LOCUS       Z38026                   615 bp    mRNA    linear   HUM 18-APR-2005
DEFINITION  H.sapiens mRNA for FALL-39 peptide antibiotic.
ACCESSION   Z38026
VERSION     Z38026.1
KEYWORDS    FALL-39; peptide antibiotic.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 615)
  AUTHORS   Agerberth B., Gunne H., Odeberg J., Kogner P., Boman H.G.,
            Gudmundsson G.H.
  TITLE     FALL-39, a putative human peptide antibiotic, is cysteine-free and
            expressed in bone marrow and testis
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 92(1), 195-199(1995).
   PUBMED   7529412
REFERENCE   2  (bases 1 to 615)
  AUTHORS   Gudmundsson G.G.
  JOURNAL   Submitted (28-SEP-1994) to the INSDC. Gudmundur H. Gudmundsson,
            Microbiology, University of Stockholm, Svante, Arrheniusvag 16,
            Stockholm, S-106 91, Sweden
FEATURES             Location/Qualifiers
     source          1..615
                     /db_xref="H-InvDB:HIT000327176"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /clone_lib="human bone marrow lambdagt11"
                     /clone="Hu7"
                     /tissue_type="Bone marrow"
                     /db_xref="taxon:9606"
     CDS             12..524
                     /product="FALL-39 peptide antibiotic"
                     /db_xref="GOA:P49913"
                     /db_xref="H-InvDB:HIT000327176.12"
                     /db_xref="HGNC:HGNC:1472"
                     /db_xref="InterPro:IPR001894"
                     /db_xref="InterPro:IPR018216"
                     /db_xref="InterPro:IPR022746"
                     /db_xref="PDB:2FBS"
                     /db_xref="PDB:2FBU"
                     /db_xref="PDB:2FCG"
                     /db_xref="PDB:2K6O"
                     /db_xref="PDB:2LMF"
                     /db_xref="PDB:2NA3"
                     /db_xref="PDB:4EYC"
                     /db_xref="PDB:5NMN"
                     /db_xref="PDB:5NNK"
                     /db_xref="PDB:5NNM"
                     /db_xref="PDB:5NNT"
                     /db_xref="PDB:5XNG"
                     /db_xref="PDB:5XRX"
                     /db_xref="PDB:6BIV"
                     /db_xref="PDB:6BIX"
                     /db_xref="UniProtKB/Swiss-Prot:P49913"
                     /protein_id="CAA86115.1"
                     /translation="MKTQRNGHSLGRWSLVLLLLGLVMPLAIIAQVLSYKEAVLRAID
                     GINQRSSDANLYRLLDLDPRPTMDGDPDTPKPVSFTVKETVCPRTTQQSPEDCDFKKD
                     GLVKRCMGTVTLNQARGSFDISCDKDNKRFALLGDFFRKSKEKIGKEFKRIVQRIKDF
                     LRNLVPRTES"
     mat_peptide     405..521
                     /product="FALL-39 peptide antibiotic"
BASE COUNT          167 a          152 c          168 g          128 t
ORIGIN      
        1 gaattccggc catgaagacc caaaggaatg gccactccct ggggcggtgg tcactggtgc
       61 tcctgctgct gggcctggtg atgcctctgg ccatcattgc ccaggtcctc agctacaagg
      121 aagctgtcct tcgtgctata gatggcatca accagcggtc ctcggatgct aacctctacc
      181 gcctcctgga cctggacccc aggcccacga tggatgggga cccagacacg ccaaagcctg
      241 tgagcttcac agtgaaggag acagtgtgcc ccaggacgac acagcagtca ccagaggatt
      301 gtgacttcaa gaaggacggg ctggtgaagc ggtgtatggg gacagtgacc ctcaaccagg
      361 ccaggggctc ctttgacatc agttgtgata aggataacaa gagatttgcc ctgctgggtg
      421 atttcttccg gaaatctaaa gagaagattg gcaaagagtt taaaagaatt gtccagagaa
      481 tcaaggattt tttgcggaat cttgtaccca ggacagagtc ctagtgtgtg ccctaccctg
      541 gctcaggctt ctgggctctg agaaataaac tatgagagca atttcaaaaa aaaaaaaaaa
      601 aaaaaaccgg aattc
//