFEDVGQWKRPWYFPKRGEDLHAAVARECKAVRDSVGILDASTLGKIDIQGP
                     DAREFLNRVYTNAWTKLDVGKARYGLMCKEDGMVFDDGVTACVGENHFIMTTTTGGAA
                     RVMEWLEIYHQTEWPELKVYFTSVTDHWATMTLSGPNSRKLLSEVTDIDLDKDAFPFM
                     TWKEGLVGGVPARVFRISFTGELSYEVNVQADYALGVWEQIVEAGKKYNLTPYGTETM
                     HVLRAEKGFIIVGQDTDGSVTPDDLNMGWCVGRNKPFSWIGWRGMNREDCLREDRKQL
                     VGLKPLDPNQVLPEGAQLVFDPKQSIPMKMVGHVTSSYMSPSLGHSFAMAVVKGGLKR
                     MGERVFAPLADGSVIEAEICSSVFYDPKGDRQNV"
     CDS             453237..453866
                     /codon_start=1
                     /EC_number="1.5.3.1"
                     /locus_tag="KF707C_4090"
                     /product="sarcosine oxidase gamma subunit"
                     /protein_id="BAU72097.1"
                     /transl_table=11
                     /translation="MSNVNVYKQRPDKARAESPLYHAGLDELARKGKSNAGVILREKK
                     LLGHLVIRGDASDPAFAGGVHKALGLELPVALTLVANGDSSLQWLGPDEWLLVVPGGT
                     EYEVEQRLRAALEGQHISVVNVSGGQTLLELSGPHARDVLMKSTVYDVHPSNFPVGKA
                     VGTTFAKAGAVIRHTGEDTWELVIRRSFSDYLWLWLQDASAEYGLAVKA"
     CDS             453995..454858
                     /codon_start=1
                     /EC_number="3.5.1.10"
                     /locus_tag="KF707C_4100"
                     /product="formyltetrahydrofolate deformylase"
                     /protein_id="BAU72098.1"
                     /transl_table=11
                     /translation="MSRTPDTWILTAHCPSVLGTVDAVTRFLFEQRCYVTEHHSFDDR
                     LASRFFIRVEFRQPDGFDEQAFRAGLDERLAPFDMQLELTPPGYRAKVVIMVSKADHC
                     LNDLLYRQRIGQLAMDVVAVVSNHPDLEPLARWHGIPYHHFPLDPNDKPAQERRVLQV
                     IEETGAELVVLARYMQVLSPELCRKLDGWAINIHHSLLPGFKGAKPYHQAYQKGVKLV
                     GATAHYINNDLDEGPIIAQGVEPVDHAHYPEDLIAKGRDIECLTLAKAVGYHIERRVF
                     LNANRTVVLNA"
     CDS             455120..456319
                     /codon_start=1
                     /locus_tag="KF707C_4110"
                     /product="threonine dehydrogenase and related
                     Zn-dependent dehydrogenases"
                     /protein_id="BAU72099.1"
                     /transl_table=11
                     /translation="MSGNRGVVYLGAGKVEVQKIDYPKMQDPRGKKIEHGVILKVVST
                     NICGSDQHMVRGRTTAQVGLVLGHEITGEVIEKGRDVENLQIGDLVSVPFNVACGRCR
                     SCKEQHTGVCLTVNPARAGGAYGYVDMGDWTGGQAEYVLVPYADFNLLKLPNRDKAME
                     KIRDLTCLSDILPTGYHGAVTAGVGPGSTVYVAGAGPVGLAAAASARLLGAAVVIVGD
                     LNPARLAHAKAQGFEIADLSLDTPLHEQVAALLGEPEVDCAIDCVGFEARGHGHEGAK
                     HEAPATVLNSLMQITRVAGKIGIPGLYVTEDPGAVDAAAKIGSLSIRFGLGWAKSHSF
                     HTGQTPVMKYNRALMQAIMWDRINIAEVVGVQVISLDDAPRGYGEFDAGVPKKFVIDP
                     HKTFSAA"
     CDS             456535..457182
                     /codon_start=1
                     /locus_tag="KF707C_4120"
                     /product="hypothetical protein"
                     /protein_id="BAU72100.1"
                     /transl_table=11
                     /translation="MHSPRSLTLAVLLSLAASPVFAVSLGDVVAAAAATGGEGATAQT
                     PGVTAAESAALLQQLGGELQITPEQALGGAAALFGLARNNLPAEQFAQLDQAVPGVGV
                     LTDPNTQGLLSSIGGLLGQQAGGAEGPGGAAGVLAGQPMNSMTDVSQAFGSLGMDNGL
                     IARFAPLILSFLGQQGLAESLLQNLGNLWKWTTPPVPSSPAIPAGQAVPVNGLST"
     CDS             complement(457186..458085)
                     /codon_start=1
                     /locus_tag="KF707C_4130"
                     /product="acyltransferase family protein"
                     /protein_id="BAU72101.1"
                     /transl_table=11
                     /translation="MRALLTGSATTLLLLLNTLTLIGPMLVIALLKLVLPGQSLKDTC
                     SRGVMWIAEAWAENCKRVFALLTPTHWDIRGGEGLRQDTSYLVISNHQSWVDIPALVQ
                     AFNRKAPYFKFFLKKELIWVPFLGLAFWALDYPFMKRYSKAFLEKHPEMKGKDLAITR
                     AACEKFKRLPVTVVNYLEGTRFTPAKHAAQQSPYRFLLKPKAGGVAFVLASLGEQLDA
                     VLDVTLVYPGQAVPGFWALLSGQVPWVTVDIRTRELDPALWQGDYENDGVFRQYVQGW
                     VSDLWREKDARIAELRAELGQDR"
     CDS             458392..458904
                     /codon_start=1
                     /locus_tag="KF707C_4140"
                     /product="ribosomal protein S6 glutaminyl transferase"
                     /protein_id="BAU72102.1"
                     /transl_table=11
                     /translation="MKALIALLALVALPALANQEPALYGRYEYVKLPEIGQTLKAKMD
                     TGALTASLSARDIELFKRDGEEWVRFRLATKDADDTLYEHRLARISKIKNRADELADE
                     DEAPSAEISRRPVVDLEMCLGGTRRTVEVNLTDRSSFNYPLLIGAKALKEFKAAIYAG
                     HKFTAGKPQC"
     CDS             458938..459627
                     /codon_start=1
                     /locus_tag="KF707C_4150"
                     /product="two-component response regulator CreB"
                     /protein_id="BAU72103.1"
                     /transl_table=11
                     /translation="MPHILIVEDEAAIADTLVYALEADGNATTWLSLGGAALDLLRRE
                     PVDLVILDVGLPDTSGFELCKALRRFSEVPVLFLTARNAEIDRVVGLEIGADDYVVKP
                     FSPREVAARVRAILKRTAPRERQVPVAAATGPFRVDLERVRIHYHGQALVLTRHEFRL
                     LQALLAQPERVFSREQLLDALGLASDVGYERNIDSHIKSLRAKLRQVAPAAEAIQTHR
                     GLGYSYSPERA"
     CDS             459627..461057
                     /codon_start=1
                     /locus_tag="KF707C_4160"
                     /product="two-component response regulator CreC"
                     /protein_id="BAU72104.1"
                     /transl_table=11
                     /translation="MPLGVRIFLAYFLFVGLAGWFVLGTVMDEIRPGVRQSTEETLVD
                     TANLLAEILRDPVRDGTLADSRLPELLEAYGERQPGADIWGLRKMQVNHRIYVTDARG
                     IVLLDSSGVALGQDYSRWNDVYLTLRGEYGARSTREDPEDPDSSVMYVAAPIRDGQRI
                     IGVVSVAKPNASLQPYIERSQRRLAWLGAGLIGLGLLVGGLLSWWLSRSLLRLRDYAQ
                     AVSEGRRAELPAMSGGELRDLASALERMRTQLEGKAYVERYVHTLTHELKSPLAAIRG
                     AAELLEGEMPVEQRRRFVANIGNEGARLQQLVERLLNLAQVEQRQGLEERVPVPLRAL
                     AETQLAAQAVRIEAAGLRVENRIAPELCALGERFLLSQALANLLDNALDFTPTGGRLR
                     LEARHDGAWLELALFNQGEPIPAFALPRLTERFYSLPRPATGRKSTGLGLNFVQEVAA
                     LHGGELRVLNREDGVEACLRLPSVAD"
     CDS             461244..461678
                     /codon_start=1
                     /locus_tag="KF707C_4170"
                     /product="CBS domain protein"
                     /protein_id="BAU72105.1"
                     /transl_table=11
                     /translation="MKTVAEILRAKSHTQLFSVEPTTTVLEAALMMADKDIGALVVMQ
                     GGELVGIVTERDFVRRVAALERSAYGTTIEEIMTSNLFVVTPRDSNQYCMQLMTEKNL
                     RHLPVLQDGKLVGLLSIRDLVRDITAEQESLIQHLEQYIRGA"
     CDS             461846..463210
                     /codon_start=1
                     /locus_tag="KF707C_4180"
                     /product="inner membrane protein CreD"
                     /protein_id="BAU72106.1"
                     /transl_table=11
                     /translation="MTRTLGFKLGTIALLILLLMIPLALIGGLIGERQAARDSVLANI
                     AQSSSHAQRITGPLLVVPYTRTLREWKTYEQTGQRHLEEREVRGRLYFLPERFELTGH
                     VDTELRARGIYKARLFKSDSQVSGQILVPAHYGIDQDLADYRFESPFLAVGISDIRGI
                     GNALKLRVNGRTLDFQPGSGDRLLEGGVHVPLASLQAAVPQRLDIGFDLKLQGTSSLT
                     VVPVGRDSRVALTSSWPHPSFIGDFLPGERSIDGKGFSASWQTSFFATNLQEALDSCV
                     GEGECHGFQSRAFGVSFVDPVDQYLKTDRAIKYALLFLALTFAGFFLMEVLKRLAVHP
                     VQYGLVGLALAFFYLLLLSLSEHLEFALAYALSAGACVALVGFYVSHVLRSWVRGAGF
                     TAGLAALYGMLYGLLSAEDYALLMGSLLVFGLLACVMVLTRKLDWYGVGRTPSSPASE
                     AVCS"
     CDS             complement(463384..464007)
                     /codon_start=1
                     /locus_tag="KF707C_4190"
                     /product="glutathione S-transferase family protein"
                     /protein_id="BAU72107.1"
                     /transl_table=11
                     /translation="MSESPILFHSPTSPYVRKVMVLLHETDQLASVTLHGVTLTPVNP
                     SAEVNQHNPAGKIPALRLDDGSVLHDSRVILDYFDHQHGGEPLIPRDGATRWRRLTLA
                     SLADAVLDAAILVRYETFLRPEDKRWDDWVLGQCSKIDRALESFEAAADELDERFDVA
                     AISAVCALGYLDFRMPGLNWRRDCPKLAAWYASASQRPSVRATAPTA"
     CDS             complement(464141..464845)
                     /codon_start=1
                     /EC_number="2.7.7.7"
                     /locus_tag="KF707C_4200"
                     /product="DNA polymerase III epsilon subunit"
                     /protein_id="BAU72108.1"
                     /transl_table=11
                     /translation="MNTFPWFTRRKSLPPDLAARRDRLPAPQALDARPLREQRFVVLD
                     LETSGLNMSRDLVLSIGAVTLEDGAIDLGNQFECTLQRDTGKLSASVLIHGIAPSELA
                     AGVEPAEALMSFMEFLGDSPLLAFHATFDQRMLGRALKQDLDHRLRHVFLDVAELAPM
                     LCPEAGIRNGGLDDWVEHFGLQVQQRHNAAADALVTAEIALILFSRARRQGLHTPADL
                     ASALARWQRRQHAPAL"
     CDS             complement(464842..466776)
                     /codon_start=1
                     /locus_tag="KF707C_4210"
                     /product="predicted signal-transduction protein
                     containing cAMP-binding and CBS domains"
                     /protein_id="BAU72109.1"
                     /transl_table=11
                     /translation="MNKADAFAQAGKQAVMQNVHGTMGFLQKYPPFNQMESAHLAFLV
                     EHCLLRFYAAGESIIKPQDGPVEHFYIVKQGRVVGERPHSARRGTETTFEIASGECFP
                     LAALLGERATRTEHLAGEDSFCLLLGKAAFVKLFALSNPFRDFALRGVSSLLDQVNQQ
                     VQLRAVETLGAQYSLDSRLEELAVRQPIACPPHLPLRDAVRLMHEQQVGSIVIVDPGH
                     RPLGIFTLRDLRRVIADASADLAQPIADLMTQAPFHLPPGASAFDAALAMTERHIAHV
                     CVVEGERLVGVVSERDLFSLQRVDLVHLARTIRHAGRVETLAALRSEIQRLVDNMLAH
                     GASSTQITRIITLLNDHTVCRVIELTLEALGDPGVPFTWLCFGSEGRCEQTLHTDQDN
                     GILFEARDAVEAAALRGRLLPLAERINQGLAQCGFELCKGGIMAGNPELCLSRAEWSR
                     RFAGFVREASPENLLGSSIYFDLRAVWGPVEGCEALQRELLALVADNSLFQRMMAENA
                     LRQRPPVGRFRDFVVARKGAEKDTLDLKVQGLTPFVDGARLLALAHGISACNTLERLR
                     QLMEQGVVDVQDGAAYEEAYHFIQLIRMQQHQHQARQGLPYSNRLDPDTLNHLDRRIL
                     RESFRQAQRLQSSLALRYQL"
     CDS             467022..467549
                     /codon_start=1
                     /locus_tag="KF707C_4220"
                     /product="response regulator receiver modulated
                     diguanylate cyclase"
                     /protein_id="BAU72110.1"
                     /transl_table=11
                     /translation="MSYGDLLSEDELRALEEIMRVPSAPPSVLLVDDDEVARDALADE
                     LVAQGIPCITAESGEQALALLVTRPTIGLLITELHMQCGSGLELVRQVRQSAQPSLPV
                     IIISGDADVQDAIEAMHMRVVDFLLKPVDTSRLVNLARNELGTPPAPKAPPARVRPRP
                     EKPKAKAKVVTLKSA"
     CDS             complement(467608..469128)
                     /codon_start=1
                     /locus_tag="KF707C_4230"
                     /product="hydantoin permease"
                     /protein_id="BAU72111.1"
                     /transl_table=11
                     /translation="MALTPITGVTPLDPPTDAATNVAPASLSPRLYSTDLAPTRQAGR
                     RWGRYSLFALWTNDVHNIANYSFAIGLFALGMSGAQILSALALGALLIYGLMNLSGYM
                     GQKTGLPFPVMCRIAFGIHGAQLPALVRAVIAIAWFGIQTYLASVVLRVLLTAVFPGL
                     AAYDQDSLLGLSSLGWITFLAIWCVQLLIFAYGMEMVRRYESFAGPVILVTVAALAAW
                     MYWRAGLDIAWSTGSQASASEMWLKVFSGAALWVSLYGTMILNFCDFARNCPDKRTIS
                     QGNFWGLPVNMLLFGLIAVVLAGAQFSIDGRLIQSPTDIVAALPETGFLVLGCLAFLI
                     VTVAVNIMANFVAPAYVLTNLAPRTLNFRSAGLLSATIAVVILPWHLYNSPGVILYFL
                     GGLGALLGPLYGIIIVDYYLVRRARLNLPELYSESREAAYHYRGGVNLRALAAFIPAA
                     AIAALLALLPAFESLSPFSWFFGAGLAGLIHFALADRQANYLEVSGETIAVDSTGH"
     CDS             complement(469468..471645)
                     /codon_start=1
                     /EC_number="2.3.3.9"
                     /locus_tag="KF707C_4240"
                     /product="malate synthase G"
                     /protein_id="BAU72112.1"
                     /transl_table=11
                     /translation="MTERVQVGGLQVARVLFDFVNNEAIPGTGIAAETFWAGVEAVIN
                     DLAPKNKALLAKRDELQAKIDAWHQARAGQAHDAVAYKAFLQEIGYLLPEPADFQATT
                     QNVDEEIATMAGPQLVVPVMNARFALNAANARWGSLYDALYGTDAISEEGGAEKGKGY
                     NKVRGDKVIAFARAFLDEAAPLEGASHVDATAYAVKNGQLAVTLKNGSEAGLKNAAQF
                     IAFQGDAAKPQAVLLKHNGLHFEIQIDPTSPIGQTDAAGVKDVLMESALTTIMDCEDS
                     VAAVDADDKVVVYRNWLGLMKGDLSEEVSKGGQTFTRTMNPDRVYTRADGSELTLHGR
                     SLLFVRNVGHLMTNPAILDAAGNEVPEGIQDALFTGLIALHNLKGNTSRKNTRTGSMY
                     VVKPKMHGPEEVAFATEIFSRVEDVLGMPRNTMKVGIMDEERRTTVNLKACIKAAAER
                     VVFINTGFLDRTGDEIHTSMEAGAMVRKGAMKSEKWIGAYENNNVDVGLATGLQGKAQ
                     IGKGMWAMPDLMAAMLEQKIGHPMAGANTAWVPSPTAATLHALHYHKVDVFARQAELA
                     KRTPASVDDILTLPLAPSTDWSAEEIQNELDNNAQGILGYVVRWIDQGVGCSKVPDIN
                     DVGLMEDRATLRISSQLLANWLRHGVVTREQIVESLERMAAVVDRQNASDPLYRPMAP
                     NFADNVAFQAALELVIEGTRQPNGYTEPVLHRRRREFKAKNGL"
     CDS             471947..472393
                     /codon_start=1
                     /locus_tag="KF707C_4250"
                     /product="probable acetyltransferase"
                     /protein_id="BAU72113.1"
                     /transl_table=11
                     /translation="MPVHAATLQDLDDLTRLFAGYLDFYEVPRPLQEIRGFLQDRLDR
                     GDSRLFIARDAEGRARGFTQLYPFISSLALAPAWLLSDLYVVPAARRQGVGEELMNAA
                     RALAERTGACGIQLETAKTNLAGQALYERLGYKRDELFHTYWLSLA"
     CDS             472429..472947
                     /codon_start=1
                     /locus_tag="KF707C_4260"
                     /product="ACT domain protein"
                     /protein_id="BAU72114.1"
                     /transl_table=11
                     /translation="MDHLVLTVIAADQPGLVERIAQCIAAHGGNWLESRMSRMAGQFA
                     GILRVAVPAEGYDELVEGLQGLSAQGIRVMLAQSGIDPACTWKPIRLELVGNDRPGIV
                     RDITRLLAELGVNLESLVTEVKPAPMSSEPLFHADAVLAVPLTLSLDTLQAKLETLAD
                     DLMVELDLHQEK"
     CDS             complement(472989..473876)
                     /codon_start=1
                     /locus_tag="KF707C_4270"
                     /product="protein rarD"
                     /protein_id="BAU72115.1"
                     /transl_table=11
                     /translation="MATADPRRGYILGLSAYIIWGLFPLYFKAIQSVPALEIIVHRAL
                     WSALFGAALLLVWKHPGWFRELRENPRRFGVLAASGLLIAGNWLVYVWAVNNGRMLEA
                     SLGYYINPLVNVLLGMLILGERLRRLQWVAVLLATIGVAQQIWQVGALPWVSLTLALT
                     FGFYGLIRKQAPVAALPGLVVETWLLLPLAIGWLLLHPAAASTQAGFWSSPEALWLAA
                     AGPITLVPLVCFNAAARHLPYTTLGFLQYLAPTLVMLQAIFLFGEHFDPSKLLAFSFI
                     WAGLAVYSVDIWLHLRRAA"
     CDS             complement(474027..475001)
                     /codon_start=1
                     /locus_tag="KF707C_4280"
                     /note="required for LPS synthesis"
                     /product="YihE protein"
                     /protein_id="BAU72116.1"
                     /transl_table=11
                     /translation="MSHPFDDLTPDLVLDAVESLGYLSDARILALNSYENRVYQVGIE
                     DSEPLIAKFYRPQRWSDAAIREEHAFSAELADCEVPVVAPLVRGGESLFEHAGFRFAL
                     FPRRGGRAPEPGNLDQLYRLGQLLGRLHAVGATRPFQHRETLAVDNFGHQSLATLLDG
                     GFIPRSLLPAYESVARDLLKRLDRLFAEVRYQPIRLHGDCHPGNLLCRDEVFHVVDLD
                     DCRMGPAVQDLWMMLAGERQERLGQLSEMMDGYQEFHDFDPRELPLIEGLRALRLMHH
                     SAWIARRWDDPAFPMHFSWFGSERYWGDQILTLREQLAALDEAPLQLF"
     CDS             complement(475103..475867)
                     /codon_start=1
                     /locus_tag="KF707C_4290"
                     /note="Molybdate-binding domain of ModE"
                     /product="DNA-binding domain of ModE"
                     /protein_id="BAU72117.1"
                     /transl_table=11
                     /translation="MSLTSALTQQLSRRPQRLALLEQIAVQGSITRAAKAAGLSYKAA
                     WDAIDELNNLAERPLVERTVGGKGGGGARLSAEGERILALYKRLESLQARLLECAESE
                     HDLELLGRLMLRTSARNQLSGRVLDIVAQGRNDLVNVELSGGGRIQAQITHDSTEKLE
                     LVPGQAVVALIKAGWLRLQSISATPDEQVNQLQGRVEEILEAEDGPCEVRIGLPSGQT
                     LCALVEGERLARLDLKVGEPVRAQFAPGQVLLGTAL"
     CDS             complement(475931..476659)
                     /codon_start=1
                     /locus_tag="KF707C_4300"
                     /note="phosphoribosyltransferase domain; protein YhgH
                     required for utilization of DNA as sole source of carbon
                     and energy"
                     /product="competence protein F homolog"
                     /protein_id="BAU72118.1"
                     /transl_table=11
                     /translation="MHTLLARLRPAWLRHTPDCLLCGAPGSELPICTGCEADLPWLTG
                     QCSLCALPLPSLGLPCGACLKRPPSFDRVVAPWRYDFPVDSLITRFKHQGRWPLGRLL
                     GELLARHLAHGFDDGLPRPDALLPVPLAAPRLRQRGFNQAGMLAGWLARELDIPVEPD
                     GLKRHRDGPPQQGLDAVTRRRNLRDAFSLDTRARVHGRHLALVDDVLTTGTTAQVLAR
                     LLKGAGATRVDIYCLARTPRPGDG"
     CDS             complement(476691..476984)
                     /codon_start=1
                     /locus_tag="KF707C_4310"
                     /product="permease of the major facilitator superfamily"
                     /protein_id="BAU72119.1"
                     /transl_table=11
                     /translation="MGTEGVFEWLGRMIGTAIRFVVDLLSGLLGGISQAIDDFLNGLA
                     RAIGMDVSIFSLILLIIGLLLLYSGIRAFLRKSIIGGLVLTFFGLVVMSWLIT"
     CDS             477213..478271
                     /codon_start=1
                     /EC_number="2.8.1.6"
                     /locus_tag="KF707C_4320"
                     /product="biotin synthase"
                     /protein_id="BAU72120.1"
                     /transl_table=11
                     /translation="MSATASIATRHDWSLAEVKALFEQPFNDLLFQAQTVHRAHFDPN
                     RVQVSTLLSIKTGACPEDCKYCPQSGHYNTGLDKEKLMEVQKVLEAAAEAKAIGSTRF
                     CMGAAWKHPSAKDMPYVLEMVKGVKKLGLETCMTLGRLDQEQTQALAEAGLDYYNHNL
                     DTSPEFYGNIITTRTYSERLQTLAYVREAGMKICSGGILGMGESVDDRAGLLIQLANL
                     PEHPESVPINMLVKVKGTPLAEEKDVDPFDFIRTLAVARIMMPKSHVRLSAGREQMNE
                     QMQALAFMAGANSIFYGEKLLTTANPQAEKDMQLFARLGIKPEEREEHADEVHQAAIE
                     QALVEQRDSQLFYDAASA"
     CDS             478374..479555
                     /codon_start=1
                     /EC_number="2.3.1.47"
                     /locus_tag="KF707C_4330"
                     /product="8-amino-7-oxononanoate synthase"
                     /protein_id="BAU72121.1"
                     /transl_table=11
                     /translation="MPFDLASRLAARQEENLYRQRPLLESPQGPEVRVDGRPMLAFCS
                     NDYLGLANHPEVKAAFIRGVERWGAGGGASHLVIGHSGPHHDLELALAEFTGRPRALL
                     FSTGYMANLGAVTALVGKGDTVLEDRLNHASLLDAGLLSGARFSRYLHNDADSLASRL
                     ERAEGDTLVVTDGVFSMDGDLADLPALCAAARARGAWVMVDDAHGFGPLGTNGGGIVE
                     HFGLGLEDVPVLVGTLGKGFGTAGAFVAGSEELIETLIQFARPYIYTTSQPPAVACAT
                     LKSLELLQRERWRREHLEKLIQRFRQGAAEIGLTLMDSPTPIQPILVGDSARALKLSA
                     LLRERGLLVGAIRPPTVPAGSARLRVTLSAAHSEEQLESLLNALADGWATLAKEEVPD
                     A"
     CDS             479548..480273
                     /codon_start=1
                     /locus_tag="KF707C_4340"
                     /product="biotin synthesis protein BioH"
                     /protein_id="BAU72122.1"
                     /transl_table=11
                     /translation="MRERLILLPGWAIGPGALEPLRDALLERAPHLMVEIEPLPALEQ
                     SGAWLDELDARLPRDSWLAGWSLGGMLAAQLAARRGDACRGLIGLCSNLSFRQRDDWP
                     QAMSQEVFTAFHEACRLDPALTLKRFSLLVAQGARDARTLARQLQVTQLATEPRVLDA
                     GLRLLDVLDIRAAVEGFAGPQLYLFAGRDALVPAGTAEALLEWLPDLETSLFPEASHG
                     LPLECPEAVADVILDFMREGEDV"
     CDS             480275..481072
                     /codon_start=1
                     /locus_tag="KF707C_4350"
                     /product="biotin synthesis protein BioC"
                     /protein_id="BAU72123.1"
                     /transl_table=11
                     /translation="MVSDTGSLPDKRQVAASFSRAADSYDSVAALQRAVGNALLRHLP
                     GDFAPEDWLDLGSGTGYFSRALAERFPDSDGLALDIAEGMLRHARPLGGASRFVAGDA
                     ERLPLVCDARSLIFSSLAVQWCADFAAVLAEARRVLKPGGVFAFSSLCVGTLQELRDS
                     WQAVDGFVHVNRFRRLEDYQRLCADSGLATLELATRPEVLYYPDLRTLTHELKALGAH
                     NLNPGRPGGLTGRARILALVEAYERFRQPQGLPATYQVVYGVLKKEV"
     CDS             481074..481760
                     /codon_start=1
                     /EC_number="6.3.3.3"
                     /locus_tag="KF707C_4360"
                     /product="dethiobiotin synthetase"
                     /protein_id="BAU72124.1"
                     /transl_table=11
                     /translation="MARAYFVTGTDTEIGKTTIAAGLLRAARRQGLSTAAAKPVASGC
                     DQTPDGLRNSDALALLEECSLPFRYEEVNPLAFAPAIAPHLAAREAGVDLSVAALAAP
                     VRQVLAKGADFTLVEGAGGWRVPLAGAETLSDLPIALGLPVVLVVGVRLGCINHALLT
                     VEAILRDGLVLAGWVANVVDPATSRLEENLATLAERLPAPCLGRVPRLAEATPEAVAD
                     HLDLAALVGE"
     CDS             481823..482068
                     /codon_start=1
                     /locus_tag="KF707C_4370"
                     /product="hypothetical protein"
                     /protein_id="BAU72125.1"
                     /transl_table=11
                     /translation="MEIQGSGFSAGLGAIQSGQRIIEKAASEIAGNTVAGAEAQPPAD
                     LTSVLLALEAGKVQAEAGSMVAKATDQMIGSLIDTFA"
     CDS             482363..484168
                     /codon_start=1
                     /EC_number="1.3.99.3"
                     /locus_tag="KF707C_4380"
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="BAU72126.1"
                     /transl_table=11
                     /translation="MPDYKAPLRDIRFVRDELLGYEAHYQSLPGCQDATPDMVDAILE
                     EGAKFCEQVIAPLNRVGDTEGCTWSAEGVKTPTGFKEAYKQFVEGGWPSLAHSVDHGG
                     QGLPESLGLAISEMVGEANWAWGMYPGLSHGAMNTIEQHGTDEQKHTYLTKLVSGEWT
                     GTMCLTEPHCGTDLGMLRTKAEPQADGTYKVSGTKIFISAGEHDMADNIVHIVLARLP
                     DAPAGTKGISLFIVPKFMPTAEGGIGERNAVSCGSIEHKMGIHGNATCVMNFDGATGF
                     LIGAPNKGLNCMFTFMNTARLGTALQGLAHAEIGFQGGIKYARERLQMRSLTGPKAPE
                     KAADPIIVHPDVRRMLLTMKAFAEGNRAMVYFTAKQVDIVKYSQDEEEKKAADSLLAF
                     LTPIAKAFMTEVGFEAASHGMQIYGGHGFISEWGMEQNLRDCRISMMYEGTTGVQALD
                     LLGRKVLMTQGEALKGFTKIVHKFCQANEANESVKELVEPLAKLNKEWGEITMKVGMA
                     AMKDREEVGAASVDYLMYSGYACLAYFWADMARLAAEKLAAGEGDAAFYKAKLQTARF
                     YFKRILPRTRTHVETMLSGAGNLMDLAEEDFALGY"
     CDS             484337..485629
                     /codon_start=1
                     /locus_tag="KF707C_4390"
                     /product="GGDEF domain protein"
                     /protein_id="BAU72127.1"
                     /transl_table=11
                     /translation="MRPRASYRPSHFLPPALLVASGAVVGSLSVLNEFFTSLFNVLPT
                     LLLLLGGAFCSVYGRVRQVALLLVVYLAYYLLDTQVDHFQVQGVVREDAGLVFHLSSL
                     LLPLLYGLHGCWEERTHLARDLVARCAVLVAVLGVVLALGSRFPDGMLGAVGSVYWPL
                     LHGDWMNLVQLAYLAFLLALVALLVTYLRHPRPQHGAQLLGLCGLAWMLPKVFILPHA
                     LHVMSSMVMLALTASVAHEAYQMAFRDELTGLPGRRALNERLRRLGRNYVLAMTDVDH
                     FKKFNDTYGHDVGDQVLRLVASRLRKVGGGGKAYRYGGEEFTILFSGKTMEECLPHLE
                     AVRQAIEAYQIRLRDPDNRPRNDDAGRARRGASAGQAVSVTISIGAAERDALQRTPDE
                     VIKAADQALYSAKSAGRNRVFRHGENRRGAVRIRDVAG"
     CDS             485730..487523
                     /codon_start=1
                     /EC_number="1.3.99.3"
                     /locus_tag="KF707C_4400"
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="BAU72128.1"
                     /transl_table=11
                     /translation="MPEYKAPLRDIRFLTDEVFDYPASYAALGASDASPDMVAAILEE
                     GAKFCEQVLSPLNRSGDEEECQWHDGVVTTPKGFKEAFAQYVEGGWNGLSADPAYGGQ
                     GLPLSLGLIVSEMVASANQSWAMYPGLTHGAMSALHAHGSEEQKRTYLTRLTEGRWTG
                     TMCLTEPHCGTDLGIIKTRAVPRADGSYAISGTKIFISAGEHDMSENIVHLVLAKLPD
                     APAGTKGISLFIVPKFLPQGDGIGERNAVSCGSIEHKMGIKASATCVMNFDGATGFLI
                     GEANKGLNCMFTMMNHARLGTGMQGLCLGEASYQGAVRYANDRLQMRALTGPKAPDKA
                     ADPIIVHPDVRRMLLTMKAFNEGNRALAYFTAQQLDIAHAAESAEAREQAENLLAFLT
                     PICKAFMTETGLEATNLGMQVFGGHGYIREWGMEQLVRDCRIAPIYEGTNGIQALDLL
                     GRKVLGSQGKLLRGFTRLVHQFCQAHAGHPRLAAQVAQLERLNQQWGELTQKVGLAAM
                     KNPDEVGAAALDYLMYSGYITLGWLWLRMALVADARVQAGEGDSAYYQTKLATCDFYF
