LOCUS Z37147 342 bp mRNA linear HUM 16-JUN-1997 DEFINITION H.sapiens rearranged anti-Desmosome antibody immunoglobulin light-chain variable region. ACCESSION Z37147 VERSION Z37147.1 KEYWORDS diversity region; immunoglobulin light chain; joining region; variable region. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 2 (bases 1 to 342) AUTHORS Brard F. JOURNAL Submitted (07-SEP-1994) to the INSDC. Brard F., Laboratoire d'Immunopathologie Clinique et Experimentale, C.H.U. Charles Nicolle, 1, rue de Germont, Pavillon Derocque, ROUEN CEDEX, FRANCE, 76031 REFERENCE 3 (bases 1 to 342) AUTHORS Gilbert D., Courville P., Brard F., Joly P., PETIT S., Bernardi E., Schoofs A.R., Lauret P., Tron F. TITLE A complementarity-determining region peptide of an anti-desmosome autoantibody may interact with the desmosomal plaque through molecular mimicry with a cytoplasmic desmoglein 1 sequence JOURNAL Eur. J. Immunol. 27(5), 1055-1060(1997). PUBMED 9174592 FEATURES Location/Qualifiers source 1..342 /db_xref="H-InvDB:HIT000327167" /organism="Homo sapiens" /mol_type="mRNA" /sex="female" /dev_stage="Juvenile (14 years old)" /clone="F12VL" /cell_line="SPAZ 4" /cell_type="B Hybridoma" /tissue_type="Blood" /db_xref="taxon:9606" primer_bind 1..24 CDS <1..>342 /codon_start=1 /product="anti-Desmosome antibody light chain variable region mRNA" /note="IgK-chain V-J region (IgM,K)" /db_xref="H-InvDB:HIT000327167.11" /protein_id="CAA85510.1" /translation="DIVMTQSPDSLALSLGERATINCKSSQSVLYSSNNKNYLAWYQQ KPGQPPKLLIYWASSRESGVPDRFSGSGSGTDFTLTISSLQAEDVALYYCHQFFTSPL TFGGGTKVEIKR" V_region 1..342 /product="Ig Kappa-light chain (F12 VK)" /note="Kappa light chain V-J region (F12 VK)" /experiment="experimental evidence, no additional details recorded" misc_feature 70..120 /product="Immunoglobulin light chain VK4 variable region" /note="CDR1 (V-segment F12 VK)" misc_feature 166..186 /product="Ig kappa light chain variable region" /note="CDR2" misc_feature 283..312 /product="Ig Kappa light chain V-J region (F12 VL)" /note="CDR3/VK4-JK4" J_segment 304..342 /product="Immunoglobulin JK region" /note="JK4 segment" BASE COUNT 79 a 97 c 84 g 82 t ORIGIN 1 gacatcgtga tgacccagtc tccagactcc ctggctctgt ctctgggcga gagggccacc 61 atcaactgca agtccagcca gagtgtttta tacagctcca acaataagaa ctacttagct 121 tggtaccagc agaaaccagg acagcctcct aagctgctca tttactgggc ttcttcccgg 181 gaatccgggg tccctgaccg attcagtggc agcgggtctg ggacagattt cactctcacc 241 atcagcagcc tgcaggctga agatgtggca ctttattact gtcaccagtt ttttactagt 301 cctctcactt tcggcggagg gaccaaggtg gagatcaaac gt //