LOCUS Z38026 615 bp mRNA linear HUM 18-APR-2005 DEFINITION H.sapiens mRNA for FALL-39 peptide antibiotic. ACCESSION Z38026 VERSION Z38026.1 KEYWORDS FALL-39; peptide antibiotic. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 615) AUTHORS Agerberth B., Gunne H., Odeberg J., Kogner P., Boman H.G., Gudmundsson G.H. TITLE FALL-39, a putative human peptide antibiotic, is cysteine-free and expressed in bone marrow and testis JOURNAL Proc. Natl. Acad. Sci. U.S.A. 92(1), 195-199(1995). PUBMED 7529412 REFERENCE 2 (bases 1 to 615) AUTHORS Gudmundsson G.G. JOURNAL Submitted (28-SEP-1994) to the INSDC. Gudmundur H. Gudmundsson, Microbiology, University of Stockholm, Svante, Arrheniusvag 16, Stockholm, S-106 91, Sweden FEATURES Location/Qualifiers source 1..615 /db_xref="H-InvDB:HIT000327176" /organism="Homo sapiens" /mol_type="mRNA" /clone_lib="human bone marrow lambdagt11" /clone="Hu7" /tissue_type="Bone marrow" /db_xref="taxon:9606" CDS 12..524 /product="FALL-39 peptide antibiotic" /db_xref="GOA:P49913" /db_xref="H-InvDB:HIT000327176.12" /db_xref="HGNC:HGNC:1472" /db_xref="InterPro:IPR001894" /db_xref="InterPro:IPR018216" /db_xref="InterPro:IPR022746" /db_xref="PDB:2FBS" /db_xref="PDB:2FBU" /db_xref="PDB:2FCG" /db_xref="PDB:2K6O" /db_xref="PDB:2LMF" /db_xref="PDB:2NA3" /db_xref="PDB:4EYC" /db_xref="PDB:5NMN" /db_xref="PDB:5NNK" /db_xref="PDB:5NNM" /db_xref="PDB:5NNT" /db_xref="PDB:5XNG" /db_xref="PDB:5XRX" /db_xref="PDB:6BIV" /db_xref="PDB:6BIX" /db_xref="UniProtKB/Swiss-Prot:P49913" /protein_id="CAA86115.1" /translation="MKTQRNGHSLGRWSLVLLLLGLVMPLAIIAQVLSYKEAVLRAID GINQRSSDANLYRLLDLDPRPTMDGDPDTPKPVSFTVKETVCPRTTQQSPEDCDFKKD GLVKRCMGTVTLNQARGSFDISCDKDNKRFALLGDFFRKSKEKIGKEFKRIVQRIKDF LRNLVPRTES" mat_peptide 405..521 /product="FALL-39 peptide antibiotic" BASE COUNT 167 a 152 c 168 g 128 t ORIGIN 1 gaattccggc catgaagacc caaaggaatg gccactccct ggggcggtgg tcactggtgc 61 tcctgctgct gggcctggtg atgcctctgg ccatcattgc ccaggtcctc agctacaagg 121 aagctgtcct tcgtgctata gatggcatca accagcggtc ctcggatgct aacctctacc 181 gcctcctgga cctggacccc aggcccacga tggatgggga cccagacacg ccaaagcctg 241 tgagcttcac agtgaaggag acagtgtgcc ccaggacgac acagcagtca ccagaggatt 301 gtgacttcaa gaaggacggg ctggtgaagc ggtgtatggg gacagtgacc ctcaaccagg 361 ccaggggctc ctttgacatc agttgtgata aggataacaa gagatttgcc ctgctgggtg 421 atttcttccg gaaatctaaa gagaagattg gcaaagagtt taaaagaatt gtccagagaa 481 tcaaggattt tttgcggaat cttgtaccca ggacagagtc ctagtgtgtg ccctaccctg 541 gctcaggctt ctgggctctg agaaataaac tatgagagca atttcaaaaa aaaaaaaaaa 601 aaaaaaccgg aattc //