LOCUS       Z37147                   342 bp    mRNA    linear   HUM 16-JUN-1997
DEFINITION  H.sapiens rearranged anti-Desmosome antibody immunoglobulin
            light-chain variable region.
ACCESSION   Z37147
VERSION     Z37147.1
KEYWORDS    diversity region; immunoglobulin light chain; joining region;
            variable region.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   2  (bases 1 to 342)
  AUTHORS   Brard F.
  JOURNAL   Submitted (07-SEP-1994) to the INSDC. Brard F., Laboratoire
            d'Immunopathologie Clinique et Experimentale, C.H.U. Charles
            Nicolle, 1, rue de Germont, Pavillon Derocque, ROUEN CEDEX, FRANCE,
            76031
REFERENCE   3  (bases 1 to 342)
  AUTHORS   Gilbert D., Courville P., Brard F., Joly P., PETIT S., Bernardi E.,
            Schoofs A.R., Lauret P., Tron F.
  TITLE     A complementarity-determining region peptide of an anti-desmosome
            autoantibody may interact with the desmosomal plaque through
            molecular mimicry with a cytoplasmic desmoglein 1 sequence
  JOURNAL   Eur. J. Immunol. 27(5), 1055-1060(1997).
   PUBMED   9174592
FEATURES             Location/Qualifiers
     source          1..342
                     /db_xref="H-InvDB:HIT000327167"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /sex="female"
                     /dev_stage="Juvenile (14 years old)"
                     /clone="F12VL"
                     /cell_line="SPAZ 4"
                     /cell_type="B Hybridoma"
                     /tissue_type="Blood"
                     /db_xref="taxon:9606"
     primer_bind     1..24
     CDS             <1..>342
                     /codon_start=1
                     /product="anti-Desmosome antibody light chain variable
                     region mRNA"
                     /note="IgK-chain V-J region (IgM,K)"
                     /db_xref="H-InvDB:HIT000327167.11"
                     /protein_id="CAA85510.1"
                     /translation="DIVMTQSPDSLALSLGERATINCKSSQSVLYSSNNKNYLAWYQQ
                     KPGQPPKLLIYWASSRESGVPDRFSGSGSGTDFTLTISSLQAEDVALYYCHQFFTSPL
                     TFGGGTKVEIKR"
     V_region        1..342
                     /product="Ig Kappa-light chain (F12 VK)"
                     /note="Kappa light chain V-J region (F12 VK)"
                     /experiment="experimental evidence, no additional details
                     recorded"
     misc_feature    70..120
                     /product="Immunoglobulin light chain VK4 variable region"
                     /note="CDR1 (V-segment F12 VK)"
     misc_feature    166..186
                     /product="Ig kappa light chain variable region"
                     /note="CDR2"
     misc_feature    283..312
                     /product="Ig Kappa light chain V-J region (F12 VL)"
                     /note="CDR3/VK4-JK4"
     J_segment       304..342
                     /product="Immunoglobulin JK region"
                     /note="JK4 segment"
BASE COUNT           79 a           97 c           84 g           82 t
ORIGIN      
        1 gacatcgtga tgacccagtc tccagactcc ctggctctgt ctctgggcga gagggccacc
       61 atcaactgca agtccagcca gagtgtttta tacagctcca acaataagaa ctacttagct
      121 tggtaccagc agaaaccagg acagcctcct aagctgctca tttactgggc ttcttcccgg
      181 gaatccgggg tccctgaccg attcagtggc agcgggtctg ggacagattt cactctcacc
      241 atcagcagcc tgcaggctga agatgtggca ctttattact gtcaccagtt ttttactagt
      301 cctctcactt tcggcggagg gaccaaggtg gagatcaaac gt
//