                     KRLLPRTEAHRAAVEAGSDCLMALPAEHFHL"
     CDS             487702..489480
                     /codon_start=1
                     /EC_number="1.3.99.3"
                     /locus_tag="KF707C_4410"
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="BAU72129.1"
                     /transl_table=11
                     /translation="MADYKAPLRDMRFVLNEVFEVAKLWAEMPALAEVVDTDTAAAIL
                     EEAGKVTAGVIAPLNRSGDEEGCQWNDGAVSTPAGFPEAYRTYAEGGWVGVGGDPVFG
                     GMGMPKVISAQVEEMVNSANLSFGLYPMLTAGACLSIKAHASEELKQKYLPNMYAGTW
                     AGSMCLTEPHAGTDLGIIRTKAEPQADGSFKITGTKIFITGGEHDLSENIIHLVLAKL
                     PDAPAGPKGISLFLVPKVLVNDDGSLGEKNSLSCGSIEHKMGIKASATCVMNFDGATG
                     WIVDAPNKGLAAMFTMMNYERLGVGIQGLATGERSYQSAVEYARERIQSRAPTGPVAK
                     DKAADPIIVHPDVRRMLLTMKAFNEGGRAFSSYVALQLDTAKFSEDGAIRKRAEEMVA
                     LLTPVAKAFLTDLGLETTVHGQQVFGGHGFIREWGQEQLVRDCRITQIYEGTNGIQAL
                     DLAGRKVVGSGGAFYKHFADEMKAFANGASAELAEFTEPLKAAIANLDDLTAWLLDRA
                     KTNPNEIGAASVEYLHVFGYTAYAYMWALMARAALGKEDQDAFYASKLGTARFYFARL
                     LPRIHSLTASVKAGSESLFLLDAEQF"
     CDS             complement(489874..490668)
                     /codon_start=1
                     /EC_number="3.5.1.30"
                     /locus_tag="KF707C_4420"
                     /product="5-aminopentanamidase"
                     /protein_id="BAU72130.1"
                     /transl_table=11
                     /translation="MRIALYQCPPLPLDPEANLERLRQRAAEAARRGARLLVTPEMFL
                     SGYSIGLEAVRALAQPHDGDWAGRIAAIAREQGIALLYGYPERDAGGALFNSVQLIDA
                     GGQRLGNYRKTHLFGELDRGMFSAGDDHFPLVELEGWKLGMLICYDVEFPENVRRLAL
                     AGADAVLVPTANMEPFDFVCDVLVRARAFENQCYLAYANYCGAEGEIRYCGLSSVSAP
                     DGSLAAVCGREETLAFADLRRDLLERSRASITYLDDRRSELYGPLA"
     CDS             complement(490683..492365)
                     /codon_start=1
                     /EC_number="1.13.12.2"
                     /locus_tag="KF707C_4430"
                     /product="lysine 2-monooxygenase"
                     /protein_id="BAU72131.1"
                     /transl_table=11
                     /translation="MNNNNRHPADGKKPITIFGPDFPFGFDDWLQHPAGLGSIPAEHH
                     GAEVAIVGAGIAGLVAAYELMKMGLKPVVYEASKMGGRLRSQTFEGTDGIIAELGGMR
                     FPASSTAFYHYVDMLGLETRPFPNPLTPASGSTVIDIEGKTYYAEKLEDLPALFQEVA
                     DAWADALEDGAHFGDIQQAIRDRDVKRLKELWNTLVPLWDDRTFYDFVASSKAFAKLS
                     FHHREVFGQVGFGTGGWDSDFPNSMLEIFRVVMTACDDNQHLIVGGVQQVPMGIWRHA
                     PDKCVHWPAGTSLASLHNGAARPGVKRIVRAADGRLAVTDTWGDTRHYAAVLATCQTW
                     LLTTQIECEESLFSQKMWMALDRTRYMQSSKTFVMVDRPFWKDKHPQTGRDTLSMTLT
                     DRLTRGTYLFDNGDDKPGVICLSYSWMSDALKMLPHPVEKRVKLALDALKKIYPDVDI
                     AGHIIGDPITVSWEADPHFLGAFKGALPGHYRYNQRMYAHFMQEEMPAEQRGIFIAGD
                     DVSWTPAWVEGAVQTSLNAVWGIMKHFGGSTPADNPGPGDLFAELGPIALPD"
     CDS             complement(492732..493202)
                     /codon_start=1
                     /locus_tag="KF707C_4440"
                     /note="AsnC family"
                     /product="transcriptional regulator"
                     /protein_id="BAU72132.1"
                     /transl_table=11
                     /translation="MSELSAAFLDEIDRQLIAALQINARESVATLARRLGIARTTVTS
                     RLARLEKAQVITGYGVRLGQRVADGGLQAYVGITVKPRSGREVLRRLTDMAEVQVLCT
                     VSGEFDYVAWLRADSPERLDELLDLIGGVDGVEKTTTSIILSCKIDRGQPLAPA"
     CDS             493432..494418
                     /codon_start=1
                     /locus_tag="KF707C_4450"
                     /product="fimbrial adhesin"
                     /protein_id="BAU72133.1"
                     /transl_table=11
                     /translation="MNNLKRNTPLSLLLGACLAPFTLSDAWGVECSGTSRTTTFPLPA
                     TLTVPRDAPNGTILYDTKGWQYGGDASVSCTGSGTPTLRYGFAATGGAFPSGLKGVYE
                     TNVPGVGIKVAWHNSRDNLPDSIDGGTLMRNPREEKPIAATDYTPAQLWWIQLIKIGN
                     IGSGTFRLPAVEVYYQNMLSNRLEFPATALNYQRRGCVVKEYRKPVPMGYVYLHDFSG
                     IGSTAKPQEFSFDLVCDPNMRISYEIYGFGGSNSPALWNNPAKGMATGVGVELLDGNG
                     ERVPQWKRLTFGRSGPVTGDLSMPFTARYYQVAEKITPGPMQVPAVLTLFYE"
     CDS             494528..494980
                     /codon_start=1
                     /locus_tag="KF707C_4460"
                     /product="hypothetical protein"
                     /protein_id="BAU72134.1"
                     /transl_table=11
                     /translation="MNALFPPLIALATALACPPLVAETLVPLQGQTQEQIQQDIAACQ
                     SQAGGTSSSSSSSTGGGRVRGAATGAVAGAAVAQSRSNDFDRIDDDLQQEYRQEKAKD
                     AAVAGAVVGGSRQRQERRQDRRTNQQASSTSSSAYMNCMQQRGYQITP"
     CDS             495162..495419
                     /codon_start=1
                     /locus_tag="KF707C_4470"
                     /product="hypothetical protein"
                     /protein_id="BAU72135.1"
                     /transl_table=11
                     /translation="MNRAIATSSALLLALLASGSAFAAKSAEAVPYQYGMPLDVARVI
                     SIDEPNPLTCETVQAKMTYVDAQGERKSVTYLKQSSACANS"
     CDS             complement(495444..496004)
                     /codon_start=1
                     /locus_tag="KF707C_4480"
                     /product="hypothetical protein"
                     /protein_id="BAU72136.1"
                     /transl_table=11
                     /translation="MSIQRTLPRLVGITALFLLAACVQQQHQPPAAPSQPQTQAPAAT
                     PQDPQAAEFERVRQLAQRGDLDAQYQLGSLYFVGKPQKDLKQAEYWWKQAADKGHAQS
                     AFSLAFLYTGRTDPTFANQPAMQRYLSQASAAGNAMAQHVLGSMYAQGAEGFKRDPYQ
                     ARALFQSACDRQYQPSCEALKKLQVN"
     CDS             496121..497041
                     /codon_start=1
                     /locus_tag="KF707C_4490"
                     /note="LysR family"
                     /product="transcriptional regulator"
                     /protein_id="BAU72137.1"
                     /transl_table=11
                     /translation="MKTTLDELLAFTTVVDTGSITAAADQLAQTASGVSRALSRLEDK
                     LDVTLLRRTTRRLELTEEGEAFLVQARRILAQVEEAEEQMALRRQKPAGRLRVNSASP
                     FILHVLVPLVAGFRERYPEIELELHSSEQIIDLIEHRTDLAIRIGTLRDSSLHARSLG
                     CSHLRVLASPAYLDAHGVPDSVEDLARHSLLGFTQPDSLNAWPLRHAQGDSLAIEPSL
                     RASSGETLRQLALAGAGITCLSDFMTQADRANGSLVQLLAEHTVEVRQPIHAVYYRNT
                     ALASRIACFLDHLTECLAREDWVRRSAGCP"
     CDS             497187..498476
                     /codon_start=1
                     /EC_number="1.1.1.-"
                     /locus_tag="KF707C_4500"
                     /product="oxidoreductase"
                     /protein_id="BAU72138.1"
                     /transl_table=11
                     /translation="MFKQSAQHVGTYYARTYPGSIPLRPIQTGGEEADVLIIGAGFSG
                     LHTGLRLAEAGKRVILLEASRVAWAASGRNGGQALLGWSCDMPPLEKALGLERTRRLW
                     DSMRWAADEMRELPGRHGFDVDYRVGSLWTAVMPRRVKLLEEAQHDAIHKWGYDRMRL
                     IGREELPEWIDSPRYQAALYDPEAAHLNPLKLAQGLAAAIEARGGRLYEQSQVLEYRQ
                     TPSGFVARTARGEVRGQVLVLACNAYVDGLDRQLSSRLLPVGSYQVATAPLAPELARS
                     LLPKNSCVIDNQFVPDYFRLTPDHRLLFGGGCTYLGGLPKDVPAATRPYLERVFPQLK
                     GVEIEFGWGGHIDVSMKRTPDIGREGDRYWLQGFSGHGVLPTLAGARAVADAILGDSE
                     LLDLYQAIGNPRFPGGSLLAAPLEAAGKAYYRLRDVI"
     CDS             498530..499087
                     /codon_start=1
                     /locus_tag="KF707C_4510"
                     /note="MerR family"
                     /product="transcriptional regulator"
                     /protein_id="BAU72139.1"
                     /transl_table=11
                     /translation="MDKQDEIEGLAILIRDLRKHKNVTLGDLATRIDRSVGFLSQVER
                     GLSRPTVADLTAISEALGVPTTYFYNPGKPRQTPWVTRPGERRTLYYAGGITDVLASP
                     TMSGGFSMLESHLEPGATSGEGHLDDSSEQGGFVLEGELTIWYGDADPPVTLRANDSF
                     QLPPHAQFRYANLSDQPTRVLWVFN"
     CDS             499113..500468
                     /codon_start=1
                     /locus_tag="KF707C_4520"
                     /product="glutamine synthetase family protein"
                     /protein_id="BAU72140.1"
                     /transl_table=11
                     /translation="MMTTTTRYPDLLSEVRAFRAQYPEVRYVDLICLDIPGHFYGKRY
                     PIDMLEKVAAGSPLKLPQNCVLLGTQGGLYPIGDYCFADGDPDAPRRLVPGTLKPVRW
                     EKEPLGQMLITSDGTEAPIEFEPREVLARVLQRLERRGIRPVVAFELEFYLFDRKLDA
                     GLPRFPRDPLCEDEDDQPNMHIERLSRFSSVLHEMVDAANEQGVAANVITAELGPGQF
                     EINFGHCDDGLQAADWAALFCRSTRGVALKHGLRASFMSKPYLEAPGSGMHVHVSLYD
                     QDGNNLLAAEEQRPLRHAVAGCLELLPHCMPIFAANHNAFRRYGAMVNAASRASWGFE
                     DRDACIRIPESDGRNLRIEHRLAGADANPYLVLAAILTGMEHGLDAAREPIAPLNDDR
                     TSGIDFPKDMLTAVAAMGSHPVVNQGLGSEFVMVYCENKRQEYLDFMNEVSAREYRWY
                     L"
     CDS             complement(500471..501370)
                     /codon_start=1
                     /locus_tag="KF707C_4530"
                     /product="basic proline-rich protein precursor"
                     /protein_id="BAU72141.1"
                     /transl_table=11
                     /translation="MKVRRASARCAQRTLPGIVPRRVRPAHHEPRASARCAQRTLPGV
                     VPRRVRPAHHEPRASARCAQRTLPGIVPRRVRPAHHEPRAKARCAQRTLPGIAPRGVR
                     PAHHEPRASARCAQRTLPGIVPRRVRPAHHESRASARCAQRTLPGIAPRGVRPAHHEP
                     RARARCAQRTLPGVAPRGVRPAHHEPRAKARCAQRTLPGIAPRGVRPAHHEPRASARC
                     AQRTRPGIAPRRVRPAHHESRAKARCAQRTLPGIVPRRVRPAHHESRARARCAQRTLP
                     GIAPRGVRPAHHEPRAKAGNPGR"
     CDS             complement(501367..502275)
                     /codon_start=1
                     /locus_tag="KF707C_4540"
                     /product="transcriptional regulator"
                     /protein_id="BAU72142.1"
                     /transl_table=11
                     /translation="MLTQLQDLDLHLLRLFVTVVESGGFSAAQGELGIGQSTISTQMA
                     KLETRLGFRLCERGKAGFRLTPKGEQVLAATRKLFGAIETFKGEARGMADLLLGELRI
                     GLSEALDDQVLERLGQAIGRFRRRNQAVHFELISAMPAELERRLLQDQLHLAIGYFSG
                     TQAALDYRPLFSEQQRLFCGAGHPLFERAEIGLDDLASGDLVQHPYRFEEARQPFPTG
                     PSSARTEQVECSLAFVLSGAHIGYLPEHIAAPWVAAGKLRALLPDATGYRVQFHLTRH
                     RARQPGEVEAAFAEDLSAAFEAASPS"
     CDS             502388..503470
                     /codon_start=1
                     /locus_tag="KF707C_4550"
                     /note="TC 3.A.1.11.2"
                     /product="putrescine ABC transporter putrescine-binding
                     protein PotF"
                     /protein_id="BAU72143.1"
                     /transl_table=11
                     /translation="MRIPLLLAALLAAALPVQAEEKALNLYSWSAYIPEQALEGFRKE
                     TGILVKYDIFDSSEALDAKLLTGGSGYDVVTPASSGLARAIQAGAVQPVQRERLRHFA
                     NLDPELLAKLATVDPDNRYGVPYTWGTVGLGMNREAVTRRIPDAPLNSLDLLFKPEYA
                     SRLKDCGIAVIDSPQEVISVALHYLGKDPYSTDKADLEAVQALLGRLQPNIRYVGAGR
                     HINDLAKGEVCLALTYNGDAAIAADQARQAKMPFEVIYRIPREGTLIWFDTLVIPADA
                     PHPEAAHAFIDYMLRPESIAELTNTQFFANANQAATPLLDPGVANDPDIYPSAEVRGR
                     LFGEQILSLREQRTRTRLWTRFRTQY"
     CDS             503533..504495
                     /codon_start=1
                     /EC_number="3.5.3.11"
                     /locus_tag="KF707C_4560"
                     /product="agmatinase"
                     /protein_id="BAU72144.1"
                     /transl_table=11
                     /translation="MDHAFDNDQAMTRDSLYGTAAESTYGGITSFMRRRYSRDLAGVD
                     LVVSGVPFDTATTNRPGSRFGPRAIRAASVQMAWARHYPWEFDPFDHLAVIDYGDCAF
                     DHGTPQHTPELIQAHAARILESGAAMLTLGGDHFISYPLLKAHADRHGPLSLIHFDAH
                     SDTWPDEEVKRIDHGTMFYHAAREGLVDPARSVQVGLRTTNDDVMGFQVLDAREVHRH
                     SPERIAERIRARVGDHPVYLTFDIDCLDPAFAPGTGTPVCGGLSSHQALEILRGLRGI
                     NLVGMDVVEVAPPYDNAEVTALAGATLAMEMVCLYAARHKLGAR"
     CDS             complement(505345..506604)
                     /codon_start=1
                     /locus_tag="KF707C_4570"
                     /product="probable porin"
                     /protein_id="BAU72145.1"
                     /transl_table=11
                     /translation="MDRNTLCLTLCGAASLAFAGPASADFIQDSKASLELRNFYFNRD
                     FRQDGAPQNKAEEWAQGFLLRYESGYTEGTVGVGVDALGLLGVKLDSSPDRTGTGLLK
                     SDRERPNRAQDEYGELGLTAKLRASQSTLKVGTLMPKLPVALHNDSRLLPQTFRGAWA
                     NSAELENLTLDLGRFDRINQRNSSDNEEMTVFNGGNRNIVLGRARTSDRFDFAGATWK
                     WTPSLSTAYHYGALDGLYQQHYLTLNHLLPIAEGQSLKSDVRWARSTDDGGSNVDNDA
                     FGAMFTYSLGGHAFGLGYQRMSGDTGFAYISGADAYLVNLVQINDFGNEDERSWQARY
                     DYNFAALGIPGLTFMTRYLSGDNVDLRGAAGEGKEWERNTDIAYVVQSGPLKNLGIKW
                     RNASTRSNFGSDLDENRLILSYTLPLW"
     CDS             complement(506731..508290)
                     /codon_start=1
                     /EC_number="2.8.3.8"
                     /locus_tag="KF707C_4580"
                     /note="alpha subunit"
                     /product="acetyl-CoA:acetoacetyl-CoA transferase"
                     /protein_id="BAU72146.1"
                     /transl_table=11
                     /translation="MSKVMSAAAAVARIPDNANLATGGFVGIGFAEEIAIALEQRFQA
                     ERAPRDLTLVYAAGQGDGKGRGLNHLAHEGLVRRVIGGHWGLVPGLQKLAVENRIEAY
                     NLPQGVISQLFRDIAAGKPGQLSRVGLGTFVDPAHGGGKLNARTTEELVRRMPLDGED
                     YLFYKAFPIHVGVIRATSADEDGNLSMEREALTIESLAIAMAARNSGGLVIAQVERVV
                     ARGSLNPREVKVPGILVDCVVVAAPENHQQTFATAYNPAFAAEVKVPEGSLAPMPLDL
                     RKLIARRATLELKPGAVVNLGIGMPEGVAAVAAEEGVIDLLTLTAEPGVIGGVPASGL
                     DFGAASNHAALLDQPYQFDFYDGGGLDIAFLGLAQADAEGNLNVSKFGTRLAGAGGFI
                     NISQNAKAVVFVGTFSAGPQDIRIEDGALRIVRDGELRKFVAKVEHRTFAGRLAAEAG
                     KPVLYVTERCVFRLTRDGLELVEIAPGVDLERDILARMDFRPIVHAPRLMDACLFREA
                     RLGLRGLIRPN"
     CDS             complement(508330..509715)
                     /codon_start=1
                     /locus_tag="KF707C_4590"
                     /product="D-beta-hydroxybutyrate permease"
                     /protein_id="BAU72147.1"
                     /transl_table=11
                     /translation="MGTLGILLSLALLMYLAYRGINVLILAPLMALLAVLFAGDAALM
                     LPTYTQVFMKSLGGYLIQFFPLFLLGAIFGKLMDDSGSARAIAHGIVAKLGRERAVLA
                     IVLACGLLTYGGVSLFVVAFAVYPIGTALFREAGIPKRLLPGAIALGAFTFTMTALPG
                     TPAIQNAIPSPFFGTDAFAAPILGLIGGSIMLVLGSWWLSAQARKLIASGEGYGVHKD
                     DPAEQSDAPAIGFWLALAPILLVIVLNYLMAKQVLPNLDTSYLAKPEFGGLQDAKSVI
                     GIWSIIVALGAAVLLLVGLHWKRWTDLRQSLNDGTFGSMLPILNTASEVGYGTVIASL
                     AGFVVIRDLVLSVPGNPLVSEAVAVNILAGITGSASGGMSIALKTLGAQYLEMANAAG
                     ISPELLHRVAAMASGCMDTLPHNGAVISLLAICKLTHRDSYKFIFMNTVVFPLMALAV
                     VITLGSLFGSF"
     CDS             complement(510066..511529)
                     /codon_start=1
                     /locus_tag="KF707C_4600"
                     /note="Fis family"
                     /product="sigma54 specific transcriptional regulator"
                     /protein_id="BAU72148.1"
                     /transl_table=11
                     /translation="MPIASEDLDQHGLVIGVSPERFREVAMPLLFDHLNAQCEGTIAV
                     NRQARIVWINDKYAEKLGIADPRSVLGQEVEAVLPASRLREVVQSGAPSMLDLMAFGD
                     EHFVVTRIPLRDEDGTLVGALGFVLFDRARHLQPVMAKYNQLQNQLAAAQRELARARR
                     ARYTIAGFIGSSAAASEVKRQARRAAQLDATVLLRGETGTGKELLAQGIHNLSLRASG
                     PFVAVNVAAIPESLVEAELFGTAPGAYTGADRRARAGKFELADGGTLFLDEIGDLPLP
                     LQAKLLRVLQEQEVEPLGSNQVKALNVRVIAATHVDLEAKVAAGAFREDLYYRLNVLA
                     LRLPPLRERREDLSALIEHLADDIASRSGQPPLELTDDALALLAAQPWPGNVRELRNL
                     LERAQLLGDGSQPLAASELAELLVDPLPAVALPAAAAPAPESPTPVRPLADSLAEAER
                     AAILAALAACKGNRTQAAERLGIARASLYNKLQAHGL"
     CDS             511648..511806
                     /codon_start=1
                     /locus_tag="KF707C_4610"
                     /product="stress induced hydrophobic peptide"
                     /protein_id="BAU72149.1"
                     /transl_table=11
                     /translation="MDLIRILIAILLPPLGVFLQVGFAGAFWLNILLTLLGYIPGIVH
                     AVYIIAKR"
     CDS             complement(512073..512921)
                     /codon_start=1
                     /locus_tag="KF707C_4620"
                     /product="integral membrane protein"
                     /protein_id="BAU72150.1"
                     /transl_table=11
                     /translation="MFNETDLATLLVLLSALMHAAWNAVIKSGSDRLSSMALVDGVAF
                     CLSLALLPLVSPPPLVVWGLIGLSVVVNTLYRLLLIRAYHYGDFGQVYPVVRGLPPLL
                     VALAAGLVFGERLSGAMLLGIVLISLGILSLLSTRLETNALKALGCAALAGVGVALYT
                     LIDAQGVRRADGVLQFVVYLTLMQSMTTPVIAWMRRGPLVLRFARENWRIGLFGGFNY
                     CVAYGLVLYAMTLDAVAKVAALRESSVIIAAIIASLVFKEPFGLRRILAACVVTAGIL
                     LIKMVD"
     CDS             513033..513938
                     /codon_start=1
                     /locus_tag="KF707C_4630"
                     /product="probable transcriptional regulator"
                     /protein_id="BAU72151.1"
                     /transl_table=11
                     /translation="MNLFQLRAFDAVVREGSFTRAAERLCISQPAVTGHVKALEEHYQ
                     VRLLRRSARQVEPTELGRSLAAISHQLFALAEKAEDLLDTSQALEAGRLDLAADSPHL
                     VMPLLARMRERYPGVAINLRLGNTQETLAALNGERVDLALVSDIPPRTGLHLMPLGAT
                     RLCLLLPAGHPWVGRRKALALNELRGQVLLQREPGSLTRRTFERACAAQELELRAALE
                     LNSREAVIEAVAAGLGVSILYAQEVPRDPRVAALPLKGEGLESRHFLACLDSYAALRV
                     VKAFYEVAGDQVPGLPSPPAPLPEG"
     CDS             complement(513935..514603)
                     /codon_start=1
                     /locus_tag="KF707C_4640"
                     /product="flavin reductase-like, FMN-binding"
                     /protein_id="BAU72152.1"
                     /transl_table=11
                     /translation="MLSFDFARLSPREKYKILIGSVVPRPIALVTTVDADGRANAAPF
                     SFFNALSADPPILALGVENHADLTPKDTSRNVLINQEFTVNIVNDALVEAMNVCAVPF
                     EPGFDELVAAGLTAVPGSRVGCPRILEAPVALECRRMMGLSIGHSREIILGEVLMAHV
                     RDDLIDPETLYIDQLGLDAIGRMGGHGYARTREYFDLPTRSLQAWKEAPGGGERLWPP
                     SQFA"
     CDS             complement(514597..516117)
                     /codon_start=1
                     /locus_tag="KF707C_4650"
                     /product="chlorohydrolase/deaminase family protein"
                     /protein_id="BAU72153.1"
                     /transl_table=11
                     /translation="MNSPRIGLRASCVVGFDGTRHVLWREGEVVLEGDRVAFVGRGYP
                     GPVARWIDYGNALVSPGLIDLDALGDLDSTVLCLDNGDERAMGRLWSAEYLARGPRES
                     YRFDEEVFKYRYAFTQLIRNGITTALPITSMYYREWAETYEEFAAVAGVAAELGLRTY
                     LGPCYMSGMQYLDANGQLREHWDETRGLAGLDAAERFFRDFDGRHGGLIRGALLPDRI
                     QTCTPALLERTVALSRELDAPVRLHCCQGRDEVALVKRLRGAAPLAWLERLGLLGPRA
                     LLPHGIHIEGEDDLARLADSGASLVHCPVVFARDGESLDSFGRYRARGINLALGTDTW
                     PADLIDNMRQGLNIARIREGGSDRTRALDYYNAATLGGARALGRDDLGRLAPGAKADI
                     AVFSLDGLHLGPLFDPLKNLILAGRGDDCIASWIDGRCVMENGQVKGVDYPSLQRQAQ
                     RQFQRLMESHAERAPGRPDWRRLFQPAIPYADAWGAEHPLVTRAGNPERQHENTPC"
     CDS             complement(516114..517310)
                     /codon_start=1
                     /EC_number="3.5.4.1"
                     /locus_tag="KF707C_4660"
                     /product="cytosine deaminase"
                     /protein_id="BAU72154.1"
                     /transl_table=11
                     /translation="MTHAYWLRNVRPFGGAAEDFLIRDGVLAERRPASAAPLAAGDVD
                     GGGQLMTRPLVESHIHLDKTLWGQPWRPNSAGPALKDYIANERRVLREVEAPIAARAG
                     ALLENCIARGSLTLRCHVDIDPEFGLSHVEAMQALREGYRDLIHLELVAFPQTGLVSR
                     PGTAELMRQALALGVENVGGLDPCGIDNDPIAQLDIVFGLAAEFDRGVDIHLHDKGEL
                     GLWQIARIADYTERFGRQGRVMISHAYCLGMAPWSQVEPLARRLAELGISLMSSAPAD
                     CAVPPFLALRAAGVNLCLGSDGIRDAWSPMGNGDMLERAMLLAFRFDLAKDDELAAAF
                     DAASLHGSRALGRAGQTLAPGGAADFLLMEAQSLGEAVVARPPRRVYRAGRLIAEQGR
                     LLESRL"
     CDS             complement(517418..518467)
                     /codon_start=1
                     /locus_tag="KF707C_4670"
                     /note="periplasmic spermidine putrescine-binding protein
                     PotD (TC 3.A.1.11.1)"
                     /product="ABC transporter"
                     /protein_id="BAU72155.1"
                     /transl_table=11
                     /translation="MKLKALRHGVAGLALACLTATAQAEEPKELFFYNWTDYYPVELL
                     AKFEKETGIKVTMDGYDSNETLLAKLQAGGANYDVIVPSHSIMRTLIEQGLLQEIDSP
                     GLPNFAHVKPAFRNPDFDPGRKYSAPYLWGTTGFSYDSARVPGGTLDDSWKEFFEPRP
                     ELQGQLAALDTPSSLINAASHYLGVDECTENPQDAKRILELLQKQKPFLKMYSSDNTV
                     DRMASGEVIMMQNWNGSTARATLQKSTIKYVYPREGIAMFQDNFAVPKGAPHPGNARV
                     FIDWMMKPENAAAVTNAIAYANGIETDALLDRKWQVMDAINMPDAYAERLRPEKECSN
                     QARELQDRIWSKLKG"
     CDS             complement(518515..519306)
                     /codon_start=1
                     /locus_tag="KF707C_4680"
                     /note="TC 3.A.1.11.1"
                     /product="spermidine Putrescine ABC transporter permease
                     component potC"
                     /protein_id="BAU72156.1"
                     /transl_table=11
                     /translation="MIANHLKKLPLTRETSLLVLAYLYLPILVLIAYSFNANRTATVW
                     TEFSFAWYGRILANPSIQAAALNSVIVASIATVCATAIALLAALATYRPFYGQKLVEG
                     GINLPLILPEIVTAVATLLLFMALGIKLGLLTVIIAHIGFCIPFAYLPIRARLNDMDK
                     SLLEAAGDLYANPFHTFRRVTLPLLFPAVLSGAVLAFVVSLDDFIMTFFVAGPGSTTL
                     PVYIFSAIKAGVTPEINAISTLMLVISIVLVVFSFWLGQRGKPTA"
     CDS             complement(519306..520220)
                     /codon_start=1
                     /locus_tag="KF707C_4690"
                     /note="TC 3.A.1.11.1"
                     /product="spermidine Putrescine ABC transporter permease
                     component PotB"
                     /protein_id="BAU72157.1"
                     /transl_table=11
                     /translation="MSVSATSPSLNRLLLLSPVLLTLLCLIAIPLGIMGYISLLPRNL
                     YGGVDWSAGWHLESYVRLFFQEDFDGNLEVNWVYAQALLRSVLQAGGTTLLCFLLGFP
                     VALWMTSLSERSRNIMVLLITIPFWTNLLIRNYAWLIILREQGWLAQSLNALFPQAGG
                     ITLLYNDFAVVVGLVYSFLPFMILPIYSTLEKLDWRLVEAAYDLGANRWKALRRVILP
                     LSMPGVVAGALLVFVPSLGAFITPAILGGGKTLMIGNLIQQQFGTARNWPLGSSLSFL
                     LLGLMLLALVLYALYARKAAKAIRQGAR"
     CDS             complement(520222..521310)
                     /codon_start=1
                     /locus_tag="KF707C_4700"
                     /note="TC 3.A.1.11.1"
                     /product="putrescine transport ATP-binding protein PotA"
                     /protein_id="BAU72158.1"
                     /transl_table=11
                     /translation="MKHASSIEVQRVSKRYTDDPEVAPALDEVSVSIRSNEFFTLLGP
                     SGCGKTTLLRSIAGFEQVSAGSIHIGGQRVDELPPYKRRVNTVFQSYALFPHMSVAEN
                     IAFGLEMQGLARGEIPARVKEMLALVQMEHLARRRPAELSGGQQQRVALARALAPRPD
                     VLLLDEPLSALDLKLRKEMQVELKRVQQEAGITFIFVTHDQEEALTLSDRIAVMASGR
                     ILQIGSPSEIYERPKHPFVAHFIGDINFLPGQIRQCPQNGRLFRPDGIPVDIPCAHDG
                     DAPSGRAQLAFRPERSKLVEPGEPHHLRGVIEAVLYVGTATLYQCRLANDLKVMLRES
                     NEGAVSARTPGSSVAVQLPPHACLLMEA"
     CDS             521454..522143
                     /codon_start=1
                     /locus_tag="KF707C_4710"
                     /note="GntR family"
                     /product="transcriptional regulator"
                     /protein_id="BAU72159.1"
                     /transl_table=11
                     /translation="MSDKKLETTVDRVYQGVYQAISKRSLRPGMKLGEAALAELFNVS
                     RTSVRAALKQLEADGLVSSETNKGCWVSLPSDEEIRSLFETRRLIEIGIVTELCRRRD
                     SAAMRDLRDHLLLEEAARREHDHERLIHLLGEFHIKLAMALHNPVLLDWFRKLISRAS
                     LYAAALDDERHDACRDDEHLRLIEFIEAGNQNAAIELTCFHLAAIETAILESAGKLKA
                     GYHPLKHLIET"
     CDS             522152..522889
                     /codon_start=1
                     /EC_number="5.1.99.-"
                     /locus_tag="KF707C_4720"
                     /product="hydantoin racemase"
                     /protein_id="BAU72160.1"
                     /transl_table=11
                     /translation="MKIQLINPNTSTAMTAALTASAQHLLRPGNQLLAVTNAAGPASI
