LOCUS Z37163 99 bp mRNA linear HUM 18-APR-2005 DEFINITION H.sapiens mRNA for homologue of the mouse Cctq gene. ACCESSION Z37163 VERSION Z37163.1 KEYWORDS Cctq gene. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 99) AUTHORS Kubota H., Hynes G., Willison K. TITLE The eighth Cct gene, Cctq, encoding the theta subunit of the cytosolic chaperonin containing TCP-1 JOURNAL Gene 154(2), 231-236(1995). PUBMED 7890169 REFERENCE 2 (bases 1 to 99) AUTHORS Kubota H. JOURNAL Submitted (13-SEP-1994) to the INSDC. Hiroshi Kubota, Institute of Cancer Research, Chester Beatty, Laboratories, 237 Fulham Road, London, SW3 6JB, United Kingdom FEATURES Location/Qualifiers source 1..99 /db_xref="H-InvDB:HIT000327169" /organism="Homo sapiens" /mol_type="mRNA" /clone_lib="lambda ZAP2 (pBluescript2 SK-)" /clone="ph13" /cell_line="HT1080" /db_xref="taxon:9606" mRNA <1..>99 /gene="Cctq" /note="This partial cDNA (clone ph13) shows 87% nucleotide identity to the mouse Cctq gene which encodes the theta subunit of the chaperonin containg TCP-1 (CCT)." CDS <1..>99 /codon_start=1 /gene="Cctq" /db_xref="GOA:P50990" /db_xref="H-InvDB:HIT000327169.12" /db_xref="HGNC:HGNC:1623" /db_xref="InterPro:IPR002194" /db_xref="InterPro:IPR002423" /db_xref="InterPro:IPR012721" /db_xref="InterPro:IPR017998" /db_xref="InterPro:IPR027409" /db_xref="InterPro:IPR027410" /db_xref="InterPro:IPR027413" /db_xref="PDB:6NR8" /db_xref="PDB:6NR9" /db_xref="PDB:6NRA" /db_xref="PDB:6NRB" /db_xref="PDB:6NRC" /db_xref="PDB:6NRD" /db_xref="PDB:6QB8" /db_xref="UniProtKB/Swiss-Prot:P50990" /protein_id="CAA85520.1" /translation="IQACKELAQTTRTAYGPNGMNKMVINHLEKLFV" BASE COUNT 34 a 20 c 22 g 23 t ORIGIN 1 atacaagctt gcaaggagct tgcccaaacc actcgtacag catatggacc aaatggaatg 61 aacaaaatgg ttatcaacca cttggagaag ttgtttgtg //