LOCUS Z25428 333 bp mRNA linear HUM 22-JUL-1994 DEFINITION H.sapiens protein-serine/threonine kinase gene, complete CDS. ACCESSION Z25428 VERSION Z25428.1 KEYWORDS protein-serine/threonine kinase. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 2 (bases 1 to 333) AUTHORS Schultz S.J. JOURNAL Submitted (03-AUG-1993) to the INSDC. SCHULTZ S. J., University of Washington, Microbiology, SEATTLE, Washington, USA, 98195 REFERENCE 3 (bases 1 to 333) AUTHORS Schultz S.J., Nigg E.A. TITLE Identification of 21 novel human protein kinases, including 3 members of a family related to the cell cycle regulator nimA of Aspergillus nidulans JOURNAL Cell Growth Differ. 4(10), 821-830(1993). PUBMED 8274451 FEATURES Location/Qualifiers source 1..333 /db_xref="H-InvDB:HIT000326709" /organism="Homo sapiens" /mol_type="mRNA" /cell_line="HL-60" /db_xref="taxon:9606" CDS <1..>333 /codon_start=1 /product="protein-serine/threonine kinase" /note="cloned using degenerate PCR primers representing conserved protein kinase subdomains V and IX; encodes an open reading frame between subdomains V and IX of protein kinase catalytic domain" /db_xref="GOA:O43283" /db_xref="H-InvDB:HIT000326709.14" /db_xref="HGNC:HGNC:6852" /db_xref="InterPro:IPR000719" /db_xref="InterPro:IPR001245" /db_xref="InterPro:IPR008271" /db_xref="InterPro:IPR011009" /db_xref="InterPro:IPR017419" /db_xref="InterPro:IPR027258" /db_xref="UniProtKB/Swiss-Prot:O43283" /citation=[3] /protein_id="CAA80915.1" /translation="YLYMEYCAHGQLYEVLRAGRKITPRLLVDWSTGIASGMNYLHLH KIIHRDLKSPNVLVTHTDAVKISDFGTSKELSDKSTKMSFAGTVAWMAPEVIRNEPVS EKVDIWSMV" BASE COUNT 100 a 67 c 76 g 90 t ORIGIN 1 tacctataca tggagtattg tgcccatgga caactctacg aggtcttacg agctggcagg 61 aagatcacac ctcgattgct agtagactgg tccacaggaa ttgcaagtgg aatgaattat 121 ttgcacctcc ataaaattat tcatcgtgat ctcaaatcac ctaatgtttt agtgacccac 181 acagatgcgg taaaaatttc agattttggt acatctaagg aactcagtga caaaagtacc 241 aagatgtcat ttgctggcac ggtcgcatgg atggcgccag aggtgatacg gaatgaacct 301 gtctctgaaa aagttgatat ctggtctatg gta //