                     EGHYDEALSVPGLLQAIRDGEREGVEGHVIACFGDPGLLAAREIARYPVIGIAEAAMH
                     LATWVATGFSIVTTLGRTKVIARHLVERYGFHAQCRGIHAVEIPVLALDQDPDGLRRL
                     MRSACREALERDESGAIVLGCAGMSHLAQTLQADLGVPVIDGVGAALKLVETLGELRL
                     STSKRGDLDFPLPKSYAGFLRGFAVGA"
     CDS             complement(523397..523870)
                     /codon_start=1
                     /locus_tag="KF707C_4730"
                     /product="prophage antirepressor"
                     /protein_id="BAU72161.1"
                     /transl_table=11
                     /translation="MSHDYFVPSVFHRHHRALRALLIDDQVWVVAHDLGPLTNRRFDR
                     HLARKLDPDQWRHARIENHQGEVETQLLISESAVCELLKVNFYHPENRSLRQWFTGEV
                     VPALRSAANPSLPRQRRFTWQGKEFNLMEWQGREWVRMKDVAELLEGQHPDTTTL"
     CDS             524237..524734
                     /codon_start=1
                     /locus_tag="KF707C_4740"
                     /product="hypothetical protein"
                     /protein_id="BAU72162.1"
                     /transl_table=11
                     /translation="MLYVVMLGGRHPRAKIEVHDVAFALADSLEATYPQLREGWFGSP
                     EGLHLDSWMAVDGVDGYKLHFTSLAPAPGDPRLYFINLGGYETGIFGEAHSYLLVVAR
                     DKAEAKAKGKHRLAALHWDKPHTDNLHDVDDCIPVDLVSGRYVQLVPGEHRGIRSGND
                     YVVLG"
     CDS             complement(525012..525788)
                     /codon_start=1
                     /locus_tag="KF707C_4750"
                     /note="IclR family"
                     /product="transcriptional regulator"
                     /protein_id="BAU72163.1"
                     /transl_table=11
                     /translation="MSDKDPRHTHPQFIETLEKGIRVLEVFRSGQASIGLTELADSCG
                     MTKSAAQRFTHTWCELGYLSKDERSRRYSLTHKALELGFLYLNADPLISRTLPALQLL
                     RERCNLTVNLSVLSGHDIVYVMRIPGQNQTFAEMLPGRRMPAWCTSAGRVLLSALPDE
                     AIRASLAGIEPTRYTPRTEVDGEALFETILRTRAQGYALTCEQVMIGQIGIAAPVRNV
                     HFQTVAAVNITAQLSLWPTEQVEQKLVPLLMEVTQAITVG"
     CDS             526004..527344
                     /codon_start=1
                     /EC_number="3.5.1.4"
                     /locus_tag="KF707C_4760"
                     /product="amidase"
                     /protein_id="BAU72164.1"
                     /transl_table=11
                     /translation="MTSACLQRVERLNPTLNALVTVDAEGALDRAACADERQARGETL
                     GPLHGLPVAHKDSFLTKGMRTTWGSRVFADHVPDQDSLIVARQAEAGSILLGKTNLPE
                     FGAGSQTFNEVFGATRNPFAPELTCGGSSGGSAVALATGMVALADGTDMGGSLRNPAS
                     FCNLVGLRPSMGRVPNWPNTNSFGQLTVAGPLGRCVADVALLLSVIAGPDRRDPLSVD
                     APASVFRGRLEADFKGARIAYSPDLGGLPVAREVRTVIDQGALRMADLGGSVEQAEPD
                     FAGAAQAFQVLRALTYATGYAHLLKDRRHLLKEDLVWNIELAQRFSVQDVIAAEAVRA
                     RLFRDTQALLERYDFLVAPVSQVLPFPVERPFVERIGERPMGNYIEWMNSCSLITLTG
                     HPAISLPCGFSDDGLPVGIQVIGRYRDELTLLKFAQAFETLNAPQIARSRVRRW"
     CDS             527408..528730
                     /codon_start=1
                     /locus_tag="KF707C_4770"
                     /product="permease of the major facilitator superfamily"
                     /protein_id="BAU72165.1"
                     /transl_table=11
                     /translation="MTHQQNAHPTTSSSHSRQPIRAAAGSFLGTLIEWFDFYIYATAS
                     ALIFSHVFFPGSSQFLGTLSSFATLAVGFLARPLGGIVFGHLGDRFGRKYSLILTLLL
                     MGVSTVGIGLLPSYEQVGILAPILLVLLRICQGIAVGGEWGGAVLLASEHAPEGKRSF
                     YASFAQLGSPAGLVLSLMVFRFISEMPEEAMYAWGWRLPFIGSVVLLLLAFVIRSRVN
                     ESPEFEAQAKAAKTEASPIRLVLRDSWPLVLLVMGACTIGISSAYFTNTFMIAYATQY
                     LGIKSSMILECLSIVAVVQLINQPIAAWLADRVGAGRFLLITSGLSLFVPYLMFSLVS
                     TGQSLMIILGISLTKVFSSAFYAVIAGYVVSVFPVSQRYSGISLAYQGCGALIGGTTP
                     MIGTLIAGQSAGQWWPLALFYTALALISFVCVLLLMRRREAFAVAALR"
     CDS             528784..529191
                     /codon_start=1
                     /locus_tag="KF707C_4780"
                     /note="CopG family"
                     /product="DNA-binding protein"
                     /protein_id="BAU72166.1"
                     /transl_table=11
                     /translation="MKFPVALHKDPDSDYGVTVPDVPGCFSAGATVAEALDNVLEALT
                     LHFEGLVADGDALPQPQDVDIHIANPDFAGGVWAVVDFDITPYLGKTVRFNATLPENL
                     LQRIDERVKRDHRYASRSGFLAIAALRELAAGH"
     CDS             complement(530443..531618)
                     /codon_start=1
                     /locus_tag="KF707C_4790"
                     /note="FIG00591562"
                     /product="hypothetical protein"
                     /protein_id="BAU72167.1"
                     /transl_table=11
                     /translation="MLPFTESADKKEFSVDCIAVEQPLGQFFIASIPYSKLIEITYAD
                     TRRVEEEEHGFETMLGIQRHVSKSRVSELNQYVNTFDACFPTAIILSIPESCVEYDAS
                     SKRLKIFESKSGVNDSDEGVPYEKIAKILDGQHRIKGLEGYVKDKKFDMNVSIFVDLD
                     PASEAYIFSVVNQAQTKVNKSLVYDLYSLAKAKSPQKLCHQVAVALNETDGSPFRHKI
                     KRLGVAGPKTEAVAITQAAFVEALMRHVSYPNSLAVEDRDLYLRGKKPRAPSSKDLEK
                     MIFRGMMLEDRDYDLTDVIWNYFDAVQERWPEAWHSQNKGTMLSKTNGFMALMRFLKD
                     IYIDREAIGTVLSKESFLEIFKAIDLNDNDFTVDNYKPGTSGESALYKDLKNKYFGE"
     CDS             complement(532173..533093)
                     /codon_start=1
                     /locus_tag="KF707C_4800"
                     /product="Mrr restriction system protein"
                     /protein_id="BAU72168.1"
                     /transl_table=11
                     /translation="MSVPTYDQFIEPILRYLAATPEGAAARDAHEAAADALNLSEAQR
                     QELIASGQATYKNRAGWAHDRLKRAGLSSSAKRGYWKLTDAGITYAAQHPMPLAADMI
                     EQLALGFIDVKLKSPTDAIPLDVQEQPAPTLSSATVSPDDRLEQALRELREATAADLL
                     DNLLQVSPNRFEVIVLDVLHSLGYGASRNDLQRVGGSGDGGIDGVISLDKLGLEKVYV
                     QAKRWQGTVGRPELQAFYGALAGQKAKRGVFITTSGFTAQAVDFARSVEGIVLVDGIR
                     LVGLMMDHEVGVTSRLLRLPKLDSDYFDEE"
     CDS             complement(533132..533902)
                     /codon_start=1
                     /locus_tag="KF707C_4810"
                     /note="FIG00960913"
                     /product="hypothetical protein"
                     /protein_id="BAU72169.1"
                     /transl_table=11
                     /translation="MDFTLIIAQAWGTLGWFIPAALLIGLLKSPWAKGQIGELLVRLF
                     AHWQLDKQTYRRLHNVTLDTPDGTTQIDHVFLSPYGIFVLETKNMSGWIFGSEKQAQW
                     TQQIYKQRFKFQNPLRQNYKHLKALEATLGVSPEHLHSVITFVGDSTFKTEVPANVTR
                     GIGFIRYIKSFQQAVFSEAEVDAMLHALQTGRRTPTLATHCEHVQNLKRRSDPTAERQ
                     CPKCGGALLIRTVKSGPKAGQQFWGCSAFPKCRTMQSL"
     CDS             complement(534007..535146)
                     /codon_start=1
                     /locus_tag="KF707C_4820"
                     /product="Fic family protein"
                     /protein_id="BAU72170.1"
                     /transl_table=11
                     /translation="MKDPLWIWQQPNWPHFSWQAEALSPLLRACSQALGRLLGMLGAV
                     DSDAEAQSSLNAMLQNIVTSSAIEGEQLNVGSVRSSLARRLGLSEEGRTTSRSEGLAE
                     LLLDATHAHRQPLDEQRLFTWHRWLFPTDVPLLARPLHIGALRGEEPMQVVSGRIDQP
                     TVHVEAPPRAGLETQLADFLAWFENSRRDASLDPFLRAGIAHFWFITLHPFEDGNGRL
                     TRAITDLALAQGEQQAIRFYALSASILDDRAGYYRILEASQKGTLDITAWLQWFLATL
                     LNSLEQALARIDRVLVKARFWQAHRSKALSAEQIKVLNRLLDGGEKGFENGISASQYQ
                     AVAKVSKATATRHLSDLVEKGCLARLPGGGRSTRYQLQHSANAQS"
     CDS             complement(535675..536547)
                     /codon_start=1
                     /locus_tag="KF707C_4830"
                     /note="AraC family"
                     /product="transcriptional regulator"
                     /protein_id="BAU72171.1"
                     /transl_table=11
                     /translation="MSAALLNVVREYLDRHVDPNGLAQTPISGLTIIRTHEPSGLDYA
                     ITRPLACLVLQGRKQVMMGTQTFTFSAGDSLLITADVPTVSQIVQASPEAPYISLVID
                     LNLSLLTELMEEMQSAPSPEAAPIKIEPTDTEVVEAALRLMRLLDRPASAAVLHASLM
                     RELHYWLLAGRHGSAISRLGWPDGHAQRIARAVTVLRSEFTRPLPVEHLASVAGMSTS
                     SFHHHFRKHTSLTPLQFQKQLRLIEARRLMIGEGASPSTAAFTVGYESVSQFSREYRR
                     LFGMPPGRHTARAC"
     CDS             536687..537442
                     /codon_start=1
                     /locus_tag="KF707C_4840"
                     /product="probable short chain dehydrogenase"
                     /protein_id="BAU72172.1"
                     /transl_table=11
                     /translation="MTKIAIVTGSSRGLGRNTALNIARQGSDVVVTYHSQADAALAVV
                     AEIEALGRKAVALQLDAGNVTTFPVFVQRLRQALRETWQRENFDHLVNNAGHGDMASI
                     AETTEAQFDALVNVHFKGVFFLTQALLPLLADGGRIVNISSGLTRVSYPGFSAYSAVK
                     GAVEVLSLYMAKELGSRGIAVNTVAPGAIETDFLGGAVRDMPDLNKVFADMTALGRVG
                     VPDDIGPMIASLLGEQNRWINAQRIEVSGGQAI"
     CDS             complement(537706..538023)
                     /codon_start=1
                     /locus_tag="KF707C_4850"
                     /note="FIG00954026"
                     /product="hypothetical protein"
                     /protein_id="BAU72173.1"
                     /transl_table=11
                     /translation="MKRDIFAELVEGFEALADERQGKVTLRSHKVQLPELCEVSSEEL
                     VAIRQKLNLSRPVFAMYLRTNPRTLENWEQGRAKPNAQATTLIRLVQKYPETIEHLAA
                     LGQ"
     CDS             complement(538020..538364)
                     /codon_start=1
                     /locus_tag="KF707C_4860"
                     /note="FIG00958844"
                     /product="hypothetical protein"
                     /protein_id="BAU72174.1"
                     /transl_table=11
                     /translation="MEALFVELPPFERHRADYLDDEAFRTFQRALMKNPEAGDVIQGT
                     GGLRKIRFADGRRQKGKRGGIRVIYYWWLGGAQFWLFTLYGKDVQDDLNEQQKKRLKQ
                     LLQAEIDARTTP"
     CDS             complement(538412..538699)
                     /codon_start=1
                     /locus_tag="KF707C_4870"
                     /product="shufflon-specific DNA recombinase"
                     /protein_id="BAU72175.1"
                     /transl_table=11
                     /translation="MLGPSQSLGEPGKNEKRRPYAFTRTWGLLKKKLGMPDLRFHDLR
                     HEAVSRLVEGGLFDQDVSAISGHKSMQMLKRSARRGFVGRLDKLKPQRKAP"
     tRNA            complement(538966..539042)
                     /locus_tag="KF707C_t140"
                     /product="tRNA-Met"
     CDS             complement(539058..542795)
                     /codon_start=1
                     /locus_tag="KF707C_4880"
                     /product="sensory box/GGDEF family protein"
                     /protein_id="BAU72176.1"
                     /transl_table=11
                     /translation="MARARAVFMLWLALWTLPAGALTLTPDEQAWLDDHDELRLGIDA
                     SWPPFEFRDEQGRHQGLAADYVELIRQRLDIELTPVEPSSWGEVLHQARTGQLDILPG
                     IMSTPERQQYLLFTRPYLDFPIVILSQTKGPQPSGLKDLYGLRVGVVADYAPHELLRS
                     QHPDLSLQAYPSVAAALQALATGKVDAFVGDLASSVWSLRQLKLDGISISGETPYRYQ
                     LAMATPKNQPILTGILDKVFAEITPQEAAAIQERWVGGALQRRPDWLRALLYGLPALL
                     LIGGALAFVIRVNRKLSNEMASRAALQEELRSSEQHYRGLVESLNAIAWEMRVDDYRY
                     TYVSPHAERLLGYPLAAWLELGFWHRALHPDDAEWATAFCKSETQLGRDHSLDYRMIA
                     ADGRILWVRDIITLIPHGESRMMRGLMIDITEAKQTEHALRLSEQKFASVFHNCPDII
                     VIARRTDGSLLAVNHTFEQQIGLKAEDAIGRTATELDIWGIPGIGPKLLQRLQQGNPL
                     HNFEMPFRRTNGDTFIGLISAQTVDLDDTPALVVVVRDITQLKETQQQLQVSEEKFAR
                     AFHASPDGLLITRMRDGLLLEANEGFTRITGFDQREIADRSTLDLGLWANPADRDLMI
                     RSIREQGSLHHFTTQIRTKAGQLRICELSAQPIPIGDEVCMLTIARDITERQQMQDKL
                     LQAATVFESTAEGVMITDADQRITAVNRAFSEITGYGEAEALGRTPRLLASGQHDSAF
                     FAALWHQLEREGHWQGEIWNRRKNGDPYPEWLTINAVRDRHQRITHYVGVFADISPLK
                     HAQARLDYQAHHDPLTGLPNRLLFESRLQLALADATSDHHHGAVLFIDLDRFKHINDS
                     LGHPVGDLLLKGIASRLKEHLRDIDTVARLGGDEFIILLPGLHNAGDAQAVANKLLAC
                     FEAPFPAGQHEFFMSASIGISLFPEHGQDVATLVKNADAAMYRAKARGRNRIDLYTQD
                     LTSQATERMSLETELRRALERNELSLSYQPKLSLQHRTLVGAEALVRWYHPRLGEIPP
                     ERFIPIAEESGLILPLGDWVLTQACRQMQRWQNDHAPFGPLSINLAGAQLRQPQLVER
                     LQRLIQGLGLEPQRLQLEITEGFIMSQAEEALGVLHNLKALGVQLAIDDFGTGYSSLS
                     YLKRLPLDVLKIDKSFVHGLPDDPNDAAISRAIIALGRSMQLTVIAEGVETPAQEAFL
                     TAEGCEQIQGFIVSAALPTEAFERKFLNPLPSIGAQQKAPV"
     CDS             complement(542937..544790)
                     /codon_start=1
                     /gene="rpoD"
                     /locus_tag="KF707C_4890"
                     /product="RNA polymerase sigma factor RpoD"
                     /protein_id="BAU72177.1"
                     /transl_table=11
                     /translation="MSGKAQQQSRLKELIARGREQGYLTYAEVNDHLPEDISDPEQVE
                     DIIRMINDMGINVFESAPDADALLLAEADTDEAAAEEAAAALAAVETDIGRTTDPVRM
                     YMREMGTVELLTREGEIEIAKRIEEGIREVMSAIAHFPGAVDGILSEYHRVTTEGGRL
                     SDVLNGYIDPDDGTLPAEEVEPELKDDNAAAKTKDDDEEDEEGESDDSEDEGDGGPDP
                     EEALRRFTAVSEQLEKAKKALKKHGRSSKEAIAELLALAELFMPIKLVPKQFDALVEK
                     VRSALDRVRAQERAIMQLCVRDARMPRADFLRLFPGNEVDLTWADGLASGKAKYAEAI
                     GRLSDDIKRNQQKLVDLEQEVELTVNEIKDINRRMSIGEAKARRAKKEMVEANLRLVI
                     SIAKKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQ
                     ARTIRIPVHMIETINKLNRISRQMLQEMGREPTPEELGERMEMPEDKIRKVLKIAKEP
                     ISMETPIGDDEDSHLGDFIEDSTMQSPIDVATVESLKEATREVLAGLTAREAKVLRMR
                     FGIDMNTDHTLEEVGKQFDVTRERIRQIEAKALRKLRHPSRSEHLRSFLDE"
     CDS             complement(544858..546855)
                     /codon_start=1
                     /EC_number="2.7.7.-"
                     /locus_tag="KF707C_4900"
                     /product="DNA primase"
                     /protein_id="BAU72178.1"
                     /transl_table=11
                     /translation="MAGLIPQGFIDDLLNRTDIVEVVGSRVQLKKAGKNYTARCPFHN
                     EKTPSFSVSPDKQFYYCFGCGAGGNALGFIMDHDHLDFPQAVEELAKRAGLDVPREEG
                     AGRSNRPRQPSDSPLYALLTAASDYYRHALKQHPTRKAAVEYLKGRGLTGEIARDFAL
                     GFAPPGWDNLLKHMGGDSLQQKHMIDAGLLIENADTGKRYDRFRDRVMFPIRDSRGRI
                     IAFGGRVLGDDKPKYLNSPETPVFHKGQELYGLFEARKHNRNLDEIMVVEGYMDVIAL
                     AQQGLRNAVATLGTATSEEHVRRLFRLVPSILFCFDGDQAGRKAAWRALEATLPSLED
                     GRRARFLFLPEGEDPDSLVRKEGTDAFRARITQHAQPLADYFFQQLTLEADPASLEGK
                     AHLATLAAPLIERIPGANLKVLMRQRLAEITGLNGDALGQLARSMPSGSASQDVHGTS
                     EDAYYESFSGYDDQQHDVDPSHYFEAPAQPQGDWQQGGQRKEWKKGDWKKDGKKWNRQ
                     GRDDFKRPPRTEVKVETPTLTALRTLLHHPSLAQKVEDAAHFAAEDDTYAQLMVALVE
                     AVQKNPKLRSLQLIARWHGTEQGRLLRALAEKEWLISEDNLEQQFFDTITSLSARQRE
                     RRLESLLRKARQSELSAEEKDQLRDLLSRNTSPLTPTSTGA"
     CDS             complement(547050..547265)
                     /codon_start=1
                     /locus_tag="KF707C_4910"
                     /product="SSU ribosomal protein S21p"
                     /protein_id="BAU72179.1"
                     /transl_table=11
                     /translation="MPAVKVKENEPFDVALRRFKRSCEKAGVLAEVRSREFYEKPTAE
                     RKRKAAAAVKRHAKKVQREQRRRERLY"
     CDS             547469..548494
                     /codon_start=1
                     /locus_tag="KF707C_4920"
                     /note="required for threonylcarbamoyladenosine (t(6)A)
                     formation in tRNA"
                     /product="YgjD/Kae1/Qri7 family"
                     /protein_id="BAU72180.1"
                     /transl_table=11
                     /translation="MLVLGLETSCDETGVALYDSERGLLADALFSQIDLHRVYGGVVP
                     ELASRDHVKRMLPLLRQVLEEAGRTPEDIDGIAYTAGPGLVGALLVGASCAQALAFAW
                     GVPALGVHHMEGHLLAPMLEEQPPQFPFVALLVSGGHTQLVRVDGIGRYALLGESVDD
                     AAGEAFDKTAKLIGLGYPGGPEIARLAQSGTPGRFTFPRPMTDRPGLDFSFSGLKTFA
                     LNTWQQCRNAGDDGEQTRCDIALAFEQAVVETLTIKCKRALKQTGLKNLVIAGGVSAN
                     QSLRQSLARMLGELNGEVFYARPRFCTDNGAMIAYAGCQRLLAGQQDGPAITVQARWP
                     MEQLPAI"
     CDS             complement(548526..549095)
                     /codon_start=1
                     /locus_tag="KF707C_4930"
                     /product="acyl-phosphate:glycerol-3-phosphate
                     O-acyltransferase PlsY"
                     /protein_id="BAU72181.1"
                     /transl_table=11
                     /translation="MFWLLATLAYLLGSLSFAILLSRLFGTGDPRAQGSGNPGATNML
                     RVAGKKLAILTLLGDLLKGLLPVLIAHLCGLGIQQQAWIGLAAVLGHLYPLYFRFRGG
                     KGVATAAGMLLGLYPPAALLAISTWLLTFYLTRTSSLAALIATPLTLPLLAWRQPGAL
                     LPMTVLTALIVWRHRGNLRDLFAGRERHF"
     CDS             549153..549500
                     /codon_start=1
                     /EC_number="4.1.2.25"
                     /locus_tag="KF707C_4940"
                     /product="dihydroneopterin aldolase"
                     /protein_id="BAU72182.1"
                     /transl_table=11
                     /translation="MVFIEGLEVDTVIGAYDWERSIRQCLRLDLQFGWDNRPAAEGDD
                     LEKALDYASVSQRIQAFAAESQFLLVETFAERLVALLMAEFNIPWVRLKLHKPGAVPA
                     ASSVGVEIERGCR"
     CDS             549491..550030
                     /codon_start=1
                     /EC_number="2.7.6.3"
                     /locus_tag="KF707C_4950"
                     /product="2-amino-4-hydroxy-6-
                     hydroxymethyldihydropteridine pyrophosphokinase"
                     /protein_id="BAU72183.1"
                     /transl_table=11
                     /translation="MSLTRIYLGLGSNIERERNLTAGLDALAVFLHDLRCSPVFESLP
                     VGIRSGNFFNFVVEAKTDLPLHELDRRLKDIEADNGRYAPGRKGLPLDIDVLLYGDRV
                     GNFDGLVLPRAEVLKNAFVLWPLSILAPDTLHPGEERSFADLWESSAIQQALWPASFR
                     WHGVELTPVTLLQAYPAPA"
     CDS             complement(550036..551277)
                     /codon_start=1
                     /EC_number="2.7.7.72"
                     /locus_tag="KF707C_4960"
                     /product="tRNA nucleotidyltransferase"
                     /protein_id="BAU72184.1"
                     /transl_table=11
                     /translation="MQIFKVGGAVRDRLLGRLVSEVDWVVVGATAEEMAAQGFRPVGA
                     DFPVFLHPETGEEYALARTERKSGRGYGGFTFHASPDVTLEQDLIRRDLTVNAMAEDE
                     HGRLIDPYGGRKDLEARVLRHVSPAFAEDPLRVLRVARFAARYAPLGFQVAGETLELM
                     RQIADSGELDALTPERSWKEISRALMEPRPDIFIQVLRDSGALAAWMPELDRLFGVPQ
                     PEQHHPEVDTGLHTLAVLRQCAEHEQPLTVRWACLLHDLGKGLTPETEWPRHVAHEVR
                     GLKLIKAVNERCKAPRDCQELALLVGEYHTHAHRALELRASTLLELLQAFDVFRRPQR
                     FEEFVAAAEMDARGRTGLEQRDYPQSAYLLGAASVARAVAVQPLLEQGFKGAELGQAL
                     TRARLAALEDYRRNSAADRPT"
     CDS             complement(551515..553080)
                     /codon_start=1
                     /locus_tag="KF707C_4970"
                     /note="FIG004684"
                     /product="SpoVR-like protein"
                     /protein_id="BAU72185.1"
                     /transl_table=11
                     /translation="MSASKKERKPISTGSEWTFDLIRTYDREISRIAERYALDTYPNQ
                     IEVISAEQMMDAYASVGMPIGYHHWSYGKHFLATEKGYTRGQMGLAYEIVINSDPCIA
                     YLMEENTITMQALVIAHACYGHNSFFKGNYLFRTWTDASSIIDYLVFAKQYITQCEER
                     HGIDAVEDLLDSCHALMNYGVDRYKRPYPISAEEERRRQKEREEHLQKQINDLWRTIP
                     KGAGKGGEKDNQRFPAEPQENILYFIEKHAPLLEPWQREIVRIVRKIAQYFYPQRQTQ
                     VMNEGWATFWHYTLLNDLYDEGLVTEGFMMEFLQSHTSVVYQPSFDSPYYSGINPYAL
                     GFAMYRDIRRICEDPTEEDKRWFPDIAGSDWLSTLKFAMKSFKDESFILQFLSPKVIR
                     DFKLFSILDDDQKDELLVPAIHDESGYRVIREQLAAQYNLGNREPNVQIWSVDRRGDR
                     SLTLRHQQHDRKPLGESTEDVLKHLHRLWGFDVHLETRYGEQITGVHHVPPKGERTED
                     GEYPRLDLIIPPI"
     CDS             complement(553093..554364)
                     /codon_start=1
                     /locus_tag="KF707C_4980"
                     /product="UPF0229 protein YeaH"
                     /protein_id="BAU72186.1"
                     /transl_table=11
                     /translation="MSYVIDRRLNGKNKSTVNRQRFLRRYREHIKKAVEEAVSRRSIT
                     DMEHGEQISIPGRDIDEPVLHHGRGGRQTIVHPGNKEFTTGDRIPRPQGGGGGRGSGK
                     ASNQGEGMDDFVFQITQEEFLDFMFEDLELPNLVKRHLTGADTFKTVRAGISNEGNPS
                     RINIVRTLRSAHARRIALSGSSRAKLREAKEELARLKREEPDNFSDIQELEAEIAKLR
                     ARIERVPFLDTFDLKYNLLVKQPNPSSKAVMFCLMDVSGSMTQATKDIAKRFFILLYL
                     FLKRNYDKIEVVFIRHHTSAREVDEEEFFYSRETGGTIVSSALKLMQEIMAERYPINE
                     WNIYAAQASDGDNWNDDSPICRDILIKQIMPFVQYYTYVEITPREHQALWYEYEQVCE
                     AFDDTFAQQQIVSASDIYPVFRELFQRRLVT"
     CDS             complement(554458..556380)
                     /codon_start=1
                     /locus_tag="KF707C_4990"
                     /note="(prkA protein, P-loop containing"
                     /product="serine protein kinase"
                     /protein_id="BAU72187.1"
                     /transl_table=11
                     /translation="MSIFSHFQQRFEATRQEEYSLQEYLDLCKQDRSAYATAAERMLM
                     AIGEPELLDTSADPRLSRIFSNKVIRRYPVFADFHGMEECIDQIVSYFRHAAQGLEEK
                     KQVLYLLGPVGGGKSSLAEKLKQVMERVPFYAIKGSPVFESPLGLFNPDEDGAILEEE
                     YGIPRRYLRTVISPWATKRLNEFGGDISKFRVVKLYPSILNQIAIAKTEPGDENNQDI
                     SSLVGKVDIRKLEEFPQNDADAYSYSGALCRSNQGLMEFVEMFKAPIKVLHPLLTATQ
                     EGNYNSTEGLGGLPFSGIILAHSNESEWHSFRNNKNNEAFIDRIYIVKVPYCLRVTDE
                     IKIYDKLLINSSLAKAHCAPDTLRMLAQFSVLSRLKEPENSNVYSKMRVYDGENLKDT
                     DPKAKSIQEYRDSAGVDEGMNGLSTRFAFKILSKVFNFDPHEVAANPVHLLYVLEQQI
                     EQEQFPAEVRERYLRYIKEYLAPRYIEFIGKEIQTAYLESYSEYGQNIFDRYVLYADF
                     WIQDQEYRDPETGEILNRVALNEELEKIEKPAGISNPKDFRNEIVNFVLRARANNNGK
                     NPSWLSYEKLRVVIEKKMFSNTEDLLPVISFNAKGSKEEQQKHNDFVKRMVERGYTEK
                     QVRLLSEWYLRVRKSQ"
     CDS             complement(556669..556998)
                     /codon_start=1
                     /EC_number="2.8.1.1"
                     /locus_tag="KF707C_5000"
                     /product="thiosulfate sulfurtransferase GlpE"
                     /protein_id="BAU72188.1"
                     /transl_table=11
                     /translation="MSEFQRIAPERAHDLREQGAVVVDIRDPQSFAQGHISGSRHLDN
                     HSLADFIAHADFDKPLIVACYHGNSSQGAAAYLAHQGFSEVYSLDGGFELWRSVYPGD
                     VAQGGTD"
     CDS             complement(556991..557818)
                     /codon_start=1
                     /EC_number="3.6.1.41"
                     /locus_tag="KF707C_5010"
                     /note="symmetrical"
                     /product="bis(5'-nucleosyl)-tetraphosphatase"
                     /protein_id="BAU72189.1"
                     /transl_table=11
                     /translation="MTTYAVGDLQGCLDQLKCLLDQVHFDPAKDRLWLVGDLVNRGPK
                     SLETLRFLFSIRDSVVCVLGNHDLHLLAVAHNIERLRKADTLREILDAPDRADLLDWL
                     RRQKLLHYDEQRDIAMVHAGIPPQWTLRKALKRAAEVEEALQDDARLPLFLDGMYGNE
                     PAKWDKDLHGVTRLRVITNYFTRMRFCKADGTLDLKTKEGLGTAPPGYAPWFSFPNRK
                     THGQKIIFGHWAALEGQCNEPGLFALDTGCVWGGTMTLLNIDSGQRISCSCQENHHE"
     CDS             complement(557829..558209)
                     /codon_start=1
                     /locus_tag="KF707C_5020"
                     /product="ApaG protein"
                     /protein_id="BAU72190.1"
                     /transl_table=11
                     /translation="MSDSRYQVDVSVATRFLPEQSQPEQNRFAFAYTVTITNNGERPA
                     KLLSRHWVITDGDGHVQEVRGAGVVGQQPLIAPGASHTYTSGTVMATRVGTMQGSYQM
                     VADDGKRFDAPIAPFRLAVPGALH"
     CDS             complement(558241..559047)
                     /codon_start=1
                     /EC_number="2.1.1.182"
                     /locus_tag="KF707C_5030"
                     /product="SSU rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))
                     -dimethyltransferase"
                     /protein_id="BAU72191.1"
                     /transl_table=11
                     /translation="MPDHYQHRARKRFGQNFLHDAGIIHRILRSIHAREGERLLEIGP
                     GQGALTEGLLASGAQLDVIELDLDLIPILTHRFGQLPNFRLNQGDALKFDFRRLDAAP
                     HSLRVVGNLPYNISTPLIFHLLAHADLIRDMHFMLQKEVVERLAAEPGGGDWGRLSIM
                     VQYHCRVEHLFNVGPGAFNPPPKVDSAIVRLVPHEVLPHPAKDPALLERVVREAFNQR
                     RKTLRNTLKGLLDAAAIEAAGVDGGLRPEQLDLAAFVRLADQLAASQPDS"
     CDS             complement(559166..560155)
                     /codon_start=1
