LOCUS       Z26626                   276 bp    mRNA    linear   HUM 16-DEC-1993
DEFINITION  H.sapiens MD4.6 mRNA for rearranged Ig kappa light chain variable
            region.
ACCESSION   Z26626
VERSION     Z26626.1
KEYWORDS    immunoglobulin; immunoglobulin light chain; joining region;
            variable region.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 276)
  AUTHORS   Klein U.
  JOURNAL   Submitted (29-SEP-1993) to the INSDC. Klein U., Universitaet Koeln,
            Med. Klinik I, LFI-Gebaeude, E4 R706, 50924 Koeln, Germany
REFERENCE   2
  AUTHORS   Klein U., Kueppers R., Rajewsky K.
  TITLE     Human IgM(+)IgD(+) cells, the major B cell subset in the peripheral
            blood, expresses V(kappa) genes with no or little somatic mutation
            throughout life
  JOURNAL   Unpublished.
REFERENCE   3  (bases 1 to 276)
  AUTHORS   Klein U., Kueppers R., Rajewsky K.
  TITLE     Human IgM+IgD+ B cells, the major B cell subset in the peripheral
            blood, express V kappa genes with no or little somatic mutation
            throughout life
  JOURNAL   Eur. J. Immunol. 23(12), 3272-3277(1993).
   PUBMED   8258343
FEATURES             Location/Qualifiers
     source          1..276
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /cell_type="IgM IgD B cell"
                     /tissue_type="peripheral blood"
                     /db_xref="taxon:9606"
     CDS             <1..>276
                     /codon_start=1
                     /product="Ig kappa light chain V-kappa 4 (VJ)"
                     /protein_id="CAA81379.1"
                     /translation="CKSSQSVLYSSNNKNYLAWYQQKPGQPPKLLIYWASTRESGVPD
                     RFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYSTPPTFGQGTKQEIKR"
     V_region        1..276
                     /product="Ig kappa light chain V-kappa 4 (VJ)"
                     /product="Ig kappa light chain (VJ)"
     V_segment       1..240
                     /note="V-kappa 4"
     J_segment       241..276
                     /note="J-Kappa 2"
BASE COUNT           73 a           74 c           66 g           63 t
ORIGIN      
        1 tgcaagtcca gccagagtgt tctatacagc tccaacaata agaactactt agcttggtac
       61 cagcagaaac caggacagcc tcctaagctg ctcatttact gggcatctac ccgggaatcc
      121 ggggtccctg accgattcag tggcagcggg tctgggacag atttcactct caccatcagc
      181 agcctgcagg ctgaagatgt ggcagtttat tactgtcagc aatattatag tactcctccc
      241 acttttggcc aggggaccaa gcaggagatt aaacga
//