LOCUS       Z47372                   194 bp    mRNA    linear   HUM 14-NOV-2006
DEFINITION  H.sapiens mRNA for T-cell receptor beta-chain V-D-J-C-region.
ACCESSION   Z47372
VERSION     Z47372.1
KEYWORDS    constant region; diversity region; joining region; T-cell receptor;
            T-cell receptor beta-chain; variable region.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 66 to 146)
  AUTHORS   Breiteneder H., Scheiner O., Hajek R., Hulla W., Huettinger R.,
            Fischer G.F., Kraft D., Ebner C.
  TITLE     Diversity of TCRAV and TCRBV sequences used by human T cell clones
            specific for a minimal epitope of Bet v 1, the major birch pollen
            allergen.
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 194)
  AUTHORS   Breiteneder H.
  JOURNAL   Submitted (06-JAN-1995) to the INSDC. Breiteneder H., General and
            Experimental Pathology, Applied Experimental Pathology, Waehringer
            Guertel 18-20, Vienna, Austria, 1090
REFERENCE   3  (bases 1 to 194)
  AUTHORS   Breiteneder H., Scheiner O., Hajek R., Hulla W., Huettinger R.,
            Fischer G.F., Kraft D., Ebner C.
  TITLE     Diversity of TCRAV and TCRBV sequences used by human T-cell clones
            specific for a minimal epitope of Bet v 1, the major birch pollen
            allergen
  JOURNAL   Immunogenetics 42(1), 53-58(1995).
   PUBMED   7797268
FEATURES             Location/Qualifiers
     source          1..194
                     /db_xref="H-InvDB:HIT000327383"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /sex="male"
                     /clone="XPF10"
                     /cell_type="T-helper cell"
                     /tissue_type="blood"
                     /db_xref="taxon:9606"
     CDS             1..194
                     /partial
                     /codon_start=3
                     /standard_name="TCRBV2S3"
                     /product="T-cell receptor beta-chain V-region (V-D-J-C)"
                     /db_xref="H-InvDB:HIT000327383.12"
                     /citation=[1]
                     /protein_id="CAA87449.1"
                     /translation="INHASLTLSTLTVTSAHPEDSSFYICSAREGQIQYFGAGTRLSV
                     LEDLKNVFPPEVAVFEPSEA"
     V_region        1..86
                     /standard_name="TCRBV2S3"
                     /citation=[1]
     D_segment       92..98
                     /standard_name="TCRBD2"
                     /citation=[1]
     J_segment       99..137
                     /standard_name="TCRBJ2S1"
                     /citation=[1]
     C_region        138..194
                     /standard_name="TCRBC2"
                     /citation=[1]
BASE COUNT           46 a           58 c           50 g           40 t
ORIGIN      
        1 tcatcaacca tgcaagcctg accttgtcca ctctgacagt gaccagtgcc catcctgaag
       61 acagcagctt ctacatctgc agtgctagag agggacagat tcagtacttc ggcgccggga
      121 cccggctctc agtgctggag gacctgaaaa acgtgttccc acccgaggtc gctgtgtttg
      181 agccatcaga agca
//