                     /EC_number="1.1.1.262"
                     /locus_tag="KF707C_5040"
                     /product="4-hydroxythreonine-4-phosphate dehydrogenase"
                     /protein_id="BAU72192.1"
                     /transl_table=11
                     /translation="MTTLRFALTPGEPAGIGPDLCLLLARNAQPHALIAVASLDLLER
                     RASELGVDIRLIAIDPDALPDAPAPAGSLYVWDTPLRAPAYPGKLDPRNADYVLETLT
                     RAGQGCLDGHFAGMITAPVHKGVINEAGIAFSGHTEFLADLTATRQVVMMLATRGLRV
                     ALVTTHLPLKDVPAAITPERLQRVSRILHTDLVEKFGIPRPRILVCGLNPHAGEGGHL
                     GREELEIIEPTLEGLRAEGLNLVGPLPADTLFTPKHLEHCDAVLAMYHDQGLPVLKYK
                     GFGAAVNVTLGLPIIRTSVDHGTALDLAGTGDIDCGSLEVALETAYQMAGSRG"
     CDS             complement(560230..561522)
                     /codon_start=1
                     /EC_number="5.2.1.8"
                     /locus_tag="KF707C_5050"
                     /note="Peptidyl-prolyl cis-trans isomerase SurA"
                     /product="survival protein SurA precursor"
                     /protein_id="BAU72193.1"
                     /transl_table=11
                     /translation="MKNKLANRLRPLLLGAVLLGGLAHAEVRPIDRVVAIVDNDVIMQ
                     SQLDQRLREVQQTIAKRGASLPPENVLSQQVLERLIIENIQLQIGDRSGIRIADEELN
                     QAIEAIAQRNGMSVDQFRAALSSDGLSYEDARDQVRREMVISRVRQRRVAERIQVTDQ
                     EVQNFLASDMGKLQLSEEFRLANILIPVPEGSSPSTIQSAERQAQELYQQLRQGADFA
                     QLAISRSAGETALEGGEIGWRKAAQLPPPFDGMISALQVGEVTEPVRTPGGFILLKLL
                     DKRGGETQVRDEVHVRHILLKPSEIRSEADTRRLAERLYERIQSGEDFGELAKAFSED
                     PGSALNGGDLNWIDPNALVPEFREVMAQTPAGKLSKPFKSPYGWHVLEVLGRRATDSS
                     EQFREQQAMNILRNRKYDEELQAWLRQIRDEAYVETKL"
     CDS             complement(561503..564283)
                     /codon_start=1
                     /locus_tag="KF707C_5060"
                     /note="required for envelope biogenesis / Organic solvent
                     tolerance protein precursor"
                     /product="outer membrane protein Imp"
                     /protein_id="BAU72194.1"
                     /transl_table=11
                     /translation="MAVRSPAFRKKFPLLVTGSLLALQPVASSFVVAAEQFDCQASAT
                     GGWACAPKASVENLPPRPVHSDSAVSSTIGAAPAAEGEAQGDKATLVTEAGGKGLASR
                     SADFSHMDWVPRDQLTPAQLAEAGPYCAGAYVEPTRPGMNDDTPMEDAPTYISAKASR
                     YEQEQQVATLAGDVVLRQGSMQVEADEANLHQAENRGELLGNVKLRDKGALVVGDRAE
                     LQLDNGEAKVENAEYVLHQSHTRGSALYAKRQEDAIIRLKDGTYTRCEPGDNAWHLKG
                     NNIKLNPATGFGTATNVTLRVKDIPVFYTPYIYFPIDDRRQSGFLPPTIGSSSDTGFL
                     LVTPYYFNLAPNYDATLYPRYMSKRGLLMEGEFRYLTHSSEGQLGGAYLNDKEDEREL
                     MSEYEKKRWLYHWKHTGGLDSRLLAEVDYTDISDPYYFEDLDTDLGVDAPTYVNQRGT
                     LTYRGNGYTAKLNAHAYELATITDITPYDRLPQITLDGALPFKPAGLNFAYSTEFVRF
                     DRNLRDGQFSDIDGNLTNWNDNNIRGLARANGDRAHLEPSVSLPMNWTWGFLKPQVKY
                     AYTQYDLDLDAQGFDLTKGGIAKSAFDDAPDRSVPIYSVDSGLYFDRKTQFFGKDYTQ
                     TLEPRLFYLYVPEEDQTDIPVFDTGESTFSYASLFRENRFSGRDRIGDANQVSLGVTN
                     RWIESNGFERQRFSIGQAFYFEDRKVQLPGIDYKTRDDAQASVSPYALEYMYRFNRDW
                     RINSTFNWDPDSHSTRSGSAMFHYQPEDNPNKVVNAGYRYRNDTVRYDQSTGNWVVGG
                     GDFGTPGSANFIEDYYKISQHDFSVIWPLVPQWSAIARWQYDYNRDRTLEAFGGFEYD
                     SCCWKLRLINRYWVDYDEFDQTPDTTNNSGDRGIFLQIVLKGLGGIVGNKAESFLDKG
                     IQGYREREEQAR"
     CDS             564410..565435
                     /codon_start=1
                     /locus_tag="KF707C_5070"
                     /note="COG3178:"
                     /product="predicted phosphotransferase related to Ser/Thr
                     protein kinases"
                     /protein_id="BAU72195.1"
                     /transl_table=11
                     /translation="MHHEDLRLAQLSQWLDQQLPSLFTAHGWGPVPEARLVPASSDAS
                     FRRYFRWEAEDRTLILMDAPPPREDCRPFVKVAGMLAEAGVHVPRILAADVEQGFLIL
                     DDLGRQTYLDVIDASNADALFEDAIQALLTFQKRSLDAPMPHYDDALLRRELQLFPEW
                     YLQHHLGLELEGERLAAWERISRLLIDSALAQPKVLVHRDYMPRNLMLSTPNPGVLDF
                     QDAVYGPVTYDITCLFKDAFLSWPEERVAGWLQRYWTLAREAGIPVQADFAEFRRASD
                     LMGVQRHLKVIGIFARICHRDGKPKYLGDVPRFFAYIKAVIERRPELAELGQLLASLP
                     DGEAARG"
     CDS             565432..566103
                     /codon_start=1
                     /locus_tag="KF707C_5080"
                     /product="nucleotidyl transferase possibly involved in
                     threonylcarbamoyladenosine formation"
                     /protein_id="BAU72196.1"
                     /transl_table=11
                     /translation="MKAMILAAGKGERMRPLTLHTPKPLVRAAGTPLIEFHLRALARA
                     GFQDLVINHAWLGQQIEDHLGSGERFGLSIRYSPEGEPLETGGGIFRALPLLGDEPFL
                     LVNGDVWTDYDFGHLCRPLDGLAHLVLVDNPEHHPRGDFQLVDGRVSEAREGEPSLTY
                     SGIAVLHPRLFEDCQPGAFKLAPLLRQAMAAGQVSGEHFRGRWVDVGTHERLADVERL
                     LQAEV"
     CDS             566104..566871
                     /codon_start=1
                     /locus_tag="KF707C_5090"
                     /product="DnaJ-like protein DjlA"
                     /protein_id="BAU72197.1"
                     /transl_table=11
                     /translation="MLWPATLIGATAGFALASIPGAMLGGLLGQVLDRRLKLDSWSAL
                     WARLRGRSEIASGDLLFVLLGRLAKSDGRVQAAHIQQARSEMKRLGLDESRTRRAIAA
                     FNRGKVGRDNLQPALAGLREERLSAERLLRSCWQMAAADGRIGEVERELILQWGQWLG
                     FKPAQVQALGAGYDTPQGLAPARGNSYSEALKLLGVTADCEPATIKRAYRRLLSKHHP
                     DKLAGSGASPTAVRAATERTRELQSAYNLIRERHGFR"
     CDS             complement(566868..567872)
                     /codon_start=1
                     /locus_tag="KF707C_5100"
                     /product="hypothetical protein"
                     /protein_id="BAU72198.1"
                     /transl_table=11
                     /translation="MLRFHRPALSALVLAPLFASLPLRAENAGTPTEPTPAVERAPLV
                     ERSQEEARGLERRLPQREQQMLKAGDEHFLALWQPANIAESKGLVVILPGDGETADWP
                     RAVGPLRRGLPDLGWSTLSLTLPDPSGDPLPPRAPKSEEKTQAEPAVSPEKAQEEGPA
                     NTEQAGSAEPDTDPAPPPLSRDAIQKSQTDRTFARIDAALAFARQQKPGVIVLLGHGT
                     GAYWAVQYLGALEPGDVQNLLLVAAETPAGYGPPLEDSLPDLKLATGDFYYRDQPADR
                     DAAQARLHASKRQQHPAYIQIAIKALPGDRASEQEQLLRRIRGWLDLQPRSKASATGG
                     "
     CDS             567975..570398
                     /codon_start=1
                     /locus_tag="KF707C_5110"
                     /note="near polyamine transporter"
                     /product="probable two-component sensor"
                     /protein_id="BAU72199.1"
                     /transl_table=11
                     /translation="MRFSLPGDGFSMIRALVSLLLVVCLSPPLLAAPSTLPLDDAQRL
                     WLADHDRLRVGAVLQAPYVQLDRRLQQLSGANVELMNWLARELGVELIWRTYDSQGEL
                     EQALRAGLIDLAPGLSQTPAGLRLWLFSDPYMRVSQLVVGEREGNAAVDLEQLDGTSP
                     LALRHPSGVFDYLRSTYTNLELRPMASERQALQALLAEQVRYAVLDEAQLSRLSREQE
                     FAGLAVVADIGFPQLLRVASRRDWPELAAIVDIALRNLPAKDLDLLHERWLQPKYPRL
                     GESAGFWQNLSLLLGVLLLSAAAIITWLRRQRRGLERQLLDARHALQMREAAEEALRL
                     TQFSIDHSTLGVLWVNWDSHVRYANRAAEQMLGYAPGSLADRPLADFQPELNMDRWLN
                     LWRRVRNSDEGPLGFETRCLRPDGSWLPADVSLSFLRFGSSEYLVVFLSDATERRRAR
                     EALEESEARLKGIASNVPGLVFRLERPAAGAPSAFAFIGEGSEGLVGYSASELLDTGR
                     GIRGLVHPEDRDGYWASQLAALDADRDWHWQGRILTRDGQLRWADIKASARIFEDGRA
                     VWDGVVWDITDNKQIELELAASRAQLRELSAHLESVREEEKARIAREVHDELGQVLTV
                     LKLETSMCELAYADLDEGLKERLESMKRLIAQLFQLVRDVATALRPPILDAGIGSAIE
                     WQARRFEARTQIPCLVEVPEHLPAISDAKAVGLFRVLQEALTNVMRHAEAHTVEVRLS
                     EEGGQLCLRISDDGRGFDTSARRGSSFGLVGMGERVLMLGGSLEIDSQPGEGTTLCVR
                     VALDKEKAA"
     CDS             570395..571024
                     /codon_start=1
                     /locus_tag="KF707C_5120"
                     /note="LuxR family, near polyamine transporter"
                     /product="DNA-binding response regulator"
                     /protein_id="BAU72200.1"
                     /transl_table=11
                     /translation="MIRVLVAEDHTIVREGIKQLIGLAKDLCVAGEAANGEQLMETLR
                     HTPCEVVLLDISMPGVNGLEAIPRIRALGNPPAVLVLSMHDEAQMAARALKIGAAGYA
                     TKDSDPSLLLAAIRKVASGGRYIDPDLADRMVFEVGLTDSRPAHTLLSEREFSVFERL
                     VRGEGVNEIAQHLAISSKTVSTHKARLMQKLGLSSVADLVKYAVEHKLL"
     CDS             571176..572285
                     /codon_start=1
                     /locus_tag="KF707C_5130"
                     /note="TC 3.A.1.11.1"
                     /product="putrescine transport ATP-binding protein PotA"
                     /protein_id="BAU72201.1"
                     /transl_table=11
                     /translation="MAETQGSDILVSFRGVQKSYDGESLIVKDLNLDIRKGEFLTLLG
                     PSGSGKTTSLMMLAGFETPTSGEILLAGRSINNVPPHKRDIGMVFQNYALFPHMTVAE
                     NLAFPLSVRGMSKTDASERVKRALSMVQLDAFRNRYPAQLSGGQQQRVALARALVFEP
                     QLVLMDEPLGALDKQLREHMQMEIKHIHQRLGVTVVYVTHDQGEALTMSDRVAVFHQG
                     EIQQIAPPRELYELPKNTFVANFIGENNRLSGQLESRQGDTCVVRLARGEKVEALAIN
                     VGQPGEPVTLSIRPERIRLNGHSESCVNRFSGRVAEFIYLGDHVRIRFEVCGKPDFFV
                     KQPIAELDPALAVGDVVPLGWQVEHVRALDPLHAE"
     CDS             572335..573366
                     /codon_start=1
                     /locus_tag="KF707C_5140"
                     /note="TC 3.A.1.11.1, periplasmic spermidine
                     putrescine-binding protein PotD"
                     /product="ABC transporter"
                     /protein_id="BAU72202.1"
                     /transl_table=11
                     /translation="MSKSLKLTAIALGLACAAQAMAADLTVVSFGGANKNAQVKAFYE
                     PFQQATGNKIIAGEYNGEMAKVKAMVDTNSVSWNLVEVESPELARGCDEGLFEELDTA
                     QFGKAEDFIPGALQPCGVGFFVWSTVLAYNADKLKTAPTSWADFWDVNKFPGKRGLRK
                     GAKYTLEFALMADGVAPKDVYSVLATKEGQDRAFKKLDEIKPSIQWWEAGAQPPQFLA
                     SGDVVMSSAYNGRIAAVQNESNLKVVWTGGIYDFDSWAIPKGAKDADKAKEFIAFSVQ
                     PEQQKVYSSNIAYGPANTQAVSLLDKGILKDMPTTPENIKDQVAMDVTFWADYGEQLE
                     QRFNAWAAK"
     CDS             573480..574727
                     /codon_start=1
                     /locus_tag="KF707C_5150"
                     /note="TC 3.A.1.11.1"
                     /product="spermidine Putrescine ABC transporter permease
                     component PotB"
                     /protein_id="BAU72203.1"
                     /transl_table=11
                     /translation="MATAVPLNEVAGPSLKQRLARAERMNRLKSQALILPLLIFLLLT
                     FLVPIGALLYKSVNNPEVVGSMPRTVDAIASWDGKALPAEPVYKALAEDLAEARKNQT
                     IGDLSKRLNMELAGYRSLMAKTARALPFKTEPASYKDALETLDERWGDPAYWQAIRRN
                     ASHLTPYYLLAALDHRIDDLGELAPATPDQAIYLDIFARTFWMSAVITAICLLLAYPL
                     AYLLANLPTRQSNLLMILVLLPFWTSILVRVAAWIVLLQSGGLINGALMKLGLIDQPL
                     QLVFNRTGVYIAMVHIMLPFMILPIYSVMKGISPSYMRAAISLGCHPFASFWKVYFPQ
                     TVAGVGAGCLLVFILSIGYYITPALLGSPNDQMVSYFVAFFTNTTINWGMATALGGML
                     LFATLVLYVVYTWLVGAGRLRLG"
     CDS             574821..575648
                     /codon_start=1
                     /locus_tag="KF707C_5160"
                     /note="TC 3.A.1.11.1"
                     /product="spermidine Putrescine ABC transporter permease
                     component PotC"
                     /protein_id="BAU72204.1"
                     /transl_table=11
                     /translation="MLSPYMSPVERLWFFTLRILCGLVLLFLILPVLVIVPLSFNSGT
                     FLVYPLQGFSLRWYADFFQSAEWMRALTNSLIVAPAATVLAMVFGTLASIGLTRGEFR
                     GKALVMSILISPMVVPVVIIGVASYLFFAPLGMGNSYLSLILVHAVLGVPFVIITVSA
                     TLQGFNHNLVRAAASLGAPPLTAFFRVTLPLIAPGVISGALFAFATSFDEVVVTLFLA
                     GPEQATLPRQMFSGIRENLSPTIAAAATLLIGFSIALLLVLEWLRGRSERLRTSMPE"
     CDS             575600..575767
                     /codon_start=1
                     /locus_tag="KF707C_5170"
                     /product="hypothetical protein"
                     /protein_id="BAU72205.1"
                     /transl_table=11
                     /translation="MAAGTQRAPAHLDAGIDSPSFRPPAPPCGRAFFRLASVIGRMPA
                     NLPSRLQFAPP"
     CDS             575788..576456
                     /codon_start=1
                     /EC_number="5.1.3.1"
                     /locus_tag="KF707C_5180"
                     /product="ribulose-phosphate 3-epimerase"
                     /protein_id="BAU72206.1"
                     /transl_table=11
                     /translation="MQPFAIAPSILSADFARLGEEVDKVLAAGADIVHFDVMDNHYVP
                     NLTIGPMVCSALRKYGITAPIDAHLMVKPVDRIIGDFIEAGATYITFHPEASLHIDRS
                     LQLIRDGGAKAGLVFNPATPLDVLKYVMDKVDMILLMSVNPGFGGQKFIPGTLDKLRE
                     ARALIDASGRDIRLEIDGGVNVKNIREIAAAGADTFVAGSAIFNAPDYAEVINAMRAE
                     LARV"
     CDS             576458..577297
                     /codon_start=1
                     /EC_number="3.1.3.18"
                     /locus_tag="KF707C_5190"
                     /product="phosphoglycolate phosphatase"
                     /protein_id="BAU72207.1"
                     /transl_table=11
                     /translation="MGTLHRLFDGRLPRLVMFDLDGTLVDSVPDLAAAVDRMLIALGR
                     PAAGVERVREWVGNGARVLVRRALAGDIEHAAVHDADAERGLALFMEAYAESHALTTV
                     YPGVVDTLKWLKKQDVELALVTNKPERFVAPLLDEMKLGRYFPLIIAGDTLPQQKPDP
                     AALLHVMHMTGVSRHEALFVGDSRNDVLAARAAGVKCVALSYGYNHGRPIAEEEPALV
                     VDDLRELLPGGCAAHGAALMSPDSPENSPQRDRNVVVPCKHWLERAGMKIIKAVARWR
                     WRA"
     CDS             577377..578876
                     /codon_start=1
                     /EC_number="4.1.3.27"
                     /locus_tag="KF707C_5200"
                     /note="aminase component"
                     /product="anthranilate synthase"
                     /protein_id="BAU72208.1"
                     /transl_table=11
                     /translation="MRLIMTREEFLRLAAEGYNRIPLAFETLADFDTPLSLYLKLADT
                     PYSYLLESVQGGEKWGRYSIIGLQSRTVLRAHGPRVTVSVDDVETESLECEDPLAFVE
                     DFKERYQVAPIAGLPRFNGGLVGYFGYDCVRYVEKRLANCPNPDPLGTPDILLMVSDA
                     VIVFDNLAGKLHAIVLVDPNQDDAFERGQAHLAELRRKLRLPVVPRLGVDPALPVEMQ
                     TDFRSSFTREDYEQAVRDIKEYILAGDCMQVVISQRMSVPFTAAPIDLYRALRCFNPT
                     PYMYFFNFGDFHVVGSSPEVLVRVEDGLVTVRPIAGTRPRGATEEADLALEEDLLSDA
                     KELAEHLMLIDLGRNDVGRVSSTGSVKVTEKMVIERYSNVMHIVSNVTGHLKEGVSAM
                     SALRAILPAGTLSGAPKIRAMEIIDQLEPVKRGVYGGAVGYLAWNGNMDTAIAIRTAV
                     IKDGELHVQAGAGIVADSVPALEWEETLNKRRAMFRAVALAEQTAKTDA"
     CDS             578887..579480
                     /codon_start=1
                     /EC_number="4.1.3.27"
                     /locus_tag="KF707C_5210"
                     /note="amidotransferase component"
                     /product="anthranilate synthase"
                     /protein_id="BAU72209.1"
                     /transl_table=11
                     /translation="MLLMIDNYDSFTYNVVQYLGELGADVHVIRNDELSIAEIEALNP
                     ERIVVSPGPCTPNEAGVSLDVIRHFAGKLPILGVCLGHQSIGQAFGGDVVRARQAMHG
                     KTSPVFHKDLGVFEGLNNPLTVTRYHSLVVKLETLPDALEVTAWTQHDDGSVDEIMGL
                     RHKTLNIEGVQFHPESILTEQGHELLANFLKQTGGVR"
     CDS             579482..580531
                     /codon_start=1
                     /EC_number="2.4.2.18"
                     /locus_tag="KF707C_5220"
                     /product="anthranilate phosphoribosyltransferase"
                     /protein_id="BAU72210.1"
                     /transl_table=11
                     /translation="MDIKEALNRVVNQLDLTTEEMQDVMRQIMTGQCTDAQIGAFLMG
                     MRMKSETIEEIVGAVSVMRELAVRVELSDLARVVDVVGTGGDGANIFNVSSAATFVVA
                     AAGGKVAKHGNRAVSGKTGSADVLEAAGIYLDLKPEQVARCIEHIGVGFMFAQVHHRA
                     MKYAAGPRRELGLRTLFNMLGPLTNPAGVKHQVVGVFSQALCRPLAEVLKRLGSEHIL
                     VVHSKDGLDELSLAAPTHVAELKGGEVTEYQIQPEDFGIKSQSLIGLTVGSPQESLEL
                     IRDALGKRKTESGQKAADMIVLNAGAALYAADLASSLKEGVRLAQDALHTGLAREKLD
                     ELASFTAVFRVENEA"
     CDS             580528..581364
                     /codon_start=1
                     /EC_number="4.1.1.48"
                     /locus_tag="KF707C_5230"
                     /product="indole-3-glycerol phosphate synthase"
                     /protein_id="BAU72211.1"
                     /transl_table=11
                     /translation="MSIPTILEKILARKAEEVAERRARVSLAEVEALARSADAPRGFA
                     RALMERAERHQPAVIAEVKKASPSKGVLREHFVPAQIARSYEAGGAACLSVLTDIDFF
                     QGSDAYLQEARAACSLPVIRKDFLIDPYQVVEARAIGADCVLLIVSALEDGRMKELAA
                     TAREVGLDVLVEVHDSEELDRALNCLDTPLVGINNRSLHSFEVSLETTLDLLPRIPRD
                     RLVVTESGILNRADVELMEVSGVYAFLVGEAFMRAEEPGTELGRLFFPERNRVVAGID
                     PD"
     CDS             complement(581461..582105)
                     /codon_start=1
                     /locus_tag="KF707C_5240"
                     /product="cyclic AMP receptor protein"
                     /protein_id="BAU72212.1"
                     /transl_table=11
                     /translation="MVAITLTPKIKSLDKLLAHCHRRRYTAKSTIIYAGDRCETLFII
                     IKGSVTILIEDDDGREMIIAYLNPGDFFGEMGLFEKEGTEKERSAWVRAKTECEVAEL
                     SYAKFRELTQQDPEILYALGSQMADRLRNTTRKVGDLAFLDVTGRVARTLLDLCKQPD
                     AMTHPDGMQIKITRQEIGRIVGCSREMVGRVLKSLEEQGLVNVKGKTMVVFGTR"
     CDS             582290..582757
                     /codon_start=1
                     /locus_tag="KF707C_5250"
                     /product="OsmC/Ohr family protein"
                     /protein_id="BAU72213.1"
                     /transl_table=11
                     /translation="MISYRTFFRAEFQVMKARIQWAGEALFLGESGSGHVVVMDGPPE
                     SGGRNLGVRPMEMLLLGLGGCTNFDVVSILKKGRQPVESCEAFLEAERAGEDPKVFTR
                     IHVHFVVKGRGLKEAQVKRAVELSAEKYCSASIMLGRAGVEITHDYEIVELGA"
     CDS             583004..583798
                     /codon_start=1
                     /EC_number="4.1.1.50"
                     /locus_tag="KF707C_5260"
                     /note="prokaryotic class 1A"
                     /product="S-adenosylmethionine decarboxylase proenzyme"
                     /protein_id="BAU72214.1"
                     /transl_table=11
                     /translation="MKSKLKLHGFNNLTKTLSFNIYDICYAETPEDQQAYVQYIDEEY
                     DAERLTQILTDVVDIIGANILNIARQDYDPQGASVTILISEQPVTPTDSQIEESPGPL
                     PETILAHLDKSHITVHTYPEIHPVSGIATFRVDIDVSTCGVISPLKALNYLIHQFDSD
                     IVTVDYRVRGFTRDVEGRKHFIDHEINSIQNYLSDDTRDAYQMTDVNVYQENLFHTKM
                     LLKDFELDNYLFGDATRNLTSGQRKEVEERLRHEMLEIFYARNMPH"
     CDS             complement(583897..584544)
                     /codon_start=1
                     /locus_tag="KF707C_5270"
                     /product="uncharacterized hydroxylase PA0655"
                     /protein_id="BAU72215.1"
                     /transl_table=11
                     /translation="MTSERSYSPADRLLLQADAALRTLLPFTGQPYRASPAEGLPESD
                     MDADEARHVAGLMRINHTGEVCAQALYQGQALTAKLPDIRAAMEHAAEEEIDHLAWCE
                     QRIRELGSHPSVLNPVFYGLSFGIGAVAGLISDRVSLGFVAATEDQVCKHLDEHLEQL
                     PTDDARSRAILQQMRTDEEQHATSAIEAGGLRFPAPVKFGMTLLSKVMTKSTYRI"
     CDS             complement(584635..584973)
                     /codon_start=1
                     /EC_number="3.6.1.17"
                     /locus_tag="KF707C_5280"
                     /note="asymmetrical"
                     /product="bis(5'-nucleosyl)-tetraphosphatase"
                     /protein_id="BAU72216.1"
                     /transl_table=11
                     /translation="MDCLFCKIAAGDIPSRKIYEDDRVVAFHDVAPQAPVHFLVIPRQ
                     HISRLTDLTEDDRTLVGHIAYTAQRLAAELGCDEGFRLVMNCNELGGQTVFHIHMHVL
                     GQRQLHWPPG"
     CDS             585064..586545
                     /codon_start=1
                     /locus_tag="KF707C_5290"
                     /note="AAA family"
                     /product="ATPase"
                     /protein_id="BAU72217.1"
                     /transl_table=11
                     /translation="MKNDIHDLGLVLDSRVKLILIESWDERRVLETLTSLAVKRGLGL
                     FTWAVSEGLQRLGFGGDGLGEGDSRDPELALRLIKGDPQPNLYVMCDLHPFLGDNPKV
                     VRLLKEVAMAEGNHKPTLVLVSHALKLPPEVQRFAARFDLALPGEDELLSIVREEASR
                     WSERNRGARVRTDNRTLQQVLKNLRGMSHGEARALARNVICDDGAITQEDLPELNKAK
                     FQLLDLEGVLSFEYETARFAEVGGLANLKRWLAERQSALLDDKGRDRPRGVLLVGVQG
                     GGKSLAAKAVAGLWGLPLLRLDFACLYNKFFGETERNLREALKLAEQMAPCVLWMDEV
                     EKGLASGDHDGGVSQRVLGTLLTWMAERKAPVFLVATANAIDRLPPELLRKGRFDELF
                     FVDLPQAEVRAEIFRIHLARRELDPAQFDLHQLAAASDGFAGAEIEQAVVGALYAAQA
                     RQCPVDQALLLAELKGTAPLSVLMAERLVELRTWAEGRCVKAD"
     CDS             complement(586551..587339)
                     /codon_start=1
                     /locus_tag="KF707C_5300"
                     /product="oxidoreductase, short chain
                     dehydrogenase/reductase family"
                     /protein_id="BAU72218.1"
                     /transl_table=11
                     /translation="MPRYALITGASSGIGLALAEALARRGRHLLLVARQRDALESIAC
                     ELTQRFGVEVLFRCCDLAEPLQVSGLLMELEQGEREFDLLVNNAGIGSSGAFIDQDWG
                     REQELIELNIIALTRLCHSIGGLMARDGGGQILNVASVAAFQPGPWMSSYYASKAFVL
                     HFSEALREELRPRGVKVSVLCPGPTRTAFFRGAHLKVDSLEGSKLMMSPEEVALATVR
                     ALDKNRAIIIPGWRNRLAVLLPRLAPRWLVRRLLGRIVRRFAQP"
     CDS             complement(587395..588429)
                     /codon_start=1
                     /locus_tag="KF707C_5310"
                     /note="FIG00954311"
                     /product="hypothetical protein"
                     /protein_id="BAU72219.1"
                     /transl_table=11
                     /translation="MTEARYKIIFDGEPMPGVALETVKDNLARLFKSDASRIESLFGG
                     RSVALKRDLLEAEADKYLAALLKAGAKVRKEQDSSSGLSLLATDDHPDPAAPASAQDD
                     YQTMDCPKCGHTQPKSAECQACGVIIEKYLARQAQLADEAVQASTTIGTVGEPASPYA
                     PPQAQVGESLPEFGELKVFSLQGRIGRLRYLAWSTVMMLAFLPIGILIFSSSVLSETV
                     AAIVTVLVSLAVIAVSVCMGVQRVHDMGWSGWLWLLNFVPVIGWVFSLLMLFMPGTAG
                     ANRYGPPPPPNSRAVKVLACLFLVPIMGIIAAIAIPAYQDYVMRAQLESPASFEAPAE
                     MPAIQDQSAQ"
     CDS             complement(588588..589550)
                     /codon_start=1
                     /locus_tag="KF707C_5320"
                     /product="dioxygenases related to 2-nitropropane
                     dioxygenase"
                     /protein_id="BAU72220.1"
                     /transl_table=11
                     /translation="MSLPALLDQRLRLPLVAAPMFLVSTPQLVLACSNSGIVGSFPAL
                     NQRESSGFRDWLDEIEAGLTAEAAPFAVNLIVHPSNPRLQADLAICVEKRVPIVITSL
                     GAVKEVVDAVHSYGGLVFHDVTTRRHAEKAAEAGVDGLIAVAAGAGGHAGTWSPFALV
                     AEIRQFFDRTLLLAGCLNHGHEVFAAQMLGVDLAYLGTRFIATRESAADDAYKQMILD
                     ARAADIVHTPAVSGVPASFMRQSLEAAGYDLKRLTDKADINYGEKLKPISDEAKAWKT
                     VWSAGQGVGGIDDLPTVRELVARLDREYRVARENAGQLGQRWPR"
     CDS             complement(589571..589996)
                     /codon_start=1
                     /EC_number="1.3.-.-"
                     /locus_tag="KF707C_5330"
                     /note="novel form, HemJ"
                     /product="protoporphyrinogen IX oxidase"
                     /protein_id="BAU72221.1"
                     /transl_table=11
                     /translation="MLYLWLKALHIVAIVCWFAGLFYLPRLFVYHAMAEDSPSRERFK
                     IMERKLYRGIMGPSMIATLVFGLWMLYLNPAWFSQGWLHAKLTLVVLLIGYHHACGSL
                     LKRFARDENRRGHVFFRWFNEVPVLFLIAIVVLVVVKPF"
     CDS             590130..591164
                     /codon_start=1
                     /EC_number="1.2.1.38"
                     /locus_tag="KF707C_5340"
                     /product="N-acetyl-gamma-glutamyl-phosphate reductase"
                     /protein_id="BAU72222.1"
                     /transl_table=11
                     /translation="MVKVGIVGGTGYTGVELLRLLAQHPQAEVAVITSRSEAGVKVAD
                     MYPNLRGHYDNLSFSVPDVATLGGCDVVFFATPHGVAHALAGELLDAGTRVIDLSADF
                     RLQDAEEWAKWYGQPHGAPALLPEAVYGLPEVNRESIKGARLIAVPGCYPTAAQLGFI
                     PLLEAGLADTSRLIADCKSGVSGAGRGAKVGSLFCEAGESMMAYSVKGHRHLPEISQG
                     LRRAAGGDVGLTFVPHLTPMIRGIHATLYANVADKGVDLQALFEKRYANEPFVDVMPA
