LOCUS       Z34893                   313 bp    mRNA    linear   HUM 01-JUL-1994
DEFINITION  H.sapiens (RFTS7H) mRNA for immunoglobulin gamma chain variable
            region, rheumatoid factor (313bp).
ACCESSION   Z34893
VERSION     Z34893.1
KEYWORDS    immunoglobulin gamma chain variable region; rheumatoid factor.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 313)
  AUTHORS   Randen I., Pascual V., Victor K., Thompson K.M., Forre O.,
            Capra D.J., Natvig J.B.
  TITLE     Synovial IgG rheumatoid factors show evidence of an antigen-driven
            immune response and a shift in the V gene repertoire compared to
            IgM rheumatoid factors
  JOURNAL   Eur. J. Immunol. 23(6), 1220-1225(1993).
   PUBMED   8500520
REFERENCE   2  (bases 1 to 313)
  AUTHORS   Thompson K.M.
  JOURNAL   Submitted (27-JUN-1994) to the INSDC. Thompson K. M., I.G.R.I,
            Immunolgoy, Fr. Qvams Gt.1, Oslo, Norway, 0172
FEATURES             Location/Qualifiers
     source          1..313
                     /db_xref="H-InvDB:HIT000326985_02"
                     /organism="Homo sapiens"
                     /isolate="rheumatoid arthritis patient TS"
                     /mol_type="mRNA"
                     /sex="female"
                     /dev_stage="Adult"
                     /cell_line="RF-TS7"
                     /cell_type="Hybridoma"
                     /tissue_type="Synovium"
                     /db_xref="taxon:9606"
     CDS             <1..>313
                     /codon_start=1
                     /gene="Ig VH1(D)"
                     /product="IgG, variable region, rheumatoid factor,
                     autoantibody"
                     /note="immunoglobulin superfamily; IgG; immunoglobulin
                     heavy chain; variable region; rheumatoid factor;
                     autoantibody; hybridomas; secreted immunoglobulin; "
                     /citation=[1]
                     /protein_id="CAA84376.1"
                     /translation="QVQLVQSGAEVKKPGASVKVSCKASGYTFTGYYIHWVRQAPGQG
                     LEWMGRINPNSGGTHYAQKFQGRVTMTRDTSISTAYMELSRLRSDDTAVYYCARGYQM
                     DV"
BASE COUNT           75 a           77 c          101 g           60 t
ORIGIN      
        1 caggtgcagc tggtgcagtc tggggctgag gtgaagaagc ctggggcctc agtgaaggtc
       61 tcctgcaagg cttctggata caccttcacc ggctactata tacactgggt gcgacaggcc
      121 cctggacaag ggcttgagtg gatgggacgg atcaacccta acagtggtgg cacacactat
      181 gcacagaagt ttcagggcag ggtcaccatg accagggaca cgtccatcag cacagcctac
      241 atggagctga gcaggctgag atctgacgac acggccgtgt attactgtgc gagaggttac
      301 cagatggatg tga
//