LOCUS Z25421 381 bp mRNA linear HUM 22-JUL-1994 DEFINITION H.sapiens protein-serine/threonine kinase gene, complete CDS. ACCESSION Z25421 VERSION Z25421.1 KEYWORDS protein-serine/threonine kinase. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 2 (bases 1 to 381) AUTHORS Schultz S.J. JOURNAL Submitted (03-AUG-1993) to the INSDC. SCHULTZ S. J., University of Washington, Microbiology, SEATTLE, Washington, USA, 98195 REFERENCE 3 (bases 1 to 381) AUTHORS Schultz S.J., Nigg E.A. TITLE Identification of 21 novel human protein kinases, including 3 members of a family related to the cell cycle regulator nimA of Aspergillus nidulans JOURNAL Cell Growth Differ. 4(10), 821-830(1993). PUBMED 8274451 FEATURES Location/Qualifiers source 1..381 /db_xref="H-InvDB:HIT000326702" /organism="Homo sapiens" /mol_type="mRNA" /cell_line="HL-60" /db_xref="taxon:9606" CDS <1..>381 /codon_start=1 /product="protein-serine/threonine kinase" /note="cloned using degenerate PCR primers representing conserved protein kinase subdomains V and IX; encodes an open reading frame between subdomains V and IX of protein kinase catalytic domain" /db_xref="GOA:Q15444" /db_xref="H-InvDB:HIT000326702.14" /db_xref="InterPro:IPR000719" /db_xref="InterPro:IPR008271" /db_xref="InterPro:IPR011009" /db_xref="UniProtKB/TrEMBL:Q15444" /citation=[3] /protein_id="CAA80908.1" /translation="YLYMEYCEGNDLDFYLKQHKLMSEKEARSIVMQIVNALRYLNEI KPPIIHYDLKPGNILLVDGTACGEIKITDFGLSKIMDDDSYGVDGIDLTSQGAGTYWY LPPECFVVGKEPPKISNKVDMWFHW" BASE COUNT 121 a 65 c 85 g 110 t ORIGIN 1 tacctataca tggaatactg tgaaggcaat gacttggatt tctatctgaa gcaacacaag 61 ttaatgtcag agaaagaagc tcggtctatt gtaatgcaga ttgtaaatgc actaagatat 121 ctcaatgaga tcaaaccccc tattatacat tatgatctta agccaggaaa catcctactg 181 gtagatggaa cagcatgtgg tgaaatcaaa atcactgatt ttggtctgtc caagattatg 241 gatgatgata gctatggtgt agatggaata gatctaactt cccagggggc aggcacttac 301 tggtatttac ctcctgagtg ttttgtagtt ggaaaagagc caccaaagat ttccaacaag 361 gttgatatgt ggttccattg g //