                     GSHPETRSVRGANVCRIAVHRPQGGDLVVVLSVIDNLVKGASGQAVQNLNIMFGLEER
                     LGLSHAALLP"
     CDS             591298..591648
                     /codon_start=1
                     /locus_tag="KF707C_5350"
                     /product="probable iron binding protein from the
                     HesB_IscA_SufA family"
                     /protein_id="BAU72223.1"
                     /transl_table=11
                     /translation="MSVETFTPSALMFTEGAASKVKNLIDEEGNPRLKLRVFVTGGGC
                     SGFQYGFTFDEDVADDDTIVERDGVSLVVDPMSFQYLAGAEVDYQEGLEGSRFVIKNP
                     NASTTCGCGQSFSI"
     CDS             complement(591712..592803)
                     /codon_start=1
                     /EC_number="2.7.1.-"
                     /locus_tag="KF707C_5360"
                     /product="anhydro-N-acetylmuramic acid kinase"
                     /protein_id="BAU72224.1"
                     /transl_table=11
                     /translation="MARYLGVMSGTSLDGLDIALVEQTDRLRLLDTHYIPMPGSLRRE
                     LLALCSSGPDELARAALAENGWVELAATGINALLVRNSLGPADIRAVGSHGQTVRHEP
                     ARGFTIQIGNPALLAELTGITVVSDFRRRDVAAGGQGAPLVPAFHESLFGDGLNHRAV
                     LNVGGFSNLSLIEPGKPVHGFDCGPGNVLMDAWIHLQRGDSFDRDGAWAASGIPQRRL
                     LDTLFADPFFATRGPKSTGRELFNLSWLQSHLARLPRFKPEDVQATLLELTARSIIDA
                     LRTAQGRTDDLLVCGGGAHNLQLMHRLAELLPGTRVCSTQALGIDPDWVEAMAFAWLA
                     HCCLEGIPTNRPSVTGAKGLRVLGAIYPA"
     CDS             complement(592808..594244)
                     /codon_start=1
                     /locus_tag="KF707C_5370"
                     /product="peptidase, M23/M37 family"
                     /protein_id="BAU72225.1"
                     /transl_table=11
                     /translation="MTHSVPKAPPYPKSHLLAASGVAALLSLALLVFPSREVEAKKTY
                     INLELESGSEMVIQEKDDLRPGSTTGDEASSPFARIETPTENQNSAGKDADKNQQNTD
                     LTTTQKPTDPSLKTVTVSNGDTLSTVFAKVGLSANVLHDVLNSSRDAKQLSRLKVGQS
                     FEFKLTPSGEIERLSTKLSSLESVHLEKTPKGYAFKRDLIKPELRSAYARGVIDSSLF
                     LSAKRAGLSHDLTMNLANVFGYDIDFALDIREGDEFEVIYEEKVVDGKKVGSGEILAA
                     RFINRGKTFTAIRYVDRQGSATYLRGDGTAMRKAFIRTPVDFARISSRFSNGRRHPIL
                     NKIRAHKGVDYAAPRGTPIKATGDGKIVLAGRRGGYGNAVIIQHGSKYRTLYGHMQGF
                     AKGIRTGGSVKQGQIIGYVGTTGLSTGPHLHYEFQVNGVHVDPLGVKLPMADPLLAAE
                     KRRFLQMSQPLLARMDREKASMLALNKR"
     CDS             594429..595628
                     /codon_start=1
                     /EC_number="6.1.1.1"
                     /locus_tag="KF707C_5380"
                     /product="tyrosyl-tRNA synthetase"
                     /protein_id="BAU72226.1"
                     /transl_table=11
                     /translation="MKSVEEQLALIKRGAEEVLVESELVEKLKRGQPLRIKAGFDPTA
                     PDLHLGHTVLINKLRQFQELGHQVIFLIGDFTGMIGDPSGKSATRPPLTRDQVLENAE
                     TYKAQVFKILDPARTEVAFNSTWMDQLSPADFIRLASQYTVARMLERDDFNKRYSTNQ
                     PIAIHEFLYPLVQGYDSVALRADIELGGTDQKFNLLMGRELQRAYGQESQCILTMPLL
                     EGLDGVKKMSKSLGNYVGIQEAPGVMYNKLVSIPDQLMWRYFELLSFRSMDEIGQFKR
                     DVEEGANPRDIKIKLAEEIVARFHGEEAAATAHRSAGNRMKDGELPVDLPEVQLSSVE
                     DMPIASVLNKAGLVKNAAVARDLLGSGGVRVDGQAVDRGFLFKLGSTHVLQAGKKSFA
                     RVSLVSE"
     rRNA            596117..597608
                     /locus_tag="KF707C_t150"
                     /product="tRNA-Ile"
     tRNA            597692..597768
                     /locus_tag="KF707C_t160"
                     /product="tRNA-Ile"
     tRNA            597801..597876
                     /locus_tag="KF707C_t170"
                     /product="tRNA-Ala"
     rRNA            598107..601006
                     /locus_tag="KF707C_r20"
                     /product="23S rRNA"
     rRNA            601135..601254
                     /locus_tag="KF707C_r30"
                     /product="5S rRNA"
     CDS             602381..603130
                     /codon_start=1
                     /EC_number="2.7.1.33"
                     /locus_tag="KF707C_5390"
                     /note="CoaX-like"
                     /product="pantothenate kinase type III"
                     /protein_id="BAU72227.1"
                     /transl_table=11
                     /translation="MILELDCGNSFIKWRVVDEVLASTVEGGVVGSDEQLLAALAGKM
                     ASALSYCRLVSVRTDEETQSLISRLEAALGVCCVRAMPSDELGGVRNGYTEYRRLGMD
                     RWLAVVGAYHLARKPCLVIDLGTAVTSDLVTGKGEHLGGFICPGMPLMRNQLRTHTRR
                     IRYDDSAAEQALHDTAPGRSTAEAVERGCLLMLRGFVQSQVELAAEHLGSEFEVFLTG
                     GDAQLVQEAVPRARVLPDLVFVGLAIACPLR"
     tRNA            603957..604041
                     /locus_tag="KF707C_t180"
                     /product="tRNA-Tyr"
     tRNA            604067..604140
                     /locus_tag="KF707C_t190"
                     /product="tRNA-Gly"
     tRNA            604167..604242
                     /locus_tag="KF707C_t200"
                     /product="tRNA-Thr"
     CDS             604328..605521
                     /codon_start=1
                     /locus_tag="KF707C_5400"
                     /product="translation elongation factor Tu"
                     /protein_id="BAU72228.1"
                     /transl_table=11
                     /translation="MAKEKFERNKPHVNVGTIGHVDHGKTTLTAALTKVCSETWGGSA
                     RAFDQIDNAPEEKARGITINTSHVEYDSAVRHYAHVDCPGHADYVKNMITGAAQMDGA
                     ILVCSAADGPMPQTREHILLSRQVGVPYIVVFLNKADMVDDAELLELVEMEVRDLLNT
                     YDFPGDDTPIVIGSALMALEGKDDNGIGVSAVRKLVETLDSYIPEPVRAIDQPFLMPI
                     EDVFSISGRGTVVTGRVERGIVKVGEEIEIVGIRPTTKTTCTGVEMFRKLLDEGRAGE
                     NIGALLRGTKRDDVERGQVLAKPGTIKPHTKFECEVYVLSKEEGGRHTPFFKGYRPQF
                     YFRTTDVTGNCELPEGVEMVMPGDNIKMVVTLIAPIAMEDGLRFAIREGGRTVGAGVV
                     AKIFE"
     tRNA            605575..605650
                     /locus_tag="KF707C_t20"
                     /product="tRNA-Trp"
     CDS             605698..606066
                     /codon_start=1
                     /locus_tag="KF707C_5410"
                     /note="TC 3.A.5.1.1"
                     /product="preprotein translocase subunit SecE"
                     /protein_id="BAU72229.1"
                     /transl_table=11
                     /translation="MNAKAEAKEARFDVLKWVVVVALVAVGVVGNQYFSSEPILYRVL
                     ALLALATVAGFVSLQTAKGQAFFALAKEARAEIRKVVWPTRQETTQTTLIVVAVVLVM
                     ALLLWGLDTLLGWLVSMIVG"
     CDS             606131..606610
                     /codon_start=1
                     /locus_tag="KF707C_5420"
                     /product="transcription antitermination protein NusG"
                     /protein_id="BAU72230.1"
                     /transl_table=11
                     /translation="MRSLVERVKLAGMEDQFGEILVPTEEVVEMRNGQKRKSERKFFP
                     GYVLVQMEMSEATWHLIKDTPRVMGFIGGTADKPAPITEKEAEAILRRVADSGDKPKP
                     KTLFEPGETVRVVDGPFADFNGVVEEVNYEKSRIQVAVLIFGRSTPVELEFSQVEKV"
     CDS             606726..607157
                     /codon_start=1
                     /locus_tag="KF707C_5430"
                     /product="LSU ribosomal protein L11p (L12e)"
                     /protein_id="BAU72231.1"
                     /transl_table=11
                     /translation="MAKKIQAYIKLQVKAGQANPSPPVGPALGQHGVNIMEFCKAFNA
                     KTQGLEPGLPTPVIITVYSDRSFTFETKSTPASVLLKKAAGIASGSPRPNTQKVGTVT
                     RAQLEEIAKAKKADLTAADLDAAVRSIAGSARSMGLNVEGV"
     CDS             607157..607852
                     /codon_start=1
                     /locus_tag="KF707C_5440"
                     /product="LSU ribosomal protein L1p (L10Ae)"
                     /protein_id="BAU72232.1"
                     /transl_table=11
                     /translation="MAKLTKRQKAIAEKVEAGKQYAFEDAAKLLAELATSKFKESVDV
                     SINLGVDPRKSDQVVRGATVLPNGTGKSVRIAVFTQGAGAEAALAAGADKVGMDELAA
                     EMKGGDLNYDVVIASPDAMRVVGQLGQILGPRGLMPNPKVGTVTPDVATAVKNAKAGQ
                     VRFRTDKNGIIHASVGKIDFEPAKLKQNVEALLADLKRLKPSTSKGVYLKRVTLSSTM
                     GPGLQIDQASLEG"
     CDS             608063..608563
                     /codon_start=1
                     /locus_tag="KF707C_5450"
                     /product="LSU ribosomal protein L10p (P0)"
                     /protein_id="BAU72233.1"
                     /transl_table=11
                     /translation="MAIKLEDKKAIVAEVNEAAKAGLSAVVADARGVTVAAMTGLRKE
                     ARDAGVYVRVVRNTLARRAVAGTQFEVLNDVFKGPTLIAFSNEHPGAAARIFKEFAKG
                     QDKFEIKAAAFEGQFLAANQIDVLATLPTYDEAVAQLMSVIQGATSKLARTLAAIRDQ
                     KEGAAA"
     CDS             608645..609013
                     /codon_start=1
                     /locus_tag="KF707C_5460"
                     /product="LSU ribosomal protein L7/L12 (P1/P2)"
                     /protein_id="BAU72234.1"
                     /transl_table=11
                     /translation="MALTNEDIINAVSEMSVMQIVELIKAMEEKFGVTAAAAVAAGPA
                     VAAAAVEEQTEFTIVLAEAGEKKVNVIKVVRELTGLGLKEAKAVVDGAPGVVKEGASK
                     EEAEAAKKALEEAGAKVELK"
     CDS             609236..613309
                     /codon_start=1
                     /EC_number="2.7.7.6"
                     /locus_tag="KF707C_5470"
                     /product="DNA-directed RNA polymerase beta subunit"
                     /protein_id="BAU72235.1"
                     /transl_table=11
                     /translation="MAYSYTEKKRIRKDFSKLPDVMDVPYLLAIQLDSYREFLQAGVS
                     KEHFRDIGLHAAFKSVFPIISYSGNAALEYVGYRLGDPAFDVKECVLRGVTFAVPLRV
                     KVRLIIFDKESSNKAIKDIKEQEVYMGEIPLMTENGTFIINGTERVIVSQLHRSPGVF
                     FDHDRGKTHSSGKLLYSARIIPYRGSWLDFEFDPKDCVFVRIDRRRKLPASVLLRALG
                     YSTEEVLDAFYATNVFHVKGEGLHLELVPQRLRGEIAVFDIKDQSGKVIVEQGRRITA
                     RHINQLEKAGIKELEVPLDYVLGRTTAKAIVHPATGEIIAECNTELTTDLLVKIAKAQ
                     VVRLETLYTNDIDCGPFISDTLKIDSTGNQLEALVEIYRMMRPGEPPTKEAAETLFNN
                     LFFSAERYDLSAVGRMKFNRRIGRSEIEGSGVLSREDIVDVLKTLVDIRNGKGIVDDI
                     DHLGNRRVRCVGEMAENQFRVGLVRVERAVKERLSMAESEGLMPQDLINAKPVAAAIK
                     EFFGSSQLSQFMDQNNPLSEITHKRRVSALGPGGLTRERAGFEVRDVHPTHYGRVCPI
                     ETPEGPNIGLINSLATYARTNQYGFLESPYRVVKEGQVTDEIVFLSAIEEADHVIAQA
                     SATLNEKGQLVDELVAVRHLNEFTVKAPEDVTLMDVSPKQVVSVAASLIPFLEHDDAN
                     RALMGSNMQRQAVPTLRADKPLVGTGMERNVARDSGVCVVARRGGVIDSVDASRIVVR
                     VNDDEVETGEAGVDIYNLTKYTRSNQNTCINQRPLVQKGDVVARADILADGPSTDMGE
                     LALGQNMRVAFMPWNGFNFEDSICLSERVVQEDRFTTIHIQELTCVARDTKLGPEEIT
                     ADIPNVGEAALNKLDEAGIVYVGAEVQAGDILVGKVTPKGETQLTPEEKLLRAIFGEK
                     ASDVKDTSLRVPTGTKGTVIDVQVFTRDGVERDSRALSIEKMQLDEIRKDLNEEFRIV
                     EGATFERLRSALVGQTAEGGAGLKKGTEITDEYLDGLERGQWFKLRMSEDALNEQLEK
                     AQAYLSDRRQMLDDKFEDKKRKLQQGDDLAPGVLKIVKVYLAIKRRIQPGDKMAGRHG
                     NKGVVSVIMPVEDMPHDANGTPVDIVLNPLGVPSRMNVGQILETHLGLAAKGLGEKIN
                     RMLEEQRKIAELREFLHEIYNEIGGRQENLNELSDQEILDLAKNLKGGVPMATPVFDG
                     AKESEIKAMLKLADLPESGQMRLFDGRTGNQFERPTTVGYMYMLKLNHLVDDKMHARS
                     TGSYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEMLTVKSDDVNGRTKMY
                     KNIVDGDHRMEAGMPESFNVLIKEIRSLGIDIELETE"
     CDS             613376..617575
                     /codon_start=1
                     /locus_tag="KF707C_5480"
                     /product="DNA-directed RNA polymerase beta subunit"
                     /protein_id="BAU72236.1"
                     /transl_table=11
                     /translation="MKDLLNLLKNQGQIEEFDAIRIGLASPEMIRSWSFGEVKKPETI
                     NYRTFKPERDGLFCAKIFGPVKDYECLCGKYKRLKHRGVICEKCGVEVALAKVRRERM
                     GHIELASPVAHIWFLKSLPSRIGLLLDMTLRDIERVLYFESYVVIDPGMTTLEKGQLL
                     NDEQYFEALEEFGDDFDARMGAEAVRELLNAIDLDHEIGRLREEIPQTNSETKIKKLS
                     KRLKLMEAFKDSGNHPEWMVLTVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRN
                     NRLKRLLDLAAPDIIVRNEKRMLQEAVDALLDNGRRGRAITGSNKRPLKSLADMIKGK
                     QGRFRQNLLGKRVDYSGRSVITVGPTLRLHQCGLPKKMALELFKPFIFGKLEARGMAT
                     TIKAAKKMVERELPEVWDVLAEVIREHPVLLNRAPTLHRLGIQAFEPVLIEGKAIQLH
                     PLVCAAYNADFDGDQMAVHVPLTLEAQLEARALMMSTNNILSPANGEPIIVPSQDVVL
                     GLYYMTREAVNAKGEGRVFADLQEVDRVFRAGEASLHARVKVRINETVKDKDGSITKN
                     TRIVDTTVGRALLFQVVPAGLSFDVVNQPMKKKAISKLINQCYRVVGLKDTVIFADQL
                     MYTGFAYSTISGVSIGVNDFVIPDEKARIIDAATEEVKEIESQYASGLVTQGEKYNKV
                     IDLWSKANDEVSKAMMSNLSKEKVIDREGKEVDQESFNSMYMMADSGARGSAAQIRQL
                     AGMRGLMAKPDGSIIETPITANFREGLNVLQYFISTHGARKGLADTALKTANSGYLTR
                     RLVDVAQDLVVTEVDCGTEHGLLMTPHIEGGDVVEPLGERVLGRVIARDVFKPGSDEV
                     IVPAGTLVDEQWVEFIERMSVDEVIVRSPISCETRYGICAKCYGRDLARGHQVNIGEA
                     VGVIAAQSIGEPGTQLTMRTFHIGGAASRTSAADNVQVKNGGTIRLHNLKHVERLDGA
                     LVAVSRSGELAVADEFGRERERYKLPYGAVISVKEGDKVDPGAIVAKWDPHTHPIVTE
                     MKGTVTFVGMEEGITIKRQTDELTGLTNIEVLDPKDRPAAGKDIRPAVKLVDANGKEL
                     LLPGTDVPAQYFLPANALVGVADGAQVGVGDVIARIPQETSKTRDITGGLPRVADLFE
                     ARRPKEPSILAEISGTISFGKETKGKRRLVITPNDGTDPYEELIPKWRHLNVFEGEQV
                     NRGEVISDGPSNPHDILRLLGVSALAKYIVNEIQDVYRLQGVKINDKHIETILRQMLR
                     KVEIAESGDSSFIKGDQMELTQVLEENERLASEDRFIAKYERVLLGITKASLSTESFI
                     SAASFQETTRVLTEAAVTGKRDYLRGLKENVVVGRLIPAGTGLAYHSERKRQRDAGKP
                     VRVSASEVEAALTEALNSSSN"
     CDS             618219..618689
                     /codon_start=1
                     /locus_tag="KF707C_5490"
                     /product="SSU ribosomal protein S7p (S5e)"
                     /protein_id="BAU72237.1"
                     /transl_table=11
                     /translation="MPRRRVAAKREILDDPKYGSLILAKFMNHVMESGKKAVAERIVY
                     GALDTVKSRKNSDPLEIFEKALDAIAPLVEVKSRRVGGATYQVPVEVRPSRRNALAMR
                     WLVESARKRGEKSMALRLAGELLDAFDGKGAAVKKREDVHRMAEANKAFSHYRF"
     CDS             618708..620837
                     /codon_start=1
                     /locus_tag="KF707C_5500"
                     /product="translation elongation factor G"
                     /protein_id="BAU72238.1"
                     /transl_table=11
                     /translation="MARTTPINRYRNIGICAHVDAGKTTTTERILFYTGLSHKMGEVH
                     DGAATTDWMVQEQERGITITSAAITTFWEGSRGQYDKYRVNVIDTPGHVDFTIEVERS
                     LRVLDGAVVVFCGTSGVEPQSETVWRQANKYGVPRIVYVNKMDRAGADFLRVVGQIKN
                     RLGHTPVPVQLAIGAEDDFQGQIDLLKMKAVYWNEDDKGTSYREEEIPAELVDLASEW
                     RNNMVEAAAEANEELMNKYLEEGELSIEEIKAGLRQRTIACEIVPAVCGSSFKNKGVP
                     LVLDAVIDFLPAPTEIPAIQGVHPDSTDDNEIHDERPADDNAPFSALAFKIATDPFVG
                     TLTFVRVYSGVLESGNSVINSVKGKKERVGRMVQMHANQRDEIKEVRAGDIAALIGMK
                     DVTTGDTLCDIEKPIILERMDFPEPVISVAVEPKTKADQEKMGIALGKLAQEDPSFRV
                     KTDEETGQTIISGMGELHLDILVDRMKREFGVEANIGKPQVSYRETISKDNIEIEGKF
                     VRQSGGRGQFGHCWIRFSAPDVDEKGNIAEGLVFTNEVVGGVVPKEYIPAIQKGIEEQ
                     MKNGVVAGYPLIGLKATVFDGSYHDVDSNEMAFKIAASMATKQLAQKGGGKVLEPIMK
                     VEVVTPEDYMGDVMGDLNRRRGLIQGMEDSVSGKVIRAEVPLGEMFGYATDVRSMSQG
                     RASYSMEFSKYAEAPSNIVEALVKKQG"
     CDS             620868..622061
                     /codon_start=1
                     /locus_tag="KF707C_5510"
                     /product="translation elongation factor Tu"
                     /protein_id="BAU72239.1"
                     /transl_table=11
                     /translation="MAKEKFERNKPHVNVGTIGHVDHGKTTLTAALTKVCSETWGGSA
                     RAFDQIDNAPEEKARGITINTSHVEYDSAVRHYAHVDCPGHADYVKNMITGAAQMDGA
                     ILVCSAADGPMPQTREHILLSRQVGVPYIVVFLNKADMVDDAELLELVEMEVRDLLNT
                     YDFPGDDTPIVIGSALMALEGKDDNGIGVSAVRKLVETLDSYIPEPVRAIDQPFLMPI
                     EDVFSISGRGTVVTGRVERGIVKVGEEIEIVGIRPTTKTTCTGVEMFRKLLDEGRAGE
                     NIGALLRGTKRDDVERGQVLAKPGTIKPHTKFECEVYVLSKEEGGRHTPFFKGYRPQF
                     YFRTTDVTGNCELPEGVEMVMPGDNIKMVVTLIAPIAMEDGLRFAIREGGRTVGAGVV
                     AKIFE"
     CDS             622218..622529
                     /codon_start=1
                     /locus_tag="KF707C_5520"
                     /product="SSU ribosomal protein S10p (S20e)"
                     /protein_id="BAU72240.1"
                     /transl_table=11
                     /translation="MQNQQIRIRLKAFDHRLIDQSTQEIVETAKRTGAQVRGPIPLPT
                     RKERYTVLISPHVNKDARDQYEIRTHKRVLDIVQPTDKTVDALMKLDLAAGVEVQISL
                     G"
     CDS             622618..623253
                     /codon_start=1
                     /locus_tag="KF707C_5530"
                     /product="LSU ribosomal protein L3p (L3e)"
                     /protein_id="BAU72241.1"
                     /transl_table=11
                     /translation="MTIGVVGRKCGMTRIFTEEGVSIPVTVIEIEPNRVTQFKNEESD
                     GYRAVQVTVGERRASRVTKAQAGHFAKANVAAGRGVWEFRLEEGEFQAGDQLTAELFQ
                     AGQLVDVTGQSKGKGFAGTIKRWNFRGQDNTHGNSVSHRVPGSIGQCQTPGRVFKGKK
                     MSGHLGAERVTVQSLEVVRVDAERNLLLVKGAVPGATGGDVLVRPAAKARG"
     CDS             623268..623870
                     /codon_start=1
                     /locus_tag="KF707C_5540"
                     /product="LSU ribosomal protein L4p (L1e)"
                     /protein_id="BAU72242.1"
                     /transl_table=11
                     /translation="MQLNVNGAQAIEVSERTFGGEFNETLVHQAVVAYMAGGRQGTRA
                     QKTRSEVSGGGKKPWRQKGTGRARAGTIRSPIWRSGGTTFAAKPQDHSQKLNKKMYRA
                     ALRSILSELVRQERLVVVEDFAVEAPKTKALLGKLNGLGLTDVLIVSDAVDQNLYLAA
                     RNLPHVDVRDVQGSDPVSLIAYDKVLITVSAVKKFEELLG"
     CDS             623867..624166
                     /codon_start=1
                     /locus_tag="KF707C_5550"
                     /product="LSU ribosomal protein L23p (L23Ae)"
                     /protein_id="BAU72243.1"
                     /transl_table=11
                     /translation="MNQERVFKVLVGPHISEKATMLADGKSQFVFKVATDATKLEIKK
                     AVESLFNVKVAEVNTLNVKGKTKRTVRGLGKRNDWKKAYIALQPGQDLDFASSAE"
     CDS             624178..624999
                     /codon_start=1
                     /locus_tag="KF707C_5560"
                     /product="LSU ribosomal protein L2p (L8e)"
                     /protein_id="BAU72244.1"
                     /transl_table=11
                     /translation="MAIVKCKPTSAGRRFVVKVVNQELHKGAPYAPLVEKKSKSGGRN
                     NNGRITTRHIGGGHKQHYRLVDFRRNKDGIPAVVERIEYDPNRTAHIALLKYADGERR
                     YIIAPKGVSAGDQLISGVNAPIKAGNTLPLRNIPVGSTVHGIELKPGKGAQIARSAGA
                     SVQLVAREGAYVTLRLRSGEMRKVLAECRATLGEVSNSEHSLRSLGKAGAKRWRGVRP
                     TVRGVAMNPVDHPHGGGEGRTSGGRHPVSPWGFPTKGAKTRANKRTDNMIVRRRK"
     CDS             625014..625289
                     /codon_start=1
                     /locus_tag="KF707C_5570"
                     /product="SSU ribosomal protein S19p (S15e)"
                     /protein_id="BAU72245.1"
                     /transl_table=11
                     /translation="MPRSLKKGPFIDLHLLKKIEVAVEKNDRKPVKTWSRRSIILPQM
                     VGLTIAVHNGRQHVPVLVNEDMVGHKLGEFAGTRTYRGHAADKKAKR"
     CDS             625357..625635
                     /codon_start=1
                     /locus_tag="KF707C_5580"
                     /product="LSU ribosomal protein L22p (L17e)"
                     /protein_id="BAU72246.1"
                     /transl_table=11
                     /translation="MVADQIRGKKVGEALNLLTFSSKKAAEIMKKVLESAVANAEHNE
                     GADVDDLKVSTVFVNEGRSLKRIMPRAKGRADRIVKRSCHITVKVADK"
     CDS             625649..626335
                     /codon_start=1
                     /locus_tag="KF707C_5590"
                     /product="SSU ribosomal protein S3p (S3e)"
                     /protein_id="BAU72247.1"
                     /transl_table=11
                     /translation="MGQKVHPTGIRLGIVKEHTSVWYADKRTYADYLFADLKVREYLQ
                     DKLKSASVSRIDIARPAQTARITIHTARPGIVIGKKGEDVEKLRQDLTKQMGVPVHIN
                     IEEIRKPELDGMLVAQSVAQQLERRVMFRRAMKRAVQNAMRIGAKGIKIQVSGRLGGA
                     EIARTEWYREGRVPLHTLRADIDYATYEAHTTYGVIGVKVWIFKGEVIGGRQEELKPV
                     APAPRKKAAK"
     CDS             626348..626761
                     /codon_start=1
                     /locus_tag="KF707C_5600"
                     /product="LSU ribosomal protein L16p (L10e)"
                     /protein_id="BAU72248.1"
                     /transl_table=11
                     /translation="MLQPKRTKFRKQMTGHNRGLAHRGSKVSFGEFALKATGRGRLTA
                     RQIEAARRALTRHVKRGGKIWIRVFPDKPVTKKPLEVRMGKGKGGVEYWVAQIQPGKV
                     LYEIEGVSEELAREAFALAAAKLPLATSFVKRTVM"
     CDS             626761..626952
                     /codon_start=1
                     /locus_tag="KF707C_5610"
                     /product="LSU ribosomal protein L29p (L35e)"
                     /protein_id="BAU72249.1"
                     /transl_table=11
                     /translation="MKAKELREKTVEQLNEQLLGLLRDQFNLRMQKATGQLGQSHLLS
                     QVKRDIARVKTVLNQQAGK"
     CDS             626955..627221
                     /codon_start=1
                     /locus_tag="KF707C_5620"
                     /product="SSU ribosomal protein S17p (S11e)"
                     /protein_id="BAU72250.1"
                     /transl_table=11
                     /translation="MAEAQKTVRTLTGRVVSDKMDKTITVLIERRVKHPIYGKYVKRS
                     TKLHAHDETNQCRIGDKVTIRETRPLAKTKSWSLVEVVERAVEV"
     CDS             627244..627612
                     /codon_start=1
                     /locus_tag="KF707C_5630"
                     /product="LSU ribosomal protein L14p (L23e)"
                     /protein_id="BAU72251.1"
                     /transl_table=11
                     /translation="MIQTQSMLDVADNSGARRVMCIKVLGGSHRRYAGIGDIIKVTVK
                     EAIPRGKVKKGQVMTAVVVRTKHGVRRPDGSIIRFDGNAAVLLNNKQEPIGTRIFGPV
                     TRELRSEKFMKIVSLAPEVL"
     CDS             627625..627939
                     /codon_start=1
                     /locus_tag="KF707C_5640"
                     /product="LSU ribosomal protein L24p (L26e)"
                     /protein_id="BAU72252.1"
                     /transl_table=11
                     /translation="MQKIRRDDEIIVIAGKDKGKRGKVLKVLADSRVLVGGVNLIKRH
                     TKPNPMSGVQGGIVEREAPLHLSNVAIFNAETNKADRVGFKVEDGKKIRVFKSTQKPV
                     DA"
     CDS             627960..628499
                     /codon_start=1
                     /locus_tag="KF707C_5650"
                     /product="LSU ribosomal protein L5p (L11e)"
                     /protein_id="BAU72253.1"
                     /transl_table=11
                     /translation="MARLKEIYRNEIAPKLKEQLQLANVMEIPRITKITLNMGLGEAI
                     GDKKVIENAVADLEKITGQKAVVTYARKSIAGFKVREGWPIGVKVTLRRDRMYEFLDR
                     LLSISLPRVRDFRGLNAKSFDGRGNYSMGVKEQIIFPEIDYDKIDALRGLDITLTTTA
                     RTDEEGRALLRAFNFPFRN"
     CDS             628513..628818
                     /codon_start=1
                     /locus_tag="KF707C_5660"
                     /note="zinc-independent"
                     /product="SSU ribosomal protein S14p (S29e)"
                     /protein_id="BAU72254.1"
                     /transl_table=11
                     /translation="MAKQSMKNRELKRQRTVAKYAKKRAELKATIANPNSTPEARWEA
                     QVALQKQPRDASASRLRNRCRITGRPHGVYRKFGLGRNKLREAAMRGDVPGLVKASW"
     CDS             629010..629402
                     /codon_start=1
                     /locus_tag="KF707C_5670"
                     /product="SSU ribosomal protein S8p (S15Ae)"
                     /protein_id="BAU72255.1"
                     /transl_table=11
                     /translation="MSMQDPLADMLTRIRNAQMAEKSVVSMPSSKLKVAVADVLKNEG
                     YISGYQVSSDIKPLLSIELKYFEGRPVIEELKRVSRPGLRQYKSVDQLPKVRGGLGVS
                     IVSTNKGVMTDRAARAAGVGGEVLCTVF"
     CDS             629415..629948
                     /codon_start=1
                     /locus_tag="KF707C_5680"
                     /product="LSU ribosomal protein L6p (L9e)"
                     /protein_id="BAU72256.1"
                     /transl_table=11
                     /translation="MSRVAKNPVKLPAGVEIKLAGQQLSVKGAKGTLELKVHPSVEVL
                     EESGELRFAARNGDQQNKAMAGTTRALVNNMVIGVSQGFERKLQLVGVGYKAQAKGQV
                     LSLALGFSHPVDYELPQGITAETPSQTDILIKGIDKQLVGQVAAEIRDFRPPEPYKGK
                     GVRYADEVVRRKEAKKK"
