LOCUS CAB39620.1 230 aa PRT PLN 14-NOV-2006 DEFINITION Arabidopsis thaliana MADS-box protein AGL11 protein. ACCESSION AL049481-9 PROTEIN_ID CAB39620.1 SOURCE Arabidopsis thaliana (thale cress) ORGANISM Arabidopsis thaliana Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis. REFERENCE 1 AUTHORS Bevan M., Murphy G., Ridley P., Hudson S., Bancroft I., Mewes H.W., Mayer K.F.X., Schueller C. JOURNAL Unpublished. REFERENCE 2 (bases 1 to 92495) AUTHORS EU Arabidopsis sequencing project. JOURNAL Submitted (18-MAR-1999) to the INSDC. MIPS, at the Max-Planck-Institut fuer Biochemie, Am Klopferspitz 18a, D-82152 Martinsried, FRG, E-mail: schuelle@mips.biochem.mpg.de, mayer@mips.biochem.mpg.de Project Coordinator: Mike Bevan, Molecular Genetics Department, Cambridge Laboratory, John Innes Centre, Colney Lane, NR4 7UJ Norwich, UK, E-mail: michael.bevan@bbsrc.ac.uk COMMENT Information on performance of analysis and a more detailed annotation of this entry and other sequences of chromosome 4 can be viewed at: http://websvr.mips.biochem.mpg.de/proj/thal/ FEATURES Qualifiers source /organism="Arabidopsis thaliana" /chromosome="4" /variety="Columbia" /mol_type="genomic DNA" /db_xref="taxon:3702" protein /gene="T5L19.90" /note="Contains MADS-box domain signature and profile [ GKIEIKRIENSTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEY]" /note="contains EST gb:H77016" /db_xref="GOA:Q38836" /db_xref="InterPro:IPR002100" /db_xref="InterPro:IPR002487" /db_xref="InterPro:IPR033896" /db_xref="InterPro:IPR036879" /db_xref="UniProtKB/Swiss-Prot:Q38836" intron_pos 61:2 (1/6) intron_pos 89:0 (2/6) intron_pos 109:2 (3/6) intron_pos 143:0 (4/6) intron_pos 157:0 (5/6) intron_pos 171:0 (6/6) BEGIN 1 MGRGKIEIKR IENSTNRQVT FCKRRNGLLK KAYELSVLCD AEVALIVFST RGRLYEYANN 61 NIRSTIERYK KACSDSTNTS TVQEINAAYY QQESAKLRQQ IQTIQNSNRN LMGDSLSSLS 121 VKELKQVENR LEKAISRIRS KKHELLLVEI ENAQKREIEL DNENIYLRTK VAEVERYQQH 181 HHQMVSGSEI NAIEALASRN YFAHSIMTAG SGSGNGGSYS DPDKKILHLG //