LOCUS       Z25421                   381 bp    mRNA    linear   HUM 22-JUL-1994
DEFINITION  H.sapiens protein-serine/threonine kinase gene, complete CDS.
ACCESSION   Z25421
VERSION     Z25421.1
KEYWORDS    protein-serine/threonine kinase.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   2  (bases 1 to 381)
  AUTHORS   Schultz S.J.
  JOURNAL   Submitted (03-AUG-1993) to the INSDC. SCHULTZ S. J., University of
            Washington, Microbiology, SEATTLE, Washington, USA, 98195
REFERENCE   3  (bases 1 to 381)
  AUTHORS   Schultz S.J., Nigg E.A.
  TITLE     Identification of 21 novel human protein kinases, including 3
            members of a family related to the cell cycle regulator nimA of
            Aspergillus nidulans
  JOURNAL   Cell Growth Differ. 4(10), 821-830(1993).
   PUBMED   8274451
FEATURES             Location/Qualifiers
     source          1..381
                     /db_xref="H-InvDB:HIT000326702"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /cell_line="HL-60"
                     /db_xref="taxon:9606"
     CDS             <1..>381
                     /codon_start=1
                     /product="protein-serine/threonine kinase"
                     /note="cloned using degenerate PCR primers representing
                     conserved protein kinase subdomains V and IX; encodes an
                     open reading frame between subdomains V and IX of protein
                     kinase catalytic domain"
                     /db_xref="GOA:Q15444"
                     /db_xref="H-InvDB:HIT000326702.14"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q15444"
                     /citation=[3]
                     /protein_id="CAA80908.1"
                     /translation="YLYMEYCEGNDLDFYLKQHKLMSEKEARSIVMQIVNALRYLNEI
                     KPPIIHYDLKPGNILLVDGTACGEIKITDFGLSKIMDDDSYGVDGIDLTSQGAGTYWY
                     LPPECFVVGKEPPKISNKVDMWFHW"
BASE COUNT          121 a           65 c           85 g          110 t
ORIGIN      
        1 tacctataca tggaatactg tgaaggcaat gacttggatt tctatctgaa gcaacacaag
       61 ttaatgtcag agaaagaagc tcggtctatt gtaatgcaga ttgtaaatgc actaagatat
      121 ctcaatgaga tcaaaccccc tattatacat tatgatctta agccaggaaa catcctactg
      181 gtagatggaa cagcatgtgg tgaaatcaaa atcactgatt ttggtctgtc caagattatg
      241 gatgatgata gctatggtgt agatggaata gatctaactt cccagggggc aggcacttac
      301 tggtatttac ctcctgagtg ttttgtagtt ggaaaagagc caccaaagat ttccaacaag
      361 gttgatatgt ggttccattg g
//