LOCUS AB593166 323 bp mRNA linear HUM 24-AUG-2011 DEFINITION Homo sapiens HP08474 mRNA for hypothetical protein HP08474, complete cds, clone: HP08474-RBd52G10. ACCESSION AB593166 VERSION AB593166.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 323) AUTHORS Kato,S. TITLE Direct Submission JOURNAL Submitted (05-OCT-2010) to the DDBJ/EMBL/GenBank databases. Contact:Seishi Kato National Rehabilitation Center for Persons with Disabilities, Research Institute, Department of Rehabilitation Engineering; 4-1 Namiki, Tokorozawa, Saitama 359-8555, Japan URL :http://www.rehab.go.jp/ REFERENCE 2 AUTHORS Oshikawa,M., Tsutsui,C., Ikegami,T., Fuchida,Y., Matsubara,M., Toyama,S., Usami,R., Ohtoko,K. and Kato,S. TITLE Full-Length Transcriptome Analysis of Human Retina-Derived Cell Lines ARPE-19 and Y79 Using the Vector-Capping Method JOURNAL Invest. Ophthalmol. Vis. Sci. 52, 6662-6670 (2011) COMMENT For cDNA clones and library availability, please contact RIKEN BioResource Center. E-mail: dnabank@brc.riken.jp URL:http://dna.brc.riken.jp/ FEATURES Location/Qualifiers source 1..323 /cell_line="Y79" /cell_type="retinoblastoma" /clone="HP08474-RBd52G10" /clone_lib="pGCAP10/Y79 cDNA" /db_xref="H-InvDB:HIT000563967" /db_xref="taxon:9606" /mol_type="mRNA" /note="The library was prepared by Vector-capping method." /organism="Homo sapiens" CDS 128..238 /codon_start=1 /gene="HP08474" /note="The partial sequence overlaps with the antisense strand against the first exon of RABGGTA." /product="hypothetical protein HP08474" /protein_id="BAJ84094.1" /transl_table=1 /translation="MAQLLGSSDPPASASGVAAGTAGTCHHAWLKHKVFS" BASE COUNT 76 a 82 c 81 g 84 t ORIGIN 1 gtgtccggaa gcagcaagcg tgcctgggca gagaccccca gagtgtaaag aggtcctggg 61 acaggctttg cacgttccac aagagtgtct cgctgtgtcg tctagactgg agtgcagtgg 121 tgtgatcatg gctcaactcc taggctcaag cgatcctcct gcctcagcct ccggagtagc 181 tgctgggact gcaggaacgt gccaccatgc ctggctcaaa cacaaagttt tttcataaaa 241 ctcacttggc ggcaaaattc taccttacct gaagttattt acggggtttt taatttccac 301 tttgaataaa tattcacatc ttg //