LOCUS       AB593166                 323 bp    mRNA    linear   HUM 24-AUG-2011
DEFINITION  Homo sapiens HP08474 mRNA for hypothetical protein HP08474,
            complete cds, clone: HP08474-RBd52G10.
ACCESSION   AB593166
VERSION     AB593166.1
KEYWORDS    FLI_CDNA.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 323)
  AUTHORS   Kato,S.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-OCT-2010) to the DDBJ/EMBL/GenBank databases.
            Contact:Seishi Kato
            National Rehabilitation Center for Persons with Disabilities,
            Research Institute, Department of Rehabilitation Engineering; 4-1
            Namiki, Tokorozawa, Saitama 359-8555, Japan
            URL    :http://www.rehab.go.jp/
REFERENCE   2
  AUTHORS   Oshikawa,M., Tsutsui,C., Ikegami,T., Fuchida,Y., Matsubara,M.,
            Toyama,S., Usami,R., Ohtoko,K. and Kato,S.
  TITLE     Full-Length Transcriptome Analysis of Human Retina-Derived Cell
            Lines ARPE-19 and Y79 Using the Vector-Capping Method
  JOURNAL   Invest. Ophthalmol. Vis. Sci. 52, 6662-6670 (2011)
COMMENT     For cDNA clones and library availability, please contact
            RIKEN BioResource Center.
            E-mail: dnabank@brc.riken.jp
            URL:http://dna.brc.riken.jp/
FEATURES             Location/Qualifiers
     source          1..323
                     /cell_line="Y79"
                     /cell_type="retinoblastoma"
                     /clone="HP08474-RBd52G10"
                     /clone_lib="pGCAP10/Y79 cDNA"
                     /db_xref="H-InvDB:HIT000563967"
                     /db_xref="taxon:9606"
                     /mol_type="mRNA"
                     /note="The library was prepared by Vector-capping method."
                     /organism="Homo sapiens"
     CDS             128..238
                     /codon_start=1
                     /gene="HP08474"
                     /note="The partial sequence overlaps with the antisense
                     strand against the first exon of RABGGTA."
                     /product="hypothetical protein HP08474"
                     /protein_id="BAJ84094.1"
                     /transl_table=1
                     /translation="MAQLLGSSDPPASASGVAAGTAGTCHHAWLKHKVFS"
BASE COUNT           76 a           82 c           81 g           84 t
ORIGIN      
        1 gtgtccggaa gcagcaagcg tgcctgggca gagaccccca gagtgtaaag aggtcctggg
       61 acaggctttg cacgttccac aagagtgtct cgctgtgtcg tctagactgg agtgcagtgg
      121 tgtgatcatg gctcaactcc taggctcaag cgatcctcct gcctcagcct ccggagtagc
      181 tgctgggact gcaggaacgt gccaccatgc ctggctcaaa cacaaagttt tttcataaaa
      241 ctcacttggc ggcaaaattc taccttacct gaagttattt acggggtttt taatttccac
      301 tttgaataaa tattcacatc ttg
//