     CDS             629959..630309
                     /codon_start=1
                     /locus_tag="KF707C_5690"
                     /product="LSU ribosomal protein L18p (L5e)"
                     /protein_id="BAU72257.1"
                     /transl_table=11
                     /translation="MSVKKETRLRRARKARLKMRELEAVRLCVYRSSQHIYAQVISAD
                     GAKVLASASTLDKELRDSATGNVDAAKKVGQLVAERAKAAGVTQVAFDRSGFKYHGRV
                     KALADAAREGGLEF"
     CDS             630313..630813
                     /codon_start=1
                     /locus_tag="KF707C_5700"
                     /product="SSU ribosomal protein S5p (S2e)"
                     /protein_id="BAU72258.1"
                     /transl_table=11
                     /translation="MANNEQKRDEGYIEKLVQVNRVAKTVKGGRIFTFTALTVVGDGK
                     GRVGFGRGKSREVPAAIQKAMEAARRNMIQVDLDGTTLQYPIKSAHGASKVFMQPASE
                     GTGIIAGGAMRAVLEVAGVQNVLAKCYGSTNPVNVVYATFKGLKNMQSPESVAAKRGK
                     SVEEIL"
     CDS             complement(630810..631100)
                     /codon_start=1
                     /locus_tag="KF707C_5710"
                     /product="hypothetical protein"
                     /protein_id="BAU72259.1"
                     /transl_table=11
                     /translation="MTAATSLAQTAADTTARTVLLATGTRRGTQIVQFHGLTLDTQKV
                     VSLVDHAAILRSVLNFDGVTNATQAETLDASLVVSQTAINALDQRYFDSCHD"
     CDS             631074..631430
                     /codon_start=1
                     /locus_tag="KF707C_5720"
                     /product="LSU ribosomal protein L15p (L27Ae)"
                     /protein_id="BAU72260.1"
                     /transl_table=11
                     /translation="MGKTGGRGHKGQTSRSGGTIAPGFEGGQQPLHRRLPKFGFVSLK
                     AMDRAEVRTSELAKVEGDVVTLQALKDANVINQNVQRVKVMLSGDVTRAVTLKGIAAT
                     KGARAAIEAAGGKFED"
     CDS             631431..632759
                     /codon_start=1
                     /locus_tag="KF707C_5730"
                     /note="TC 3.A.5.1.1"
                     /product="preprotein translocase secY subunit"
                     /protein_id="BAU72261.1"
                     /transl_table=11
                     /translation="MAKQGALSALSNGGLSELWARLRFLFLAIIVYRIGAHIPVPGIN
                     PDRLAELFRQNEGTILSLFNMFSGGALERMSIFALGIMPYISASIIMQLMTAISPQLE
                     QLKKEGEAGRRKISQYTRYGTVVLALVQAIGMSVGLAGQGVAFASDFGFHFVAVTTFV
                     AGAMFMMWLGEQITERGVGNGISMLIFAGIVAGLPSAIGQSFESARQGDINIFALVAI
                     GLLAVAIIGFVVFIERGQRRIAVHYAKRQQGRKVFAAQTSHLPLKVNMAGVIPAIFAS
                     SILLFPASLGAWFGQSESMGWLQDVAQAIAPGQPLNILLFSAGIIFFCFFYTALMFNP
                     KDVAENLKKSGAFIPGIRPGEQSARYIDGVLTRLTMFGALYMTAVCLLPQFLVVAANV
                     PFYLGGTSLLIVVVVVMDFMAQVQSHLVSHQYESLMKKANLKGYGGGMLR"
     CDS             complement(632784..633080)
                     /codon_start=1
                     /locus_tag="KF707C_5740"
                     /product="hypothetical protein"
                     /protein_id="BAU72262.1"
                     /transl_table=11
                     /translation="MLVIWNVDACNTGHSVKLQLTATYAPEAKKRARDISAVKTINQP
                     GSALAAGFTTRESHSALALFVTRFRAADHANDTVATDDLAVAAQLFHRCTNFHQ"
     CDS             633039..633395
                     /codon_start=1
                     /locus_tag="KF707C_5750"
                     /product="SSU ribosomal protein S13p (S18e)"
                     /protein_id="BAU72263.1"
                     /transl_table=11
                     /translation="MARIAGVNIPDNKHTVISLTYIYGVGRTTAQKICAVTGVNPAAK
                     IKDLSDEQIEQLRGEVAKLTTEGDLRREINMNIKRLMDLGCYRGLRHRRGLPVHGQRT
                     KTNARTRKGPRKPIRK"
     CDS             633426..633815
                     /codon_start=1
                     /locus_tag="KF707C_5760"
                     /product="SSU ribosomal protein S11p (S14e)"
                     /protein_id="BAU72264.1"
                     /transl_table=11
                     /translation="MAKPAARPRKKVKKTVVDGIAHIHASFNNTIVTITDRQGNALSW
                     ATSGGSGFRGSRKSTPFAAQVAAERAGQAALEYGLKNLDVNVKGPGPGRESAVRALNA
                     CGYKIASITDVTPIPHNGCRPPKKRRV"
     CDS             633834..634454
                     /codon_start=1
                     /locus_tag="KF707C_5770"
                     /product="SSU ribosomal protein S4p (S9e)"
                     /protein_id="BAU72265.1"
                     /transl_table=11
                     /translation="MARYIGPKCKLSRREGTDLFLKSGARALESKCNIESAPGQHGAR
                     RGRLSDYGTQLREKQKVRRIYGVLERQFSGYYKEAARRKGATGENLLQLLECRLDNVV
                     YRMGFGATRAESRQLVSHKSITVNGQTVNVPSFQIKAGDVVAVREKSKNQLRISQALE
                     LSAQRGRAEWVEVDAEKKSGVFKSVPARSDLSADINENLIVELYSK"
     CDS             634477..635478
                     /codon_start=1
                     /EC_number="2.7.7.6"
                     /locus_tag="KF707C_5780"
                     /product="DNA-directed RNA polymerase alpha subunit"
                     /protein_id="BAU72266.1"
                     /transl_table=11
                     /translation="MQSSVNEFLTPRHIDVQVVSQTRAKITLEPLERGFGHTLGNALR
                     RILLSSMPGCAVVEAEIDGVLHEYSAIEGVQEDVIEILLNLKGLAIKLHGRDEVTLSL
                     SKKGPGVVTAADIQLDHDVEIVNGDHVIANLADNGVLNMKLKVSRGRGYEPADARQSD
                     EDESRSIGRLQLDASFSPVRRVAYVVENARVEQRTNLDKLVIDLETNGTLDPEEAIRR
                     AATILQHQLAAFVDLKGDAEPVVVEQEDEIDPILLRPVDDLELTVRSANCLKAENIYY
                     IGDLIQRTEVELLKTPNLGKKSLTEIKDVLASRGLSLGMRLDNWPPASLKKDDKATA"
     CDS             635523..635912
                     /codon_start=1
                     /locus_tag="KF707C_5790"
                     /product="LSU ribosomal protein L17p"
                     /protein_id="BAU72267.1"
                     /transl_table=11
                     /translation="MRHRKSGRHLSRTSAHRKAMFQNMAVSLFEHELIKTTLPKAKEL
                     RRVAEPLITLAKEDSVANRRLAFDRTRSKAAVGKLFNDLGKRYANRQGGYLRILKCGF
                     RAGDNAPMAYVELVDRPVAGEVEAAAE"
     CDS             636221..638371
                     /codon_start=1
                     /EC_number="1.11.1.6"
                     /locus_tag="KF707C_5800"
                     /product="catalase"
                     /protein_id="BAU72268.1"
                     /transl_table=11
                     /translation="MTNQGKCPFNHVAGGGTTNRDWWPNQLRVDLLNQHSDKSNPLGA
                     KFNYAEEFKKLDYKALKADLVRLMTDSQDWWPADFGHYGPQMIRMAWHATGTYRTTDG
                     RGGGGRGQQRFAPLNSWPDNVNIDKTRRLLWPIKQKYGQKISWADLLVLAGNVALESM
                     GFRTFGFGAGREDVWEPDLDVNWGAEVAWLGVDAERVKDDRELTPPFGATHMGLIYVN
                     PEGPNASGDYMLAAKDIRATFGRMAMDDEETVALIAGGHTFGKAHGAAPESHKGPEPE
                     GAPIEAQGLGWMSSFGSGHGKDTISSGIEVTWTKTPALWSNNFFENLFKYEWELTTSP
                     AGAKQWVAKDAPEIIPDAHVPGKFHKPTMLTTDLTLRFDPEFGKISKRFLDDPQAFAD
                     AFARAWYKLTHRDMGPKARYLGPEVPKEDLIWQDPLPAPTHNPSAADIADLKSRIAAS
                     GLSVGDLVSVAWASASTFRGGDKRGGANGARLALAPQKDWPVNQRAMGALPKLVEIQQ
                     ASGKASLADVIVLAGNVGIELAAKAAGISVDVPFAPGRVDARQDQTDVDSFDVLEPAA
                     DGFRNYAKANLGVPTEAMLVDKAQLLTLTAPELTVLVGGLRVLGANYDGSQHGVFTDK
                     VGVLSNDFFVNLLDMATEWKPADASGEVFEGRDRKTGDLKFTGTRSDLVFGSNSVLRA
                     YAEVYASTDAKEKFARDFVAAWTKVMNLDRFDLA"
     CDS             complement(638419..641253)
                     /codon_start=1
                     /locus_tag="KF707C_5810"
                     /product="excinuclease ABC subunit A"
                     /protein_id="BAU72269.1"
                     /transl_table=11
                     /translation="MDKILIRGARTHNLKNVDLTLPRDKLIVITGLSGSGKSSLAFDT
                     LYAEGQRRYVESLSAYARQFLSMMEKPDVDTIEGLSPAISIEQKSTSHNPRSTVGTIT
                     EIYDYLRLLYARVGMPRCPDHDVPLEAQTVSQMVDQVLALPEGRKLMLLAPVVRERKG
                     EHLALFDELRAQGFVRARVNGKLYELDELPKLDKQKKHSIDVVVDRFKVRSDLQQRLA
                     ESFETAINLADGIALVAPMDDEEGEEIIFSARFACPHCGHSISELEPKLFSFNNPAGA
                     CPTCDGLGVKQFFDAKRLVNGELTLAEGAIRGWDRRNVYYFQMLGSLAAHYGFSLEKP
                     FDQLEAEDQKAVLFGSGRENVDFRYLNDRGDIVKRSHPFEGIIPNLERRYRETESATV
                     REELAKFLSTQPCPDCRGTRLRREARHVWVGDKTLPAVTGLPVGDASEYFGGLSLTGR
                     RGEIAEKILKEIRERLQFLVNVGLDYLTLDRSADTLSGGEAQRIRLASQIGAGLVGVM
                     YILDEPSIGLHQRDNERLLATLTHLRNLGNTVIVVEHDEDAIRLADYVVDIGPGAGVH
                     GGQIVAQGTPGEVMAHPESLTGKYLSGRVKIAVPPARTPRDKKKSLKLKGASGNNLQN
                     VNLEIPVGLLTCVTGVSGSGKSTLINNTLFPITATALNGATSLEAAPYDSFDGLQHLD
                     KVVDIDQSPIGRTPRSNPATYTGLFTPIRELFAGVPESRSRGYGPGRFSFNVKGGRCE
                     ACQGDGVIKVEMHFLPDIYVPCDVCKGKRYNRETLEVKYKGRSITEVLDMTIEEAREF
                     FDAVPAIARKLQTLMDVGLAYIRLGQSATTLSGGEAQRVKLSRELSKRDTGKTLYILD
                     EPTTGLHFADIQQLLDVLHRLRDHGNTVVVIEHNLDVIKTADWLVDLGPEGGSRGGQI
                     IATGTPEEVAEMPQSHTGRFLRPLLERDRA"
     CDS             641462..642856
                     /codon_start=1
                     /locus_tag="KF707C_5820"
                     /product="putative transport protein"
                     /protein_id="BAU72270.1"
                     /transl_table=11
                     /translation="MHDSHAERMSGSETRAAGGLALVFAFRMLGMFMVLPVLATYGQD
                     LAGATPALIGLAIGAYGLTQALLQIPFGILSDRIGRLPVIYAGLLIFAAGAALAANAD
                     SIWGVIAGRVLQGAGAISAAVMALLSDLTREQHRTKAMAMIGMSIGLSFAVAMVVGPL
                     LTRAFGLSGLFWATSLMALLGIVIIVALVPRAAHPLQHRESGVAGQALIPTLKHPDLL
                     RLDFGILALHAVLMASFVALPLALVEKAGLPREEHWWVYLTALLVGFFGMVPFIIYGE
                     KKRRMKRVLVGAVATLFLCELFFWGFGDSLRALVFGTIVFFTAFNLLEASLPSLISKV
                     APAGGKGTAMGVYSTSQFLGAALGGILGGWLFQHGGLSVVFIGCAAVCAIWVLIAVTM
                     REPPYVTSLRLPLSAAAVADTGLVARLLALPGVADAVVVAEEAAIYIKVDSEKLDRTS
                     LERLIQSAPERAEA"
     CDS             642866..643351
                     /codon_start=1
                     /locus_tag="KF707C_5830"
                     /product="single-stranded DNA-binding protein"
                     /protein_id="BAU72271.1"
                     /transl_table=11
                     /translation="MARGVNKVILVGNVGGDPETRYLPNGNAVTNITLATSESWKDKQ
                     TGQQQERTEWHRVVFFGRLAEIAGEYLRKGSQVYVEGSLRTREWEKDGVKRYTTEIVV
                     DINGQMQLLGGRPGADDGAPRAPRPQRESQQSAPQQRPAPQPAAQPAPDYDSFDDDIP
                     F"
     CDS             complement(643481..644359)
                     /codon_start=1
                     /locus_tag="KF707C_5840"
                     /product="aldose 1-epimerase"
                     /protein_id="BAU72272.1"
                     /transl_table=11
                     /translation="MKPDLICLEDPISRLTLAPALGGAIANWRLLEGDVPLLRPADDD
                     ALAAGTPRRLGCYPLAPWSNRIGAGGFAIPDGWLELTPNAEGEALPIHGSAWQQPWTL
                     LEQAGDLVRLGLESALPFAYRAEQRFRLRDGELEVRLRVTQVDERAIWHGLGLHPYFP
                     RTARTRLQAKADATWLCGPDKLPTRQVARPDEWNFDEHRPLPSSLVDNGFRGWPGHCR
                     ILQPDLGYQLDCSASGCDAFLLFCPEAQPFFCFEPVTHPVNAHHLEGRPGLTLLSPGQ
                     SLEITWRMAVRPLGTG"
     CDS             644482..645234
                     /codon_start=1
                     /locus_tag="KF707C_5850"
                     /note="GntR family"
                     /product="predicted D-glucarate or D-galactorate
                     regulator"
                     /protein_id="BAU72273.1"
                     /transl_table=11
                     /translation="MDTPSTQQRPRRKHRSLAQELVSELSQQIQSGVIKRGEKLPTES
                     AIMEAQGVSRTVVREAISRLQAAGLVETRHGIGTFVLDTPSPMGFRIDPATIVTLRDV
                     IAILELRISLEVESAGLAAQRRSPEQLKAIREALDVFLNAAHGTDAVGSDFQFHLQIA
                     LATGNRYFTDIMTHLGTSIIPRTRLNSARIAHADHEQYMARLVREHEEIYEAIARQDA
                     EAARAAMRLHLTNSRERLRQAHEEAEREQQEA"
     CDS             complement(645259..646170)
                     /codon_start=1
                     /locus_tag="KF707C_5860"
                     /product="membrane protein, putative"
                     /protein_id="BAU72274.1"
                     /transl_table=11
                     /translation="MPASLPFPRHIAVLMLVLLACAFAGNHIAARFAFDDGTGLLLAI
                     LCRSGVAMTVLTGLVLWQRQPLALPPGSRRWQLLLGLLIATQSLCLYSAVARIPVALA
                     LLVGNTFPIVLALLTWALGGGAPSRRNALLMGLILVGLVFALDVPARLAASEGAGPEW
                     TLGVGLAFCAACAFACALWITDHRLAGLRGPVRSMLTLMIVFASMAIAGASGLVPGGM
                     SPPSSPAGWVALGALVLLYGTAFSVLFVSVPRLNMPQNAPVMNVEPIATLLFGWVLLD
                     QVLGGMQLIGGAIVVAGIVLLTYRRDA"
     CDS             complement(646281..647561)
                     /codon_start=1
                     /locus_tag="KF707C_5870"
                     /note="large permease component"
                     /product="TRAP-type C4-dicarboxylate transport system"
                     /protein_id="BAU72275.1"
                     /transl_table=11
                     /translation="MDAFILLGSFILLILLGMPVAYALGLSALIGAWWIDIPLQAMMI
                     QVAGGVNKFSLLAIPFFVLAGAIMAEGGMSRRLVAFAGVLVGFVRGGLSLVNIMASTF
                     FGAISGSSVADTASVGSVLIPEMERKGYPREFSTAVTVSGSVQALLTPPSHNSVLYSL
                     AAGGTVSIGALFMAGVMPGLLLSAVMMGLCLLFAKKRNYPKGEVIPLRQALKIAGEAL
                     WGLMAMVIILGGILSGVFTATESAAIAVVWSFFVTMFIYRDYKWRDLPKLMHRTVRTI
                     SIVMILIAFAASFGYIMTLMQIPAKITTLFLTLSDNRYVILMCINAMLLLLGTVMDMA
                     PLILILTPILMPVITDIGVDPVHFGMIMLVNLGIGLITPPVGAVLFVGSAIGKVSIES
                     TVKALLPFYAALFLVLMAVTYIPAISLWLPSVVL"
     CDS             complement(647562..648089)
                     /codon_start=1
                     /locus_tag="KF707C_5880"
                     /note="small permease component, predicted
                     N-acetylneuraminate transporter"
                     /product="TRAP-type transport system"
                     /protein_id="BAU72276.1"
                     /transl_table=11
                     /translation="MKDTLLRFNDGLYMTCIWVAGLSVATMSLIIPWGIFARYVLGTG
                     SSWPEPVSILLMVVFTFVGAAASYRAGAHMAVGMLVDRLPQRIRLSASLLVQVLMALI
                     CLFMALWGAKLCATTWNQFVASLPGLRVGLTYAPIPIGGVLTLVFVLEKLLLGDQSHR
                     RVVQFDLVEENEGAA"
     CDS             complement(648154..649125)
                     /codon_start=1
                     /locus_tag="KF707C_5890"
                     /note="periplasmic component"
                     /product="TRAP-type C4-dicarboxylate transport system"
                     /protein_id="BAU72277.1"
                     /transl_table=11
                     /translation="MNLKRKLLVAALPFAFSLVGSAQALDIKFADVHPAGYPTVVAEQ
                     NMGRKLEEASKGEITFKMFAGGVLGSEKEVIEQAQIGAIQMARVSLGIVGPVVPDVNV
                     FNMPFVFRDHAHMRKVIDGEIGQEILDKITHSEFNLVALAWMDGGTRNLYTKEPVRSI
                     QDLQGKKIRVMGNPLFIDMMNAMGGNGIAMDTGEIFSALQTGVIDGAENNPPTMLEHN
                     HFQNAKYYTLTGHLILPEPLVMSKTTWNKLTPEQQALVKKVAREAQMEERALWDAKSA
                     ASEEKLKAAGVEFITVDKKPFFDATAPVREKYGAQYADLIQRIADVQ"
     CDS             complement(649192..650085)
                     /codon_start=1
                     /EC_number="3.1.1.17"
                     /locus_tag="KF707C_5900"
                     /product="gluconolactonase"
                     /protein_id="BAU72278.1"
                     /transl_table=11
                     /translation="MHAELILDARNATGESPVWHPREQALYWVDIPARRLHRWRLADG
                     ASQSWEADEMIACIARREDGRGGGWIAGMQSGVFQLQPGDDGRLQSTRLAPVEHAVPA
                     MRFNDGRCDRQGRFWAGTMLLDMAAGARVGALYRFDGESGPLTARLGDFIVPNGLAFS
                     PDGTRMYLSDSHPEVQAIWAFDYDTDSGIPYNRRLFVDMREFPGRPDGAAVDEDGCYW
                     ICGNDAGLVHRFTPDGRLDRSLAVPVKKPAMCAFGGPGLATLFVTSIRPAGDLSDQPL
                     AGGLFALSPGVKGLEEPVFRG"
     CDS             complement(650133..650954)
                     /codon_start=1
                     /EC_number="5.1.3.2"
                     /locus_tag="KF707C_5910"
                     /product="UDP-glucose 4-epimerase"
                     /protein_id="BAU72279.1"
                     /transl_table=11
                     /translation="MNPSQPASRCLKRILLTGAAGGLGKVLRETTRPFAEVLRLSDIA
                     AMAPAAGPHEEVIPCDLADKAAVDALVQGVDAILHFGGISVERPFEEILEANIRGVFN
                     LYEAARRHGVKRVVFASSNHVIGFYRQDQRLDAASPRRPDGYYGLSKSFGEDMASFYY
                     DRYGIETVSIRIGSSFPEPQNRRMMSTWLSYDDLTQLIEKSLFTPDVGHTLVYGMSDN
                     REVWWDNHLASHLGYRPKDSSEPFRAKVESQPAPAADDPVAVYQGGAFVAAGPFD"
     CDS             650940..651221
                     /codon_start=1
                     /locus_tag="KF707C_5920"
                     /product="hypothetical protein"
                     /protein_id="BAU72280.1"
                     /transl_table=11
                     /translation="MGRIHASGLSVVVIECVVICCRMTVVELSTGLLSVVNAAKVENS
                     SSYEAKHAAGRVIRSRCGDAGPVLNRSTAGFARDGAVARGEGPAVGRQR"
     CDS             651364..652275
                     /codon_start=1
                     /EC_number="4.2.1.41"
                     /locus_tag="KF707C_5930"
                     /product="5-dehydro-4-deoxyglucarate dehydratase"
                     /protein_id="BAU72281.1"
                     /transl_table=11
                     /translation="MNPQELKSILSSGLLSFPVTDFDAAGDFNAASYARRLEWLAPYG
                     ASALFAAGGTGEFFSLAPDEYSGIIKTAVDTCANSVPILAGVGGPTRVAIQYAQEAER
                     LGAKGLLLLPHYLTEASQEGVAAHVEQVCKSVNIGVVVYNRNVCRLTPALLEQLAERC
                     PNLIGYKDGLGDIELMVAIRRRLGDRFSYLGGLPTAEVYAAAYKALGVPVYSSAVFNF
                     IPKTAMDFYKAIARDDHETVGKLIDDFFLPYLEIRNRRAGYAVSIVKAGARISGYDAG
                     PVRAPLTDLLPDEYERLAALIDAQGAQ"
     CDS             652296..653741
                     /codon_start=1
                     /EC_number="1.2.1.26"
                     /locus_tag="KF707C_5940"
                     /product="2-ketoglutaric semialdehyde dehydrogenase"
                     /protein_id="BAU72282.1"
                     /transl_table=11
                     /translation="MAEQKRFDNFIGGEWVAGSGYSRNINPSDLSDCLGEYAQADAAQ
                     VAQAIAAARAAFPAWSVSGIQARADALDKVGSEILARREELGALLAREEGKTLPEASG
                     EVARAGNIFKFFAGECLRLSGEVIPSVRPGVGVEVTREPLGVIGMITPWNFPIAIPAW
                     KIAPALAYGNCVVFKPADLVPGSAWALAEIIARAGFPAGVFNLVMGSGRVVGEALVHD
                     TRVDGISFTGSVGVGRSIAASCVARGAKVQLEMGGKNPQVILDDADLKTAVELSVQSA
                     FYSTGQRCTASSRLIVTAGIHDRFIEAMAERMRAIRVGHALTSGVDIGPVVSQAQLEQ
                     DLRYIDIGRDEGARLVTGGERVRCDTEGYFMAPALFADSAADMRISREEIFGPVANVI
                     RVADYEEALALANDTEFGLSAGIATSSLKYANHFKRHAQAGMVMVNLPTAGVDYHVPF
                     GGRKGSSYGPREQGRHAQEFYTTVKTTYIGS"
     CDS             653939..655303
                     /codon_start=1
                     /locus_tag="KF707C_5950"
                     /product="D-galactarate permease"
                     /protein_id="BAU72283.1"
                     /transl_table=11
                     /translation="MGDVLKQTRVRYLILLMLFLVTTINYADRATISIAGSTMQKELG
                     IDAVMLGYIFSAFGWAYVLGQIPGGWLLDRFGSKRVYAVSIFTWSVFTLLQGFVDTLP
                     VAWTVVTLFMLRFLVGFAEAPSFPGNARIVAAWFPTAERGTASAVFNSAQYFATVLFA
                     PLMGWIVHSFGWEHVFIVMGVIGILFSGVWMKFIYNPKEHPLINQAEIDHIAANGALV
                     DMDQNRRLPGNGPKWAHIRQLVTSRMMVGIYLGQYCINAITYFFLTWFPVYLVQERGM
                     TILKAGIIASLPAICGFIGGVLGGVLSDGMLRRGHSLTLARKTPIVCGMLLSMSMILC
                     NYVEADWMVVGFMALAFFGKGIGALGWAVMSDTSPKQIAGLSGGIFNTCGNLSSITTP
                     IVIGYIIATTGSFKWALVFVGVNALLAAFSYLFIVGEIKRIELKGETPAATDPADGAV
                     NPVR"
     CDS             655381..656937
                     /codon_start=1
                     /EC_number="4.2.1.42"
                     /locus_tag="KF707C_5960"
                     /product="D-galactarate dehydratase"
                     /protein_id="BAU72284.1"
                     /transl_table=11
                     /translation="MQLIPHQDSPRYVRLHPDDNVAIVINEQGVAEGGRFPDGLVTRE
                     AIPQSHKVTLVDIPAGGAVLRYGTVIGHALQAIPRGTWVREELLSIPEAPALDRLPMA
                     TAVPPALPALPGYSFEGFRNPDGSVGTRNILGVTTTVQCVTGVLDHCVERVRKEVLPR
                     YPNVDDVVALTHSYGCGVAINAPDAVIPIRTLHNLARNPNLGGQALVIGLGCEKLQAE
                     QLMPGDALTAGQDEEAWLFRLQDSATGFSGMVEQIMGMIEDRLKVLDARRRETCPASE
                     LVLGMQCGGSDAFSGVTANPALGVAADLLVRAGATVMFSENTEVRDGIHLLTPRAATP
                     EVAQALVRELEWYDRYLARGMADRSANTTPGNKKGGLNNIVEKAMGSIAKSGNSAIAG
                     VVAPGERVRGKGLQFCATPASDFICGTLQLAAGMNLHVFTTGRGTPYGLSMVPVIKVS
                     TRTQLAERWPDLIDVDAGRITSGRVSLEELGWELFHYYLDVASGKQRTWAEKHRLHND
                     LTLFNPAPVT"
     CDS             656986..657903
                     /codon_start=1
                     /EC_number="1.1.1.95"
                     /locus_tag="KF707C_5970"
                     /product="D-3-phosphoglycerate dehydrogenase"
                     /protein_id="BAU72285.1"
                     /transl_table=11
                     /translation="MGPLTERFNQRLASGKDVVQLWRQGDALAYLDAHGSEFEILVTS
                     ARFGCSAAHLARLPRLRAICSFGVGYDAIAVDQARERGIPVSYTPDVLNDCVADLAMG
                     LMIDCARRISAADRFLRDGRWQTGQYPLARKVSGKRLGIVGLGRIGKDLARRAQAFDM
                     QVRYHNRRPDAGAPYGFEPDLLALARWADFLVLLCPGGAATRHLVSAPVLDALGPDGI
                     LINVARGSVVDEPALVAALLEGRLGGAGLDVFESEPQVPEALLGLDSVVLTPHVGSAT
                     EETRLAMEELVFANLAAFLETGELLTPVP"
     CDS             658546..659913
                     /codon_start=1
                     /locus_tag="KF707C_5980"
                     /product="mobile element protein"
                     /protein_id="BAU72286.1"
                     /transl_table=11
                     /translation="MAIQQALHQMPGKPGRDGAATGEARRGASSDEAGCPRHDQNHTG
                     SGLLQEVLTRENLQLALKRVRANKGVAGVDGLGIDETVEHLKTAWPAIRAQLLAGTYR
                     PSPVRRVLIPKPEGGERKLGIPTVTDRLIQQALLQILQPLLDPGFSDHSYGFRPGRSA
                     HQAVLAAQRYIHSGRNILVDVDLEQFFDRVDHDLLIARLSRKVTDRGVLRLVRAYLNS
                     GTLIDGVVVASERGTPQGGPLSPLLANVLLDEVDKELERRGHCFVRYADDANVYVRSL
                     KAGQRVMAVLRRLYDRLRLQVNERKSAIASAFGRKFLGYSFWLSAQGEIKRGVASQAL
                     QRFKSRIRQLTSRNGGRSVSQVVESLRPYLLGWKAYFGLSQTPRRWRGFDEWIRRRLR
                     AIQLKQWKTGRRTYRELRKLGAWPDLAAAIAGNSHRFWHNSVGLIHGVLTVAWFDRLG
                     LPRLC"
     CDS             complement(660339..661601)
                     /codon_start=1
                     /locus_tag="KF707C_5990"
                     /product="PhaK-like protein"
                     /protein_id="BAU72287.1"
                     /transl_table=11
                     /translation="MTLRNALKSSLAASATLACGLALLPASVHAAGFAEDAKVGLNLR
                     NFYINRNFVDPTYPQGKAEEWTQSFILDARSGFTEGPVGFGVDALGLLSVKLDGGRGT
                     RGTQLLPVHDDGRPADDFGRLALAGKMLVSSTELKVGEWMPVLPILRADDGRSLPQTF
                     QGGQVTSKEIDGLTLYGGQFRQNSPRNDASLEDLSMNGKAAFTSDRFNFAGGEYAFNE
                     NRTLVGLWYAELEDIYQQQYLQVMHSQPVGDWTLGANLGFFNGKEDGSALAGDLDNRT
                     WSALLSARYGGNTFYVGLQKVGGDDAWMRVNGTSGGTLANDSYNSSYDNAKEKSWQLR
                     HDYNFAALGIPGLTLMNRYISGDDVHTGAVTDGKEWGRETELGYTVQSGAFKALNLKW
                     RNASIRRDFSNNEFDENRLIINYPLSIL"
     CDS             661629..661943
                     /codon_start=1
                     /locus_tag="KF707C_6000"
                     /product="hypothetical protein"
                     /protein_id="BAU72288.1"
                     /transl_table=11
                     /translation="MSRPPARRERTSTWGHWGSGWRAGQRSAAASRRRIRWVPWGRGR
                     RHGRAVGGGPGGMVRRSAGRGSWSGPERMSCCYFCHTSSYNVARLSTGLVALVNADTA
                     FV"
     CDS             complement(662033..664450)
                     /codon_start=1
                     /locus_tag="KF707C_6010"
                     /product="ferrichrome-iron receptor"
                     /protein_id="BAU72289.1"
                     /transl_table=11
                     /translation="MTSPRASRLALAVRGALISAALAAPLLPAAGWADQAAEVASRSY
                     AIPAGPLGDALNRFAREAGINLAATPAQVRGLRSPGLSGNHGVEAGLARLLEGSGLQA
                     EDLGNGSFVVREVSSGAALEVPSTQVFALGNALGSADGYLATHSQIATKTSKALLETS
                     QSVSVVTREQIDDQGSKTVQQAMRYTPGIFTGQVGASNRYDYIVMRGFADNSVDNVYL
                     DGLKTMGDSGTFSSLQVDPYFLERIDVLKGPSSVLYGRSLPGGLVALTSKKPLYEDYH
                     QVQATLGNLDQKGLGFDFSGPLDEEKRIAYRLVGLGKGGDTQFDHTRDERYAIAPTLA
                     IDFSDDTTLTLLGYLQHDPNGGYHSGVPADGSLYPHNGRRIDRDFFDGEPALDDFDRT
                     QRMVGYQLEHRFDDVWSARQNLRYLSAQVDLSQVYGYQWTGAGSNALNRYFSGASEDL
                     DAYILDNMVQAEFDWGPARHTLLTGLDYQKRKAKVDWTSASVSPLDAFDPVYGNATLG
