LOCUS       Z25428                   333 bp    mRNA    linear   HUM 22-JUL-1994
DEFINITION  H.sapiens protein-serine/threonine kinase gene, complete CDS.
ACCESSION   Z25428
VERSION     Z25428.1
KEYWORDS    protein-serine/threonine kinase.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   2  (bases 1 to 333)
  AUTHORS   Schultz S.J.
  JOURNAL   Submitted (03-AUG-1993) to the INSDC. SCHULTZ S. J., University of
            Washington, Microbiology, SEATTLE, Washington, USA, 98195
REFERENCE   3  (bases 1 to 333)
  AUTHORS   Schultz S.J., Nigg E.A.
  TITLE     Identification of 21 novel human protein kinases, including 3
            members of a family related to the cell cycle regulator nimA of
            Aspergillus nidulans
  JOURNAL   Cell Growth Differ. 4(10), 821-830(1993).
   PUBMED   8274451
FEATURES             Location/Qualifiers
     source          1..333
                     /db_xref="H-InvDB:HIT000326709"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /cell_line="HL-60"
                     /db_xref="taxon:9606"
     CDS             <1..>333
                     /codon_start=1
                     /product="protein-serine/threonine kinase"
                     /note="cloned using degenerate PCR primers representing
                     conserved protein kinase subdomains V and IX; encodes an
                     open reading frame between subdomains V and IX of protein
                     kinase catalytic domain"
                     /db_xref="GOA:O43283"
                     /db_xref="H-InvDB:HIT000326709.14"
                     /db_xref="HGNC:HGNC:6852"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR001245"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017419"
                     /db_xref="InterPro:IPR027258"
                     /db_xref="UniProtKB/Swiss-Prot:O43283"
                     /citation=[3]
                     /protein_id="CAA80915.1"
                     /translation="YLYMEYCAHGQLYEVLRAGRKITPRLLVDWSTGIASGMNYLHLH
                     KIIHRDLKSPNVLVTHTDAVKISDFGTSKELSDKSTKMSFAGTVAWMAPEVIRNEPVS
                     EKVDIWSMV"
BASE COUNT          100 a           67 c           76 g           90 t
ORIGIN      
        1 tacctataca tggagtattg tgcccatgga caactctacg aggtcttacg agctggcagg
       61 aagatcacac ctcgattgct agtagactgg tccacaggaa ttgcaagtgg aatgaattat
      121 ttgcacctcc ataaaattat tcatcgtgat ctcaaatcac ctaatgtttt agtgacccac
      181 acagatgcgg taaaaatttc agattttggt acatctaagg aactcagtga caaaagtacc
      241 aagatgtcat ttgctggcac ggtcgcatgg atggcgccag aggtgatacg gaatgaacct
      301 gtctctgaaa aagttgatat ctggtctatg gta
//