LOCUS Z26626 276 bp mRNA linear HUM 16-DEC-1993 DEFINITION H.sapiens MD4.6 mRNA for rearranged Ig kappa light chain variable region. ACCESSION Z26626 VERSION Z26626.1 KEYWORDS immunoglobulin; immunoglobulin light chain; joining region; variable region. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 276) AUTHORS Klein U. JOURNAL Submitted (29-SEP-1993) to the INSDC. Klein U., Universitaet Koeln, Med. Klinik I, LFI-Gebaeude, E4 R706, 50924 Koeln, Germany REFERENCE 2 AUTHORS Klein U., Kueppers R., Rajewsky K. TITLE Human IgM(+)IgD(+) cells, the major B cell subset in the peripheral blood, expresses V(kappa) genes with no or little somatic mutation throughout life JOURNAL Unpublished. REFERENCE 3 (bases 1 to 276) AUTHORS Klein U., Kueppers R., Rajewsky K. TITLE Human IgM+IgD+ B cells, the major B cell subset in the peripheral blood, express V kappa genes with no or little somatic mutation throughout life JOURNAL Eur. J. Immunol. 23(12), 3272-3277(1993). PUBMED 8258343 FEATURES Location/Qualifiers source 1..276 /organism="Homo sapiens" /mol_type="mRNA" /cell_type="IgM IgD B cell" /tissue_type="peripheral blood" /db_xref="taxon:9606" CDS <1..>276 /codon_start=1 /product="Ig kappa light chain V-kappa 4 (VJ)" /protein_id="CAA81379.1" /translation="CKSSQSVLYSSNNKNYLAWYQQKPGQPPKLLIYWASTRESGVPD RFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYSTPPTFGQGTKQEIKR" V_region 1..276 /product="Ig kappa light chain V-kappa 4 (VJ)" /product="Ig kappa light chain (VJ)" V_segment 1..240 /note="V-kappa 4" J_segment 241..276 /note="J-Kappa 2" BASE COUNT 73 a 74 c 66 g 63 t ORIGIN 1 tgcaagtcca gccagagtgt tctatacagc tccaacaata agaactactt agcttggtac 61 cagcagaaac caggacagcc tcctaagctg ctcatttact gggcatctac ccgggaatcc 121 ggggtccctg accgattcag tggcagcggg tctgggacag atttcactct caccatcagc 181 agcctgcagg ctgaagatgt ggcagtttat tactgtcagc aatattatag tactcctccc 241 acttttggcc aggggaccaa gcaggagatt aaacga //