                     PLYEDNHTRRLEQTGLYLQDLVDLDRWRFSLGLRQDWVDVSDQNRSTGGRSEGDWSRF
                     TGRAGVLYLFDNGVAPYISYSESFNPNAYSDNAGKPLEPTEGKQWEAGLKFQPADSDS
                     LYTASLFHIVQQNVASKLPQNSYYESVGEVRSQGLELEANTQLTDQLKVLASYTYTDI
                     TYSESVDKAVQGNTPNQAPRHMASIWGQYDFDAGALDGLRTGLGVRYVGRSWADKENT
                     LRVPSYTLVDALIGYDLGKLGLKGMDLSLNANNLLDEDYVASCYSLDFCYFGEQRNLT
                     ATLGYQF"
     CDS             complement(664564..665523)
                     /codon_start=1
                     /locus_tag="KF707C_6020"
                     /product="iron siderophore sensor protein"
                     /protein_id="BAU72290.1"
                     /transl_table=11
                     /translation="MNPTSRSASPDEPVVRQAIAWMLRLRGKADLDLQRACEHWRGQS
                     DSHELAWQRVQQLEQELGLGLKAMPGTANLLDDARTGLRRRQALKLLSGAALGGSALW
                     LTRDLAPWERLTADLATATGERRSQALADGSRLLLNTDSAVDLRFDGRQRLIRLRRGE
                     ILVDGSAGPLRVMTDHGLLDARDARFVLRQGRASSRVSVLEGQVRLGSASGLHRQQAD
                     AGQSLDLLQDGIRPVTRLDQEPGAWAEGLIVTRDMRLADFLAEVARYRHGRLACSEPV
                     ADLRLSGVYRLDDTERLLALLPQALPVRLHYRTRWWVTVEARA"
     CDS             complement(665520..666017)
                     /codon_start=1
                     /locus_tag="KF707C_6030"
                     /product="RNA polymerase sigma-70 factor, ECF subfamily"
                     /protein_id="BAU72291.1"
                     /transl_table=11
                     /translation="MPSPLSIQTLYSEHHGWLRSWLRSRLGNAADAADLAQDTFLRLL
                     GKGELPDLRTPRAFLRTVARGLVIDHWRREEVERAYREALAHLPEAVAPSPEERELIL
                     ELLERVARLLDRLKPRARMAFLLAQCEGLTQKEVAERMGISLRSVERYIADALYQCYL
                     LRFEE"
     CDS             complement(666041..666208)
                     /codon_start=1
                     /locus_tag="KF707C_6040"
                     /product="hypothetical protein"
                     /protein_id="BAU72292.1"
                     /transl_table=11
                     /translation="MGVHAALVSVATPVGAGSRAQLAPTSETSGAAIRFDPGSLLQNR
                     VANKRMRLVFI"
     CDS             complement(666178..667824)
                     /codon_start=1
                     /locus_tag="KF707C_6050"
                     /note="Cobalt-precorrin-3b C17-methyltransferase"
                     /product="cobalamin biosynthesis protein CbiG"
                     /protein_id="BAU72293.1"
                     /transl_table=11
                     /translation="MKAPAIVLLGNGGLAVARRLQGLYPQARVLGLAGRVEGADEPYS
                     EFGETLRELYRNDTPIIALCAAGIVIRTLAPLLASKGAEPPVLALAEDGSAVVPLLGG
                     LGGVNRMAREIAACLEVAPAITTSGELRFGTCLLDPPSGYALADLEQGKRFVADLLGG
                     ETMQVAGDAPWLEAVALPRDSAAKLTLHITPEQRPAARDELLIHPRVLAVRVDGDASA
                     EAIREALVSAGLAPQALACLVADPARMTDAGLAAAAAELAVPLRFAAEDADLPSPVAR
                     IGDLRLYRAQAPLDPARIGQARGRLTVIGLGPGDPVFMTPATRQALDEAQDLLGYETY
                     IRMAGPLRADQVAHCTDNREELQRARHAFELAASGRRVVVVSSGDPGVFAMAAAVLEA
                     LDEARDPAWLRVDLQIQPGVSAALATAARAGAPLGHDFCLISLSDNLKPWDMIERRLD
                     HAGAADFAMAFYNPISRARPWQLGRALEIVRQHRGPETLVVLGRDIGRPAEKLTVTCL
                     GDLLPEQVDMRTLVIIGSSLTRRVPRAEGGDWVYTPRWYR"
     CDS             complement(667824..668573)
                     /codon_start=1
                     /EC_number="2.1.1.130"
                     /locus_tag="KF707C_6060"
                     /product="cobalt-precorrin-2 C20-methyltransferase"
                     /protein_id="BAU72294.1"
                     /transl_table=11
                     /translation="MMSGKGRLIGLGVGPGDPELITVKALRLLQSAQVVGYFVAKAKA
                     NRGEGGNAFGIIEQHLGEAQQRMPLVYPVTTEKLEPPLSYETVISDFYDTAAQQVAQH
                     LDAGRDVAVICEGDPFFYGSYMYLHDRLADRYEVDVVPGVCSMLGSAAMLGLPLVYRN
                     QSLSVLSGVLPEDELKARLATAEAAVVMKLGRNFDKVRRVLVELGLADRAHYVERATM
                     ANQRIVALDEVDPMASPYFSMILVPGQKWRG"
     CDS             complement(668570..669196)
                     /codon_start=1
                     /EC_number="5.4.1.2"
                     /locus_tag="KF707C_6070"
                     /product="cobalt-precorrin-8x methylmutase"
                     /protein_id="BAU72295.1"
                     /transl_table=11
                     /translation="MIDYIRDGQEIYRHSFSIIRAEADLSAIPPDLEKLAVRVIHACG
                     MVDVVQDLAFSPGAGTAGRAALAAGAPILCDARMVAEGVTRARLPADNRVICTLNDPG
                     VPELARELGNTRSAVALEHWREHLEGSVVVIGNAPTALFYLLEMLDAGAPKPALILGF
                     PVGFVGAAESKDLLAADSRGVPYVVVRGRRGGSAMAAAAVNALATEVE"
     CDS             complement(669193..670563)
                     /codon_start=1
                     /locus_tag="KF707C_6080"
                     /product="cobalamin biosynthesis protein CobG"
                     /protein_id="BAU72296.1"
                     /transl_table=11
                     /translation="MSLGQGYSGRRDANQGDPLKQAESAATSVRPSACPGLLRIVQSG
                     DGGLCRIKLPCGRLHAHQARAVAAAARQQASGVIEATNRANLQIRGVRPGAEGALIET
                     LLAADLGAPSPGADDLRNLMVSPLLGLEPGVGQTVAALAERLLALLQDTPRFHALSPK
                     FALLLDGGEPLAMLEHPHDIWLAALGPQADAPFAFGLAGCPPLRADDAPAFGAVPAAQ
                     VPALVEALLQLFLDRARPEQTRMRHLLADLGPAALVAELERRLGTPLQPLPDWRRDTA
                     ATLGHLGPVDGRHAGAAAPLGRLDAAQLDALADLADQQSDGQLRLTPWQSVLLPAPRD
                     LDGTLAALAALGLVTDATAPLARLIACTGSAGCPRSLADTKADALALAPRLPPEVQLH
                     LTGCPRSCAAAHVAPFTLLARAPGRYDLYQRARDGFGRLLASDLDLEQASDRLAATPD
                     SWSSSE"
     CDS             670588..670878
                     /codon_start=1
                     /locus_tag="KF707C_6090"
                     /product="hypothetical protein"
                     /protein_id="BAU72297.1"
                     /transl_table=11
                     /translation="MRSHATGFTGRSPGWQVVILRGLPERCSVARVRGLAAYSCGGSH
                     GATVFPQGIAREIPSSRPPASTSGRRRQPMKGAIMPALSDMRKRLPVGRASG"
     CDS             670904..672106
                     /codon_start=1
                     /EC_number="2.1.1.-"
                     /locus_tag="KF707C_6100"
                     /product="cobalt-precorrin-6y C5-methyltransferase"
                     /protein_id="BAU72298.1"
                     /transl_table=11
                     /translation="MQPWLTVVGIGEDGYGGLGKAARHALLGAAEVVGAPRQLALLPR
                     CIRAVRTPWPSPFSLEPVLARRGTTLCVLASGDPMLFGVGASLARQVPAEELRVLPAP
                     SSASLAAARLGWPLQEVTLLSTVARPLAVLNGHLHPGARLLVLSNDGGTPASLASLLV
                     AAGFGASRLTVLEHLGGPLERRLDGLASAWSAVEVADLNLVAVEVAADPGTRALPVTC
                     GLPDDAYRHDGQLTKRDVRAITLARLAPRPGELLWDVGAGCGSIGIEWMRAHPACRAL
                     AIEANAGRQAHIRHNRDALGVPGLQLVAGEAPAALEGLPAPDAIFIGGGVTDPGVLAQ
                     CWARLKPGGRLVANAVTLQSESTLVAFRADNGGSLTRITVAQAQPLGDFDTWRSALPI
                     TLLEAVKP"
     CDS             672137..673234
                     /codon_start=1
                     /locus_tag="KF707C_6110"
                     /product="cobalt-precorrin-6 synthase, anaerobic"
                     /protein_id="BAU72299.1"
                     /transl_table=11
                     /translation="MRDETPEQPAPLRSGYTTGSCATATSLAAARLLLGGEAADAVEI
                     VLPKGKRVMLRLEFCRLIDGGAEAGTLKDAGDDPDVTHGALIHARVRLAAEPGVRFHA
                     GPGVGTVTRPGLVLAVGEPAINPVPRRMMTDHLTELAGTLGYAGGFEVTVCVQGGEAL
                     ALKTMNPRLGILGGLSILGTTGIVRPFSCAAYIASIHQGIDVACANGFTHLAACTGNA
                     SEDAMRQRYGLDDTALIEMGDFAGAVLKHLRKAPVARLSLCGGFGKISKLAAGHMDLH
                     SRHSSIDLPQLARWAAELGADSALQAAIEGANTSQQALALAHADGVPLGNAVCARALA
                     FARRTVPARVALEVFAIDRQGVIVGEALENP"
     CDS             673231..673962
                     /codon_start=1
                     /EC_number="1.3.1.54"
                     /locus_tag="KF707C_6120"
                     /product="cobalt-precorrin-6x reductase"
                     /protein_id="BAU72300.1"
                     /transl_table=11
                     /translation="MTPILLLGGVTEALALARSLGPAHVYSLAGLGRVPQDLACQVRV
                     GGFGGAEGLAGYIRERGIGLLVDATHPYAAQISHNAARAAAQAGVPCWALRRPGWQAG
                     PGDDWREVDDWAGLMAALAPFRRPFFTLGREPLEHLDAVPVHQHWTVRCLQGQAPGER
                     HEVIGSRGPFHLDEERALFERLGTDVLISKNSGSQSTEPKLQVARERGLPVLILRRPA
                     LPPVTREFDSVEGLWQALGPYLDTP"
     CDS             673959..674666
                     /codon_start=1
                     /locus_tag="KF707C_6130"
                     /product="putative 2Fe-2S ferredoxin CbiW involved in B12
                     biosynthesis"
                     /protein_id="BAU72301.1"
                     /transl_table=11
                     /translation="MTATVYARVLFAGPDLAEGAFAELFRRQLVALRGEAALADVVDT
                     GAGPDALREAVQASPRPLLVIDLDPQSTPPHLDWLRSELGQCEAPEHLFIASLLGQYD
                     SDPAGAACALVARTELHLACVEVPALPESHAWSCIPPHARRLLLCNGPRCTRRGALPL
                     WKKLRETLKAAGKLECAGGVHITRTQCQYPCDLGPTASLYPEGEWYRLESEEQVLRWV
                     QERIVEERAVPELLMKG"
     CDS             674707..674952
                     /codon_start=1
                     /locus_tag="KF707C_6140"
                     /product="CcdB antidote CcdA protein"
                     /protein_id="BAU72302.1"
                     /transl_table=11
                     /translation="MPVLYDPQAPKKPTNLSVNSDLLNKARALDINLSATLEQALAET
                     LRARQREVWLAENREAIAAYNQHVESDGVFSDGLRRF"
     CDS             674952..675269
                     /codon_start=1
                     /locus_tag="KF707C_6150"
                     /product="CcdB protein"
                     /protein_id="BAU72303.1"
                     /transl_table=11
                     /translation="MPQFAVYLNTNPATRADVPYLLDVQSDLLDGLGTRVVVPLYSER
                     AMGGRAVGSLMPRFEVEGVSVVMVTPEMAGVPRRALGRQVADLAGQRFEIIAALDLLI
                     SGI"
     CDS             complement(675283..676212)
                     /codon_start=1
                     /locus_tag="KF707C_6160"
                     /product="putative membrane protein"
                     /protein_id="BAU72304.1"
                     /transl_table=11
                     /translation="MTHAVPCADSPATRLATRLAFFVSGFGMACWAPLVPYAKARLDI
                     GEAVLGLLLLCLGAGSMLSMPVAGVLAGRIGARPVILVGGVGLCCAMPLLAGADFSLL
                     LALALALFGASLGAMDVAMNIHAVEVANDAPVPLMSGFHGLFSLGGFVGSLGMTGLLA
                     AGLAPLTAILVALVVVITGLALAAPRLLRTRSAGSGPLFVVPRGLVLLLGALTFAMFL
                     AEGALLDWGAILLVGLGAANIVPVLFSAAGRQGTMPANLAVAAVTTVGYAGVLAGPAL
                     VGFVAQGLGLVTAFVILGVLMLSAPLTALWFVR"
     CDS             complement(676456..676806)
                     /codon_start=1
                     /locus_tag="KF707C_6170"
                     /product="hypothetical protein"
                     /protein_id="BAU72305.1"
                     /transl_table=11
                     /translation="MALQHLDYDLETLTVTLRNLETQGLTSLRISAVEGFRVLDEGDL
                     LEFWPHCSGSWLHEITAGGWLDQERLRAGFLSGDRALKEYLISGADTCLNVLTWEAIT
                     VPQQPCSPPPDYAQ"
     CDS             complement(677023..677478)
                     /codon_start=1
                     /locus_tag="KF707C_6180"
                     /product="ChlD component of cobalt chelatase involved in
                     B12 biosynthesis"
                     /protein_id="BAU72306.1"
                     /transl_table=11
                     /translation="MIVDASASTRRHGALSRAKGLLAQLFDDAYRQRARLAVLSATGR
                     EARWQWQGRKADAGLQPWLEGLGAGGGTPLRDALERSGQWLARRQRQKPGEEQWVLIL
                     TDGRLKDLPALQPLGCATLLVDIESGPVRLGRARQLAAALGAEYQALSD"
     CDS             complement(677676..678683)
                     /codon_start=1
                     /locus_tag="KF707C_6190"
                     /product="ChlI component of cobalt chelatase involved in
                     B12 biosynthesis"
                     /protein_id="BAU72307.1"
                     /transl_table=11
                     /translation="MSELAHYPLSAVVGADELKLALYLAAIDPAIGGVLIEGPRGMAK
                     STLARGIADLLPQRTFVTLPLGASEDRIVGTLDLDAALGEGRARFSPGLLARAHGGVL
                     YVDEVNLLPDHLVDLLLDVAASGLNLVERDGLSHRHPARFVLIGTMNPEEGELRPQLL
                     DRFGLKVSLEGSPAPAERAEIVRRRLAFDSDPQAFLARWEAEQQALTQGCQAARQRLE
                     RIPLDDAALDEIARRCFDAGVDGLRADLVWLRAARAHAAWRGAERIAAVDIDAVERFA
                     LAHRRHHAPPPAAQPPREAPAQAPRPQQDASGEGQWGELPAQPTPTGERRALPTWPKK
                     P"
     CDS             678807..678926
                     /codon_start=1
                     /locus_tag="KF707C_6200"
                     /product="hypothetical protein"
                     /protein_id="BAU72308.1"
                     /transl_table=11
                     /translation="MSHLASTSLNAAPAQAVAGVRVVAATRYFHGYWFSHGLT"
     CDS             complement(678887..679036)
                     /codon_start=1
                     /locus_tag="KF707C_6210"
                     /product="hypothetical protein"
                     /protein_id="BAU72309.1"
                     /transl_table=11
                     /translation="MVVLWTVGKQKPPVGLPTGGFVELWRRPCWSGPPDGYQVSPWLN
                     QYPWK"
     CDS             679007..679156
                     /codon_start=1
                     /locus_tag="KF707C_6220"
                     /product="hypothetical protein"
                     /protein_id="BAU72310.1"
                     /transl_table=11
                     /translation="MFSDGPQDHHDVTEDRTMISYRNDYRYYRTDWRFSRSTRIPTPT
                     SRTPS"
     CDS             679199..680290
                     /codon_start=1
                     /EC_number="2.5.1.54"
                     /locus_tag="KF707C_6230"
                     /product="2-keto-3-deoxy-D-arabino-heptulosonate-7-
                     phosphate synthase I alpha"
                     /protein_id="BAU72311.1"
                     /transl_table=11
                     /translation="MNSSVSALSTAAQPLHVVALDTAPSPSRSTRPLPTPAELRRRLP
                     LSVELARQIRAQREAVRAVLDGEDPRLLVVVGPCSIHDPDAALDYARRLAALAPLVSD
                     QLLLVMRAYVEKPRTTVGWKGLVYDPHLDGSGDMAEGLALSRRLMLEIAGLGLPVATE
                     LLQPLVAGYLDDALSWAAIGARTSESQIHREMVSGLDLPVGFKNGTDGGLGIATDAMR
                     SAAHAHQHFGLDAQGRPALVETAGNPDTHLVLRGGHKGPNHDAASVQAAREGLEKLGI
                     APRILVDCSHANSGKDPLRQPAVLADVIDQRLAGQDALRGVMIESHLFDGAQSLSCDL
                     RYGVSITDGCLGWAGTEAMLLEAAARLRG"
     CDS             complement(680398..684132)
                     /codon_start=1
                     /locus_tag="KF707C_6240"
                     /product="CobN component of cobalt chelatase involved in
                     B12 biosynthesis"
                     /protein_id="BAU72312.1"
                     /transl_table=11
                     /translation="MHLLRTQPGGFVPEDGIAHLAQTPAELVILCSGDSHLALLAEAA
                     RELPEDYPSLRLANPMQLQNHASVDLYVDEVLQHAKVILISVHGGVGYWRYGIEQLVA
                     LAERGARLILVPGDDRPDPELARLCTVPAEDAERYWHYLRQGGLDNARQLFACLASRC
                     LGRAMPWDEPRPLPRVAVYHPRQPNAGLEHWRADWRADQPVVALLFYRTHLQAANTGF
                     LDTFCERLAAQGLNPLPIAVASLKEAACLATLEDWLDEAGAELIINTTGFAQSAPEAP
                     NLRPFRRDVPVFQAICSLDNQPQWEANAQGLGPRDLAMHVALPELDGRLITRAISFKG
                     LAWRSERSQSDVVCYLPHVERMDFVAELARRWLLLARKPNADKRVALILANYPTRDGR
                     IGNGVGLDTPAGALNILRALEQQGYPVAGLPESGTALIHSLLGGVSNDLDSLDARPCA
                     QSLALADYLACFARLPEANQRAVRERWGEPQQDPMFRSGRMMIAGLRFGLAFVGIQPA
                     RGYQLDPAAIYHDPSLVPPHGYLAFYFWLREVFGADALVHVGKHGNLEWLPGKGVGLS
                     AECWPDAVMGPLPNIYPFIVNDPGEGAQAKRRAQAVIIDHLMPPLTRAETYGPLRDLE
                     RLADEYYDASLLDPRRAVQLRGEILELVKATALDRELGLSLNDDADSWLPQLDAYLCD
                     LKESQIRDGLHLFGESPVAGLRDDTLLSLVRIPRGDGKGGNASLLRALASDLNLGRDP
                     LDLSWAEPWEGPRPAVLDGISDEPWRSNGDTRERLELLARRLIANPAAEAIGRASDAV
                     IHNLRQVIAPALDACGAAEIGGVLTALDGRFVPPGPSGAPSRGRLDVLPTGRNFFTLD
                     VRNLPTPTAWRLGFQSASLLLERHLQDEGDHLRQLGLSVWGTATMRTGGDDLAQAMAL
                     LGVRPVWQAGSQRVEDFEILPLSLLDRPRVDVTLRVSGFFRDAFANLIRLFDAAVQAV
                     AELDEPDDLNPLAARVRQDRARLEGEGLPAEAARREAGWRVFGAQPGAYGAGVQGVIE
                     ARTWETRSDLAEAYLNWGGYAYGASDAGTPARQRFGERLEGLQAVLQNQDNHEHDILD
                     SNDYYQFQGGMLATAETLRGQKVASYHGDHSQPDLPRIRSLREELGRVVRARAANPKW
                     IAGMKRHGYKGAFELAATVDYLFAFDATTRLVDDHQYALLAEAYLLDADTRAFLQQHN
                     PESLRDIVERLLEAQQRGLWEEPGDYREAIEDLLLDIEEQ"
     CDS             complement(684243..685295)
                     /codon_start=1
                     /locus_tag="KF707C_6250"
                     /product="CobW GTPase involved in cobalt insertion for
                     B12 biosynthesis"
                     /protein_id="BAU72313.1"
                     /transl_table=11
                     /translation="MKTLAKLPVTIVTGFLGAGKTTLLRHMLDNAQGRRIAVIVNEFG
                     ELGIDGDILKQCSIGCSEEEAVGRVFELANGCLCCTVQEEFFPVMRELVARRGDLDQI
                     LIETSGLALPKPLVQAFQWPEIRNACTVDAVITVVDSPAVAAGTFAAFPDQVDEQRKQ
                     DPNLDHESPLHELFEDQLASADLVILNKSDLLDAETLAAVRAEVSEELPPAVKVVEAA
                     SGKLPLDVLLGLNAEAEAHIDSRPTHHDHEEHEDHDHDEFDSFHVDLPDVDERALLAA
                     LGQLVERHPILRIKGFVAVAGKPMRLLVQGVGKRFDKHFDRAWRSDETRSTRLVVIGQ
                     DLDPAAIANELRTALA"
     CDS             complement(685581..685703)
                     /codon_start=1
                     /locus_tag="KF707C_6260"
                     /product="hypothetical protein"
                     /protein_id="BAU72314.1"
                     /transl_table=11
                     /translation="MGGAARFMAWQATGREKSAQGQHGPDKASTDAIDRRPGPA"
     CDS             685702..686121
                     /codon_start=1
                     /locus_tag="KF707C_6270"
                     /note="Cobalt-precorrin-3b C17-methyltransferase"
                     /product="cobalamin biosynthesis protein CbiG"
                     /protein_id="BAU72315.1"
                     /transl_table=11
                     /translation="MTPLSLVAGFGCRQGCTAAELGALLEACLAEAGVPAASLAALAT
                     REDRALEPGLRALAAERNLPLQGVAPEVLNALEARLNQPSERVRALAGSAGVAEAAAL
                     ALADRLGQGPAWLVLDKRRSARATCALACIHLEAQRP"
     CDS             686118..686888
                     /codon_start=1
                     /EC_number="2.1.1.133"
                     /locus_tag="KF707C_6280"
                     /product="cobalt-precorrin-4 C11-methyltransferase"
                     /protein_id="BAU72316.1"
                     /transl_table=11
                     /translation="MTVYFIGAGPGDPELITVKGQRLIRSCPVILYAGSLVPEAVLEG
                     HRAERVVNTAELHLEQIVALLAEAHARGQDVARVHSGDPSLYGAIGEQIRHLRERGIP
                     YEIVPGVTATAACAALLGCELTLPEVSQTLILTRHASKTRMPEGESLGDLARHRATLA
                     IHLGVSRIEEIVAELLPHYGPACPVAVIHRASWPDQAQVTGTLADIAEKVQAVGFRRT
                     ALILVGEVLAAEGFADSSLYRAGHAHLYRPTKPLPPRG"
     CDS             687001..687870
                     /codon_start=1
                     /EC_number="1.1.1.133"
                     /locus_tag="KF707C_6290"
                     /product="dTDP-4-dehydrorhamnose reductase"
                     /protein_id="BAU72317.1"
                     /transl_table=11
                     /translation="MLLGGGNSLGQALIRLGAEEDIGFLAPRPPEQGWDAASLTQLLD
                     DTRPDAVVNLAYYFDWFQADEVSEDRLSAQERGVERLAELCQHHGIVLLQPSSYRVFD
                     GSRATAYSEKDETLPRSVRGQALLRMEQSVRAACPKHVLLRFGWLLDDSRDGSLARFL
                     ARAEQADEICLADDRRGNPTPVDDAARVLLAVLKQLDCAAPLWGTYHYGGHEATTPLA
                     LGQALLAEARSLHPLKVQDITPQAHAARPDAAEEPQNAVLACKKILHTFGIKPRAWRA
                     ALPTLLDRYYRHA"
     CDS             687863..688792
                     /codon_start=1
                     /EC_number="5.1.3.2"
                     /locus_tag="KF707C_6300"
                     /product="UDP-glucose 4-epimerase"
                     /protein_id="BAU72318.1"
                     /transl_table=11
                     /translation="MPDSPILITGGAGFIGSHLADALLARGHAVRVLDNLSTGKRDNL
                     ALDNPRLELIEGDVADAALVARAMAGCKGVAHLAAVASVQASVDDPVATHQSNFIGTL
                     NVCEAMRQQGVKRVLFASSAAVYGQNGEGRAIDEDTPKSPLTPYAVDKLASEQYLDFY
                     RRQHGLEPAVFRFFNIFGPRQDPSSPYSGVISIFTERALAGTPITVFGDGEQTRDFVY
                     VGDLVQVLVQALEQDWLEVGAVNVGLNQATSLKELLAAIGDVLGGLPPITHAEARAGD
                     IRHSRANNARLLLRYDFPKPTPLREGVARLLGR"
     CDS             complement(688916..689587)
                     /codon_start=1
                     /locus_tag="KF707C_6310"
                     /product="outer membrane protein W precursor"
                     /protein_id="BAU72319.1"
                     /transl_table=11
                     /translation="MRKHLLTASLLALAIASPLAQAHKAGDVIIRAGAATVDPNEDSS
                     ALSIAGGKVGGTKATLDSDTQLGLTGTYMLTDHVGLELLAATPFKHEVGVKGLGALDG
                     KLGDIKHLPPTLSLQYYPMDPGSAFQPYVGAGLNYTLIFDESLTGQRKSQGFSDLELD
                     DSWGLAAQVGMDYMLTDNVLLNAAVWYIDIDTTATTDLAGVGKVKVDVDVDPWVYMVG
                     VGYKF"
     CDS             complement(689750..690268)
                     /codon_start=1
                     /locus_tag="KF707C_6320"
                     /note="FIG003461"
                     /product="hypothetical protein"
                     /protein_id="BAU72320.1"
                     /transl_table=11
                     /translation="MKPILLALLLTLSSPLWAGEARELTWSEMIPEGAPPPPPPAPIH
                     DLSQLGDTLNAEAGPAAGQQSPAAPVVESLDGQEVKLPGYIVPLDVTEEGRVTEFLLV
                     PYFGACIHVPPPPSNQIVHVRSELGVLMDALYQPFWIEGPMQVKPSSSELAEAGYQME
                     ASKIYPYESPSS"
     CDS             complement(690276..691538)
                     /codon_start=1
                     /locus_tag="KF707C_6330"
                     /note="permease component"
                     /product="ABC-type antimicrobial peptide transport system"
                     /protein_id="BAU72321.1"
                     /transl_table=11
                     /translation="MHLLRLALASLANRRFTALLTVFAIALSVCLLLAVERVRTEARA
                     SFASTISGTDLIVGARSGSVNLLLYSVFRIGNATNNIRWDSFEAIAQDKRVKWAIPLS
                     LGDSHKGYRVMGTSPAYFEHYRYGRGRSLALAEGKPFSDLFEVVLGAEVAEALKYRLG
                     DRIVLAHGVSTVSLVQHDDKPFTVVGILERTGTPVDRTLHISLAGMEALHVDWQNGVP
                     ARGAGKVSAEQARAMDLQPKAITAFLLGLNSKIATFALQRQINEYRGEPLLAVLPGVA
                     LQELWSLMGTAEKALFVVSLCVVLTGLIGMLTAILTSLNERRREMAILRSVGARSWHI
                     GSLLVLEAFSLALAGAALGLGLLYLGIGLSQGYVQASYGLYLPLALPSPYEWTLLGAI
                     LSAALLMGAVPAWRAYRQSLADGLSIRL"
     CDS             complement(691540..692247)
                     /codon_start=1
                     /locus_tag="KF707C_6340"
                     /note="ATPase component"
                     /product="ABC-type antimicrobial peptide transport system"
                     /protein_id="BAU72322.1"
                     /transl_table=11
                     /translation="MSQTLIELQGLGFAWPGHPELLDIPEFHLNFGESLFLKGPSGSG
                     KTTLLGLLGGVQKPGRGSIRLLGQDLASLSASARDRFRVDHTGYIFQQFNLLPFLSVR
                     ENVELPCRFSRLRAERACQRHGSVDNAAATLLRHLGLKEDLLLRRADALSIGQQQRVA
                     AARALIGQPELVIADEPTSALDADAREAFLGLLFAECREAGSSLLFVSHDQSLAPLFD
                     RSLSLADLNRAARLEED"
     CDS             complement(692288..692851)
                     /codon_start=1
                     /locus_tag="KF707C_6350"
                     /product="predicted zinc-binding protein"
                     /protein_id="BAU72323.1"
                     /transl_table=11
                     /translation="MHRLLLALPFALLPLAAQAHEHDHDHEHGSLAAHEHGVARLNAA
                     LDGKTLELELESPAMNLVGFEHAARSDADKAKVAGVRASLEQPLALFDLPAQAGCRVS
                     AQELESPLFGDHDHDKADDHAHEHEHSDIHAHYQLECATPSALESLDLAPLFKQFPAT
                     QKIQVQLIGPNGQQGAELTPSSPRLSF"
     CDS             692960..693310
                     /codon_start=1
                     /locus_tag="KF707C_6360"
                     /note="FIG00954755"
                     /product="hypothetical protein"
                     /protein_id="BAU72324.1"
                     /transl_table=11
                     /translation="MLRIRGRIGDWPVDLTVEMEAEDWDRLASRLSLETQAPAASMAT
                     GPVAAPRNDALWDTARQLLREAGQMEGPRLLAALEALAGGPAAGKRLLVRLRHCAEVQ
                     VDAGEDAPLYRWKG"
     CDS             complement(693386..694255)
                     /codon_start=1
                     /locus_tag="KF707C_6370"
                     /note="COG3118"
                     /product="thioredoxin domain-containing protein EC-YbbN"
                     /protein_id="BAU72325.1"
                     /transl_table=11
