LOCUS Z34893 313 bp mRNA linear HUM 01-JUL-1994 DEFINITION H.sapiens (RFTS7H) mRNA for immunoglobulin gamma chain variable region, rheumatoid factor (313bp). ACCESSION Z34893 VERSION Z34893.1 KEYWORDS immunoglobulin gamma chain variable region; rheumatoid factor. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 313) AUTHORS Randen I., Pascual V., Victor K., Thompson K.M., Forre O., Capra D.J., Natvig J.B. TITLE Synovial IgG rheumatoid factors show evidence of an antigen-driven immune response and a shift in the V gene repertoire compared to IgM rheumatoid factors JOURNAL Eur. J. Immunol. 23(6), 1220-1225(1993). PUBMED 8500520 REFERENCE 2 (bases 1 to 313) AUTHORS Thompson K.M. JOURNAL Submitted (27-JUN-1994) to the INSDC. Thompson K. M., I.G.R.I, Immunolgoy, Fr. Qvams Gt.1, Oslo, Norway, 0172 FEATURES Location/Qualifiers source 1..313 /db_xref="H-InvDB:HIT000326985_02" /organism="Homo sapiens" /isolate="rheumatoid arthritis patient TS" /mol_type="mRNA" /sex="female" /dev_stage="Adult" /cell_line="RF-TS7" /cell_type="Hybridoma" /tissue_type="Synovium" /db_xref="taxon:9606" CDS <1..>313 /codon_start=1 /gene="Ig VH1(D)" /product="IgG, variable region, rheumatoid factor, autoantibody" /note="immunoglobulin superfamily; IgG; immunoglobulin heavy chain; variable region; rheumatoid factor; autoantibody; hybridomas; secreted immunoglobulin; " /citation=[1] /protein_id="CAA84376.1" /translation="QVQLVQSGAEVKKPGASVKVSCKASGYTFTGYYIHWVRQAPGQG LEWMGRINPNSGGTHYAQKFQGRVTMTRDTSISTAYMELSRLRSDDTAVYYCARGYQM DV" BASE COUNT 75 a 77 c 101 g 60 t ORIGIN 1 caggtgcagc tggtgcagtc tggggctgag gtgaagaagc ctggggcctc agtgaaggtc 61 tcctgcaagg cttctggata caccttcacc ggctactata tacactgggt gcgacaggcc 121 cctggacaag ggcttgagtg gatgggacgg atcaacccta acagtggtgg cacacactat 181 gcacagaagt ttcagggcag ggtcaccatg accagggaca cgtccatcag cacagcctac 241 atggagctga gcaggctgag atctgacgac acggccgtgt attactgtgc gagaggttac 301 cagatggatg tga //