LOCUS Z47372 194 bp mRNA linear HUM 14-NOV-2006 DEFINITION H.sapiens mRNA for T-cell receptor beta-chain V-D-J-C-region. ACCESSION Z47372 VERSION Z47372.1 KEYWORDS constant region; diversity region; joining region; T-cell receptor; T-cell receptor beta-chain; variable region. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 66 to 146) AUTHORS Breiteneder H., Scheiner O., Hajek R., Hulla W., Huettinger R., Fischer G.F., Kraft D., Ebner C. TITLE Diversity of TCRAV and TCRBV sequences used by human T cell clones specific for a minimal epitope of Bet v 1, the major birch pollen allergen. JOURNAL Unpublished. REFERENCE 2 (bases 1 to 194) AUTHORS Breiteneder H. JOURNAL Submitted (06-JAN-1995) to the INSDC. Breiteneder H., General and Experimental Pathology, Applied Experimental Pathology, Waehringer Guertel 18-20, Vienna, Austria, 1090 REFERENCE 3 (bases 1 to 194) AUTHORS Breiteneder H., Scheiner O., Hajek R., Hulla W., Huettinger R., Fischer G.F., Kraft D., Ebner C. TITLE Diversity of TCRAV and TCRBV sequences used by human T-cell clones specific for a minimal epitope of Bet v 1, the major birch pollen allergen JOURNAL Immunogenetics 42(1), 53-58(1995). PUBMED 7797268 FEATURES Location/Qualifiers source 1..194 /db_xref="H-InvDB:HIT000327383" /organism="Homo sapiens" /mol_type="mRNA" /sex="male" /clone="XPF10" /cell_type="T-helper cell" /tissue_type="blood" /db_xref="taxon:9606" CDS 1..194 /partial /codon_start=3 /standard_name="TCRBV2S3" /product="T-cell receptor beta-chain V-region (V-D-J-C)" /db_xref="H-InvDB:HIT000327383.12" /citation=[1] /protein_id="CAA87449.1" /translation="INHASLTLSTLTVTSAHPEDSSFYICSAREGQIQYFGAGTRLSV LEDLKNVFPPEVAVFEPSEA" V_region 1..86 /standard_name="TCRBV2S3" /citation=[1] D_segment 92..98 /standard_name="TCRBD2" /citation=[1] J_segment 99..137 /standard_name="TCRBJ2S1" /citation=[1] C_region 138..194 /standard_name="TCRBC2" /citation=[1] BASE COUNT 46 a 58 c 50 g 40 t ORIGIN 1 tcatcaacca tgcaagcctg accttgtcca ctctgacagt gaccagtgcc catcctgaag 61 acagcagctt ctacatctgc agtgctagag agggacagat tcagtacttc ggcgccggga 121 cccggctctc agtgctggag gacctgaaaa acgtgttccc acccgaggtc gctgtgtttg 181 agccatcaga agca //