                     /translation="MSDTSYIFDATSTDFEQSVIQNSFHKPVLVDFWADWCAPCKALM
                     PLLAQIAESYQGELLLAKVNCDIEQDIVMRFGIRSLPTVVLFKDGQPVDGFAGAQPES
                     AIRAMLEPHVQPPATPEGNLLDAAQAAFSEGRIAEAENLLKQLLTEDNTNAAGLILYA
                     RCLAERGELGEAETVLNAVKSDEHKQALAGARAQLTFLRQAADLPEVADLKSRLAQNA
                     GDDEAAYQLSVQQLARQQYEPALDALLKLFVRNRGYENGLPHKTLLQVFDLLGNDHPL
                     VATYRRKLYNAIY"
     CDS             complement(694381..695034)
                     /codon_start=1
                     /locus_tag="KF707C_6380"
                     /product="conserved domain protein"
                     /protein_id="BAU72326.1"
                     /transl_table=11
                     /translation="MTPPDVLQQAITELLGDARLSAETLPGTDLRLWLIDPDNMDRAF
                     SPEETRRILEEPPYWCFCWASGLALARWLADKPEWVRGKRVLDFGAGSGVAAIAAARA
                     GAQEVVACDLDPLALASCRANAELNGVELQYSDDFFREEDRFDLVIVADVLYDRANLP
                     LLDHFLTRGRQALVADSRVRDFQHPLYTRLAVLDACTWPDLAEPAEFRKVSLYHAIR"
     CDS             complement(695031..695459)
                     /codon_start=1
                     /locus_tag="KF707C_6390"
                     /product="lipoprotein, putative"
                     /protein_id="BAU72327.1"
                     /transl_table=11
                     /translation="MRRLLSLLLATLLAGCASDEPAPRQAPAAAPEPWIEATPAHLRE
                     LSGVLQVPPTGSDVELALLSVDTRDRPQRLLGSLTLNGNGGPLPFRLLFNPAYFPRGE
                     RVELRVRVSQSGRLIQRLPPVPILQPDSRALGPLQLVPAP"
     CDS             695573..696037
                     /codon_start=1
                     /locus_tag="KF707C_6400"
                     /product="ribonucleotide reductase transcriptional
                     regulator NrdR"
                     /protein_id="BAU72328.1"
                     /transl_table=11
                     /translation="MHCPFCGAHDTKVIDSRLVAEGDQVRRRRECLACEERFTTFETA
                     ELVMPRLIKQDGSRQPFDEEKLRAGMQRALEKRPVSIERLEAAIAHIKHKLRATGERE
                     VKSRVLGELVMAELQKLDEVAYIRFASVYRRFQDLNEFREEIERLAREPSKD"
     CDS             696037..697143
                     /codon_start=1
                     /EC_number="3.5.4.26"
                     /locus_tag="KF707C_6410"
                     /product="diaminohydroxyphosphoribosylaminopyrimidine
                     deaminase"
                     /protein_id="BAU72329.1"
                     /transl_table=11
                     /translation="MAGQDQAFMARALELARKGLYSTHPNPRVGCVIVRDGQVVGEGW
                     HVRAGEPHAEVHALRQAAERARGATAYVTLEPCSHHGRTPPCADALVAAGVGRVVAAM
                     QDPNPQVAGRGLKRLEDAGIAVSSGVLEAEAKALNAGFIKRMEQGLPFVRVKLAMSLD
                     GRTAMASGESQWITGPAARAAVQRLRARASVVLTGADTVLMDAARLTVRPDELGLDAE
                     LTALAASRPPLRVLVDGRLRVPSDVPFFQAGPALVATALEGREAPAGHELIAVPGADG
                     RVDLRRLLEALASRGVNEVLVEAGPRLAGAFAQAGLVDEYQIFFAGKFLGSGARPLLD
                     WPLERMAEAPELSIVEVRAVGEDWRVIAVPRLPA"
     CDS             697613..698275
                     /codon_start=1
                     /EC_number="2.5.1.9"
                     /locus_tag="KF707C_6420"
                     /product="riboflavin synthase eubacterial/eukaryotic"
                     /protein_id="BAU72330.1"
                     /transl_table=11
                     /translation="MFTGIIEAIGTIRAITPKGGDVRVLVETGKLDLGDVKLGDSIAV
                     NGVCLTAVELPGNGFWADVSRETLARTAFDDLKPGSPVNLEKALTPSSRLGGHLVSGH
                     VDGIGEVIAREDNARAVQFRIRAPRELARYIALKGSITVDGTSLTVNAVNGAEFELTI
                     VPHTLAETIMVDYRPGRRVNLEVDLLARYLERLLLGDKAAEPAASGLTESFLAEHGYL
                     KH"
     CDS             698294..699388
                     /codon_start=1
                     /EC_number="4.1.99.12"
                     /locus_tag="KF707C_6430"
                     /product="3,4-dihydroxy-2-butanone 4-phosphate synthase"
                     /protein_id="BAU72331.1"
                     /transl_table=11
                     /translation="MALNSIDELIEDIRQGKMVILMDDEDRENEGDLIMASECVQAEH
                     INFMARFARGLICMPMTRERCELLKLPLMAPRNGSGFGTKFTVSIEAAEGVTTGISAA
                     DRARTVQVAAAKHAKAEDIVSPGHIFPLMAQPGGVLARAGHTEAACDLARMAGFEASG
                     VICEIMNDDGTMSRRPELEAFAAEHGIKIGTIADLIHYRLIHERTVERIAEQPLDSEL
                     GHFNLVTYRDAVEGDIHMALTLGEISPEEPTLVRVHNMDPLRDLFMVNQGGRWSLRAA
                     MKEVAAAGSGVVLLLGNPLTGPQLLAHLERQLGTETKVTNPTTYSTVGAGSQILRDLG
                     VRKMRLMSSPMKFNAISGFDLEVVEYLPAE"
     CDS             699451..699927
                     /codon_start=1
                     /EC_number="2.5.1.78"
                     /locus_tag="KF707C_6440"
                     /product="6,7-dimethyl-8-ribityllumazine synthase"
                     /protein_id="BAU72332.1"
                     /transl_table=11
                     /translation="MSLKTIEGTFIAPRGRYALVVGRFNSFVVESLVSGAVDALVRHG
                     VREDDITLIRAPGAFEIPLVAQKVAQQGEYSAIIALGAVIRGGTPHFEYVAGECTKGL
                     AQVSMEFGVPVAFGVLTVDSIEQAIERSGTKAGNKGAEAALSALEMVSLLAALEAK"
     CDS             699924..700397
                     /codon_start=1
                     /locus_tag="KF707C_6450"
                     /product="transcription termination protein NusB"
                     /protein_id="BAU72333.1"
                     /transl_table=11
                     /translation="MSNTEGSAPKAPKGKIAARRQARTLAMQALYSWHIAGQALNEIE
                     AQFRVDNDFSQVDGAYFHEILHGVPRQKTEIDEAFLPCLDRALEEVDPVELAILRLST
                     YELMNRVDVPYRVVINEGIELAKVFGATDGHKFVNGVLDKLAPRLRAAEVRGGKR"
     CDS             700416..701384
                     /codon_start=1
                     /EC_number="2.7.4.16"
                     /locus_tag="KF707C_6460"
                     /product="thiamine-monophosphate kinase"
                     /protein_id="BAU72334.1"
                     /transl_table=11
                     /translation="MGEFELIRRFFASAACAAGGEGIALGIGDDCALLQLPPGEQLAI
                     STDTLVAGVHFPDAADPFLLGQRALAVSASDLAAMGATPVAFTLALTLPDARADWLDG
                     FARGLCAMARGCGLGLVGGDTTRGPLSLTLTVLGRVPAGGALTRAGARPGDLLCVGGS
                     LGDGAGALPLVLGQREAQGAHADYLLARYWSPQPQLALGQALRGRATAALDISDGLLA
                     DCGHIAKASGVALWVDQSRLPLSPALTALHPRDFALKCALAGGDDYRLAFTLPATELA
                     AVQGLWPEMAVIGRVDAGQGVHLLDSTGAELLPPVLGYQHFGSQGD"
     CDS             701377..701877
                     /codon_start=1
                     /EC_number="3.1.3.27"
                     /locus_tag="KF707C_6470"
                     /product="phosphatidylglycerophosphatase A"
                     /protein_id="BAU72335.1"
                     /transl_table=11
                     /translation="MTDHESATPQPIPHSVWSNPWHFIAFGFGSGTLPKAPGTWGSLV
                     ALPFIPLWQMLPDWGYWLMLGVTMLFGFWLCGRVADDLRVHDHEGIVWDEMVGMWITL
                     WLVPEGWQWLLLGFLVFRVMDIAKPWPIRWIDKHVHGGVGIMLDDVLAGVFAWLAMQL
                     IIWGLA"
     CDS             701943..702596
                     /codon_start=1
                     /locus_tag="KF707C_6480"
                     /product="transporter"
                     /protein_id="BAU72336.1"
                     /transl_table=11
                     /translation="MSRPDLKVAVLLTALCPALALATQVQVVGLFPGAVVLNVDGQRK
                     LVKVGQTGPGGVQVISADSQGAVLRVDGVEGRYGLSREYNPAGMSAAPQRAQLSIARG
                     NNGHYQVAGSIEGHPVQFLVDTGATSVAMNEHQARRLGIDYRMKGQPMKAGTAAGTVN
                     AWRVTFDRVKVGGLEVLGVEGAVIEGDAPVEVLLGMSFLNRVKWREDQGVLLLESKF"
     CDS             702706..703320
                     /codon_start=1
                     /EC_number="3.5.4.25"
                     /locus_tag="KF707C_6490"
                     /product="GTP cyclohydrolase II"
                     /protein_id="BAU72337.1"
                     /transl_table=11
                     /translation="MSVVFVAASQLPTPFGVFTMHGFLDEASGKEHVALTLGDVASGE
                     PVLGRLHSECLTGDALFSLRCDCGFQLEGALRAIAEAGCGVLLYLRQEGRGIGLLNKI
                     RAYELQDAGADTVEANERLGFGADQRDYAMCQPMLEHLGISAIKLMTNNPRKVKALES
                     YGLKVAERVPLQTGMNKHNRKYLATKAGKLGHMLGNLHQAEAES"
     CDS             703317..703733
                     /codon_start=1
                     /locus_tag="KF707C_6500"
                     /product="permease of the major facilitator superfamily"
                     /protein_id="BAU72338.1"
                     /transl_table=11
                     /translation="MSRADARRRLSLAWWRQLPLTLAPLFLMNAFLGDLDLLPAAQMP
                     LFIVGLLSLFPSLRCFAAYKRALVATEAALDGPDEAAAWDALGRCRTKAMLVASLPAW
                     VAALAVPVNLNGVALFLLAMSSLVMLYLYRIPRQLG"
     CDS             703733..704530
                     /codon_start=1
                     /locus_tag="KF707C_6510"
                     /note="B12-binding component BtuF"
                     /product="vitamin B12 ABC transporter"
                     /protein_id="BAU72339.1"
                     /transl_table=11
                     /translation="MRPLLACLLLCLALPAAAQLRVVSLAPSLTETMLDLGAADLLVG
                     VLDGGERPPALADLPSVGRYGQLQAEALLSLQPDLVLLWPDSVGAAGRAQLKDLAIAQ
                     LVVEPRSLEQLARSFIEIGERIGRADQGHRLARRFESGLAALRERHRRPVPLRVFYQV
                     WDRPLYTLGGRQIVSDALRVCGAENVFAELPLPAPQVSVEAVLQRDPAVILVSEPGQA
                     SAWKDWPQLTAVKKGQVWAVPDRGLERPSFQMLQATDRLCRLLDAAK"
     CDS             complement(704667..706562)
                     /codon_start=1
                     /EC_number="2.2.1.7"
                     /locus_tag="KF707C_6520"
                     /product="1-deoxy-D-xylulose 5-phosphate synthase"
                     /protein_id="BAU72340.1"
                     /transl_table=11
                     /translation="MPTTFHEIPRERPVTPLLDRATTPDQLRRLGEAELDTLADELRQ
                     YLLYTVGKTGGHFGAGLGVVELTIALHYVYDTPDDRLVWDVGHQAYPHKILTGRREQM
                     ATLRQKDGVAAFPRRAESEYDTFGVGHSSTSISAALGMAIAARMQGSERKSIAVIGDG
                     ALTAGMAFEALNHASDVQADMLVILNDNDMSISRNVGGLSNYLAKILSSRTYASMREG
                     SKKVLSRLPGAWEIARRTEEYAKGMLVPGTLFEELGWNYIGPIDGHDLPTLIATLRNM
                     RDLKGPQFLHVVTKKGKGFAPAEADPIGYHAITKLEPIKAPATPKKPSGPKYSNVFGQ
                     WLCDMAGQDPRLVGITPAMKEGSDLVAFAERFPDRYFDVAIAEQHAVTLAAGMACDGA
                     KPVVAIYSTFLQRAYDQLIHDVAVQNLDVLFAIDRAGLVGEDGPTHAGSFDLSYLRCI
                     PGMLVMTPSDENELRLLLTTGHHFEGPAAVRYPRGSGPNSPIDPELKTVEIGKGVVRR
                     QGSKVALLVFGVQLAEALQVADGLDATVVDMRFVKPLDEALVRELAGSHELLVTVEEN
                     SVMGGAGAAVSEFLARENLLKPILHLGLPDYYVEHAKPAEMLAECGLDAAGVEASVRT
                     RMALLGL"
     CDS             complement(706685..707341)
                     /codon_start=1
                     /locus_tag="KF707C_6530"
                     /product="hypothetical protein"
                     /protein_id="BAU72341.1"
                     /transl_table=11
                     /translation="MSYLTIKTGTPGCLAHFYPAKYRIDLIDEQRRQRIDLSFAGSRV
                     LECLLDAAGEVVSREALLSHAWADRVVSQGSLNQQIHTLRRLLHDKDRRRIIQTLPSR
                     GYLFNPEFLVPGTERASIPDPAESRSRPMAAPTPGVVGTRATRRRRTWSLHGAWALAL
                     LLSSSLVAPGLRPMPLPFIHQPLDYHPVGHRYAGTSGLPQSERPREAPFISLRPARHP
                     "
     CDS             complement(707717..710986)
                     /codon_start=1
                     /EC_number="6.3.4.14"
                     /locus_tag="KF707C_6540"
                     /product="biotin carboxylase"
                     /protein_id="BAU72342.1"
                     /transl_table=11
                     /translation="MNRPIAKLLIANRGEIAIRIARAAAELGITSVAVYAEDDAGSLH
                     SRKADCAVPLSGRGAAAYLDAEQLVDIARQQGCDAVHPGYGFLSENADFAQRCEEAGI
                     GFVGPSVETLALFGDKARARDLAARCGLPLAAGSNAATSLEQARALLAKGPIMLKALA
                     GGGGRGMRAVREAGELEEAFQRCQSEARAAFGNGDLYVERLIEQARHIEVQVLGDGER
                     VNHLWERDCSLQRRHQKVIEIAPAPALPAGLRQRILEAALTLAASVGYRGIGTFEFLV
                     DEARGDFVFMEANPRIQVEHCITEAITGVDLVQAQLRLAAGARLCELGLLEPVATRGF
                     AVQLRINLETMQADGSARPAGGLISAYEPPSGPGIRVDGYGYGGYATSPSYDSLLAKL
                     IVQGDDLPSALRRAYRALCEFRLEGVASNIHFLQNLLRRAELMKGVDTRFIERSIGEL
                     LAPREQAHPHLYMSGAASAGDKPAGGVDAPAGCVPLNAPSQGVLVSLDVQVGDAVAAG
                     QPVAVLEAMKMEFVVKASQGGIVRAVAVAPGDSLFEGAPLLFIEPAEVTDEGPRDEES
                     LDLAHIRADLAEVLERHAVTRDERRPQAVAKRRRTGQRTTRENLDDLLDPGSFIEYGA
                     LALAAQRRRRPLEELIQQSPADGLVAGIGTVNAGHFGDEAARCMTIAYDYTVFAGTQG
                     VMNHKKTDRMLGLAGQWRLPLVLFAEGGGGRPGDSDFVGVAGLDCHTFVAMARLSGQV
                     PLVGVVSGRCFAGNAALLGCCDVIIATRNASIGMAGPAMIEGGGLGRFSAEEVGPTRV
                     QAPNGVIDVLVEDEAEAVRVAQQYLSYFQGDLADWECADQRLLRHAIPENRLRVYDIR
                     ALIETLADQGSMLELRREFAPGLVTAFVRIGGKAFGLMANNPMHLGGAIDAQAGDKAA
                     RFMKLCDAFGIPMVSLCDTPGFMVGPESEKQATVRHVSRMFVAAAGLSVPFFTLVLRK
                     GYGLGAQAMAAGSFHSPLFTVAWPSGEFGAMGLEGAVRLGYAKELAAVEDLAAREALF
                     QKMVAKAYQNGKAINMASFLEIDAVIDPEETRRWLLRGLSAATNAKRGEERPRGFVDT
                     W"
     CDS             complement(710983..712674)
                     /codon_start=1
                     /EC_number="6.2.1.3"
                     /locus_tag="KF707C_6550"
                     /product="long-chain-fatty-acid--CoA ligase"
                     /protein_id="BAU72343.1"
                     /transl_table=11
                     /translation="MNERDYLSELARLRERSWPAGLPRSPEYPLGERPLTEYLREWAR
                     RQPRKTALHFYGHDTSWAELDRLSDRCAVLLEELGVGPGDRVAVFMPNCPQLHIAFWG
                     ILKLGAVYAPVSPLSRGLELAYQLNDSEAEVLLCFDQLLPVVRLVREETPLRHVIATS
                     LSELCPDTPELPVPDLLRAPKLVADDALDFYSALAATKGTPPAHPPCLHAFAALNYTG
                     GTTGLPKGCIHSHGDMLYTCASFVPVALGLTPDSISLNFLPEFWIAGENAGLLFPVFA
                     GCSLVLLARWDALAFLGAVQRYRVSHCGLLVDSAAEVLEHPRLDEFDLGSLQRVGAIS
                     FVKKLTPEYRRRWHERTGCNLYEFAFGMTETHTCDTFTFGLQDDDFDLRQAPTFVGLP
                     VPGTEFKVCDFETGELLPLGTEGELCLRSPSLFKGYWRRPEASTEVLREGWLRTGDLG
                     VIDAQGFIRYLGRRKEMLKVNGMSVFPSELEALLGQHPAILASAVIGRPDPERGQQPV
                     AFIVLHPGSGESAEGLAAWCRESMAGYKVPEIRLVEALPMTATGKVKKNELEALL"
     CDS             712871..713812
                     /codon_start=1
                     /locus_tag="KF707C_6560"
                     /note="LysR family"
                     /product="transcriptional regulator"
                     /protein_id="BAU72344.1"
                     /transl_table=11
                     /translation="MNKQHEWPNLGRIDLNLFRVFDAIQREGNLTRAAAVLHLSQSAI
                     SHALARLREHLGDPLFVRDGRGVAPTPVALRLVPVVSAALGMLQAGVERLQDFDPERD
                     ARSFVLNMPEQLEPLLLPRILADLRDLGGQVSIRSTSVRWAALKLEMAAGQVDLAMEV
                     ARPADAELHQCQLLREPLLVLAGPAFTGELDARRYLSARHIAVTSRRRGISVEDLALD
                     SQGLNRNVVQRCQHYLSAAQVVAQTDWLLTIAAPYTPLLARIHGLRVLPMPLALPPVT
                     LNLYWHEQAANEPGNRWLRERLLAHFGEDLGDRGTLA"
     CDS             complement(713884..714276)
                     /codon_start=1
                     /locus_tag="KF707C_6570"
                     /product="hypothetical protein"
                     /protein_id="BAU72345.1"
                     /transl_table=11
                     /translation="MKAIDIHAALDSITAGRAMPEARHAVAFSQLTQFQPGPSAIHVG
                     RFSGEMPWERHPDGDKLLQVLEGRVEVTLLPDIGLLRETVLAGSLLVIPRGLWHRLEG
                     VEAAVLAVVPLRTEVSRGEKPAALNRSA"
     CDS             complement(714405..715766)
                     /codon_start=1
                     /locus_tag="KF707C_6580"
                     /product="probable porin"
                     /protein_id="BAU72346.1"
                     /transl_table=11
                     /translation="MHPIPRSILLALAMGSGPALAAGFLDDSQANLALRNFYFNQDNR
                     EGRSGETEEWGQGLRLDYQSGFTQGTFGFGLDAIGLLGLRLDSGGRAGKPGQSRTPSA
                     LFPLEHDGSPRDEYSSLGLTAKVRYAASEARFGTLIPRLPVIKANDGRLLPQTFEGAQ
                     LTVREVEDLTLLAGRLRKAKGRSQSHRDDLSINGANSPRKAGDAVSAAPARHSDAFDF
                     FGLDYQLTRQLQAQYYLGQLEDFYRQHFLGLNHAQGLPLGTLKTDLRYFHTRALGKNA
                     SRSGRAEGYTAAGYYGDGNDDSGRHRGEVDNRTWSALFTWSHGPHALSGGYQRLSGRS
                     NFIQPNQGNGGDLYLITDRQLNSFARAGERTWLTQYSLDFAPWGLPGLSSSVAYLKGS
                     EIRSERGRLKEWERDFTLAYVLQSGPAKGLGITWRNASLRSQASTDADQNRLFLTYSL
                     PLL"
     CDS             complement(715815..716603)
                     /codon_start=1
                     /EC_number="3.1.3.15"
                     /locus_tag="KF707C_6590"
                     /product="histidinol-phosphatase"
                     /protein_id="BAU72347.1"
                     /transl_table=11
                     /translation="MTTARHQALAEHLADLSRTLLRAHWHSAMPGGQPFDDKADASPV
                     TELDRRIELELRETLVRETPAFGVVGEEFPAHEADAEYVWVLDPIDGTKAFIAGLPVF
                     GTLIALCRDGRPILGVVDLPISGLRWVGVEGEATRLNGHPVTTRPCAELAQALLASSN
                     PESPPDHHLDALARLRRATRWRLYGGACSAYANLACGRLDLVVDSGGMTPVDYCALVP
                     VIEGAGGVISDWHGAPLGLHSGDTVVAAGDPALHRRTLELLHRA"
     CDS             complement(716619..717611)
                     /codon_start=1
                     /locus_tag="KF707C_6600"
                     /note="iron-binding protein"
                     /product="ferric iron ABC transporter"
                     /protein_id="BAU72348.1"
                     /transl_table=11
                     /translation="MTFPWNNPLPALLAAIALALMQPAAASGKAVLYTTNNDSAVQAL
                     LDSGTRLAPDLKIGVVNGSSAALLKRIEAESRAARADVFWSSQPNTLGAFTSLYQPYR
                     SPQAAAIAPAHHHPDQLWSTANIQVVVMMVNRKQLGDLAEPSHWRDLLAPAWKGRIIV
                     GDPATTSTAYTVLWGLRQLLGAEDFQRLAANLVVSRNSSAVLNQVAQGEYAVGLTFEG
                     NAYAYVAGGQEEIRLVYPQEGTFVTEEALVLVKNGPNPEGGRRLYDLLLSRDTQVALL
                     ERAYRRPSRGDIQVGAHVGLPELDDIKVFAVDDLAAVAGRDDFLLAWKALDKAR"
     CDS             complement(717635..719272)
                     /codon_start=1
                     /locus_tag="KF707C_6610"
                     /note="permease protein"
                     /product="ferric iron ABC transporter"
                     /protein_id="BAU72349.1"
                     /transl_table=11
                     /translation="MNSRLPSIWHLLALCALALLLTFLLWPLANLLFSSVFGAGAEGT
                     GWSQLRDDPSYLRALGNTLLLGCLVTACAGVLGVSLAYVTARFDFPGKALVAVLPVCT
                     LVVPEVIVSQTWLMILGNNGLLTRILDEHLGLALPSFYGWPGLVLVMSLVYYTYIYLG
                     TLAAIRGFDAQLEEAAQSLGTPPARARLQVMLPVVMPAVLASGLLVFTLAVGNFAIAT
                     LLGGKVQLLSVLTYLSFISEMGTNASLQSALATLSIAIVAGVLFLQRWLVSRKRYEIV
                     QGRSAPARRLRGIRGLLLGGGTVLFILLSSLPLLMVLVSAFTQSRGPVMQWGVFSLDN
                     LGRVLLRNPEPILNTLAYGALATLIGILLSVVISYLVIKKKNLLTPAIDYLAMLPLAM
                     SGTVLGIGLVMTFNTGPLALSGTAAILVVAFVIRRFPFGVRSASATLYNIPDSLEEAS
                     ISLGVPPLRSFLKVVLPLMAPAVAAAAVLTWTTIVAELSASLVVYSAGRETITIQVFR
                     LIETGLQGQAAAYGLILVLLTLTPVVIATRVFHIKIF"
     CDS             complement(719269..720339)
                     /codon_start=1
                     /locus_tag="KF707C_6620"
                     /product="probable ATP-binding component of ABC
                     transporter"
                     /protein_id="BAU72350.1"
                     /transl_table=11
                     /translation="MSSISIRQLEVSYGSGVKVIDGLDLEIPEGSFFTLLGPSGCGKT
                     TLLRVIAGFIHPTRGSLSLGAVDMTRMPPHRRGIGMVFQDYALFPDKTVFDNVAYGLR
                     ARKLDAARIRQKVGEYLERVGMDGFADRHPAALSGGQRQRVALARALAIEPEVLLMDE
                     PLSNLDARLRLQIRTAIAELQREIGITTVFVTHDQEEALALSDQIALMRQGRIEQLGS
                     PQAIYQSPSSTYVADFVGSANLLAARVLEQTDADSVAILVAGQSLLARTDGPLEQPSV
                     HLVARPESIRLRAAGQANGNSLDGWIHRKQYLGNRTSYSIRLTDTQRVSVDRFGPDDG
                     GFLEGQPVSLEFDPQHVRVVSR"
     CDS             complement(720509..721288)
                     /codon_start=1
                     /locus_tag="KF707C_6630"
                     /note="AraC family"
                     /product="transcriptional regulator"
                     /protein_id="BAU72351.1"
                     /transl_table=11
                     /translation="MRNLLAGVVRMMQIEHLPLAPDLPGLLTCLEQVAPLLDAMPGVV
                     FFVKDLEARYVLVNQTLARRCGVNDKASLLGRTAEDVFPSRFGSRYTEQDRQVLDGGE
                     PLSDQLELHLYPGRQPGWCLTHKLALRDLGRRVIGMAGISYDLQAPQSSHPAYQRLAA
                     VDAYIREHFADPISLDDLTAIAELSVAQLGRLCKRIFQLTPRQMIHKARLGAATQLLA
                     GDLPITEIAHQCGYSDHSAFSRQFRTHTGLSPSQYRDSFHR"
     CDS             complement(721554..722441)
                     /codon_start=1
                     /locus_tag="KF707C_6640"
                     /product="octaprenyl-diphosphate synthase"
                     /protein_id="BAU72352.1"
                     /transl_table=11
                     /translation="MIAGYQARCQQRVDAALAALFEPPLAPLERLYQAMRYSVVNGGK
                     RVRPLLVYAACEALGGDPARADGAACAVELIHAYSLVHDDLPAMDDDDLRRGQPTTHI
                     AFDEACAILAGDGLQALAFEVLADAERNPQDAETRLAMVASLGHAAGPAGMVGGQAID
                     LGSVGLKLDQAALETMHRHKTGALIEASVRLGALASGQATPAALAALRIYARAVGLAF
                     QVQDDILDVESDTATLGKTQGKDQAHDKPTYPALLGMDRAKAYALELRDQALAAVAGL
                     GDSAEPLRALARYIVERRS"
     CDS             complement(722438..722680)
                     /codon_start=1
                     /EC_number="3.1.11.6"
                     /locus_tag="KF707C_6650"
                     /product="exodeoxyribonuclease VII small subunit"
                     /protein_id="BAU72353.1"
                     /transl_table=11
                     /translation="MARKKATPDFEQSLAELQTLVERLESGELSLEDSLGAFEQGIRL
                     TRECQAALNQAEQKVQILLERDGQLEEAPFDADDQA"
     CDS             complement(722780..723538)
                     /codon_start=1
                     /locus_tag="KF707C_6660"
                     /product="Mlr4286 protein"
                     /protein_id="BAU72354.1"
                     /transl_table=11
                     /translation="MSLHDVILLLLAGFAAGGMNALAGGGTFFSFPALLATGLPPVTA
                     NATNAVALWPASLAASWAAREQLRSLGRYVLPLVALSVLGGVGGGLLLLAGGDETFRK
                     LIPWLLLAATLLFAASPWLSRLVNRQRTAGELPPHGPGSGLAHALVAVYGGYFGAGMG
                     ILQLAAFSIEGHPLLRANALKNLLSSVIYSVAVVTFVIAGRVSWAELAVLLGAASCGG
                     YAGGALARRLPTQWLRGLVIAVGAGMTVYYFVTA"
     CDS             complement(723962..724396)
                     /codon_start=1
                     /locus_tag="KF707C_6670"
                     /product="putative lipoprotein"
                     /protein_id="BAU72355.1"
                     /transl_table=11
                     /translation="MRLTCALVSLFLLAGCSSYRGDAEFIKPVPADRLLAFQEPVPGG
                     GRIVVNRDMGGLGSGCYIAVHVDRQLAARIGTGEVASFEVPAGDRIVGIGIDEQDDTL
                     CSMGRLRREKAAHVDSGQSEHFRIISDNREGFALREDAPTAK"
     CDS             complement(724492..726189)
                     /codon_start=1
                     /locus_tag="KF707C_6680"
                     /product="positive regulator of phenol hydroxylase"
                     /protein_id="BAU72356.1"
                     /transl_table=11
                     /translation="MKVDYKASEHSPTLKDLTDRVRFLGNEGKIWLDEQRMLLLQSAA
                     MGSFRRELVEMLGVERAKGLFLRLGYQSGLKDAELARKLRPDADAVEMFLTGPQLHSL
                     KGMVKVEPLAMNIDIENGLFYADLEWQNSYEVENCRAEGLASDEPVCWTLLGYAISYS
                     SFFLGRQVLYKEVSCRGCGGDRCRIIGKPVEEWEDADAFLRYFQSDPIIDELQALQVQ
                     VADLRQRLEQDAGQFYGIGKAPLYRKACTLIDKVAPGKASVLLLGETGVGKEVMARSL
                     HLRSERAGGPFVALNCAAIPPDLIEAELFGVERGAYTGAQQSRMGRFERAHGGTLFLD
                     EVVELTPRAQASLLRVLQEEELERVGDSQTRKVDVRVVAATHEDLARAVKDGRFRADL
                     YYRLNVYPVFIPSLRERKEDIPLLADHFLARLHTAYGKTTLGLSDRALEACMRYDWPG
                     NIRELENLIERGVIITDANQSISADALFPHHSDEAGSIGLTSDGALVDTRASVEPDWV
                     EHLIDSGLSLDAVEEALMQGALKRAQQNVSEAARLLGMTRPALAYRLKKRPGEDGQR"
     CDS             726571..726828
                     /codon_start=1
                     /gene="dmpK"
                     /locus_tag="KF707C_6690"
                     /note="assembly protein DmpK"
                     /product="phenol hydroxylase"
                     /protein_id="BAU72357.1"
                     /transl_table=11
                     /translation="MNPNPQRFDQLPRYVRVRSEPDATFVEFDFAIGYPDLFVELVLP
                     REAFTRFCEQNRVRHMDARMAEAIDADMEKWRYGESRGPAD"
     CDS             726881..727861
                     /codon_start=1
                     /EC_number="1.14.13.7"
                     /gene="dmpL"
                     /locus_tag="KF707C_6700"
                     /note="P1 oxygenase component DmpL"
                     /product="phenol hydroxylase"
                     /protein_id="BAU72358.1"
                     /transl_table=11