LOCUS       Z37163                    99 bp    mRNA    linear   HUM 18-APR-2005
DEFINITION  H.sapiens mRNA for homologue of the mouse Cctq gene.
ACCESSION   Z37163
VERSION     Z37163.1
KEYWORDS    Cctq gene.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 99)
  AUTHORS   Kubota H., Hynes G., Willison K.
  TITLE     The eighth Cct gene, Cctq, encoding the theta subunit of the
            cytosolic chaperonin containing TCP-1
  JOURNAL   Gene 154(2), 231-236(1995).
   PUBMED   7890169
REFERENCE   2  (bases 1 to 99)
  AUTHORS   Kubota H.
  JOURNAL   Submitted (13-SEP-1994) to the INSDC. Hiroshi Kubota, Institute of
            Cancer Research, Chester Beatty, Laboratories, 237 Fulham Road,
            London, SW3 6JB, United Kingdom
FEATURES             Location/Qualifiers
     source          1..99
                     /db_xref="H-InvDB:HIT000327169"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /clone_lib="lambda ZAP2 (pBluescript2 SK-)"
                     /clone="ph13"
                     /cell_line="HT1080"
                     /db_xref="taxon:9606"
     mRNA            <1..>99
                     /gene="Cctq"
                     /note="This partial cDNA (clone ph13) shows 87% nucleotide
                     identity to the mouse Cctq gene which encodes the theta
                     subunit of the chaperonin containg TCP-1 (CCT)."
     CDS             <1..>99
                     /codon_start=1
                     /gene="Cctq"
                     /db_xref="GOA:P50990"
                     /db_xref="H-InvDB:HIT000327169.12"
                     /db_xref="HGNC:HGNC:1623"
                     /db_xref="InterPro:IPR002194"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR012721"
                     /db_xref="InterPro:IPR017998"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027410"
                     /db_xref="InterPro:IPR027413"
                     /db_xref="PDB:6NR8"
                     /db_xref="PDB:6NR9"
                     /db_xref="PDB:6NRA"
                     /db_xref="PDB:6NRB"
                     /db_xref="PDB:6NRC"
                     /db_xref="PDB:6NRD"
                     /db_xref="PDB:6QB8"
                     /db_xref="UniProtKB/Swiss-Prot:P50990"
                     /protein_id="CAA85520.1"
                     /translation="IQACKELAQTTRTAYGPNGMNKMVINHLEKLFV"
BASE COUNT           34 a           20 c           22 g           23 t
ORIGIN      
        1 atacaagctt gcaaggagct tgcccaaacc actcgtacag catatggacc aaatggaatg
       61 aacaaaatgg ttatcaacca cttggagaag ttgtttgtg
//