LOCUS Y18213 357 bp mRNA linear HUM 14-NOV-2006 DEFINITION Homo sapiens mRNA for Go protein, partial. ACCESSION Y18213 VERSION Y18213.1 KEYWORDS Go protein; heterotrimeric guanine nucleotide-binding protein. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 AUTHORS Duc-Goiran P., Bourgeois C., Mignot T.M., Robert B., Tanguy G., Ferre F. TITLE Identification and expression of Go1 and Go2 alpha-subunit transcripts in human myometrium in relation to pregnancy JOURNAL Biol. Reprod. 60(6), 1528-1535(1999). PUBMED 10330115 REFERENCE 2 (bases 1 to 357) AUTHORS Duc-Goiran P. JOURNAL Submitted (12-OCT-1998) to the INSDC. P. Duc-Goiran, INSERM, U.361 INSERM pavillon Baudelocque, 123, boulevard de Port-Royal, 75014-Paris, FRANCE REFERENCE 3 AUTHORS Tsukamoto T., Toyama R., Itoh H., Kozasa T., Matsuoka M., Kaziro Y. TITLE Structure of the human gene and two rat cDNAs encoding the alpha chain of GTP-binding regulatory protein Go: two different mRNAs are generated by alternative splicing JOURNAL Proc. Natl. Acad. Sci. U.S.A. 88(8), 2974-2978(1991). PUBMED 1901650 COMMENT Related sequences M60161, M60162 FEATURES Location/Qualifiers source 1..357 /db_xref="H-InvDB:HIT000326074" /organism="Homo sapiens" /mol_type="mRNA" /tissue_type="myometrium" /db_xref="taxon:9606" CDS <1..331 /codon_start=2 /product="Go protein" /db_xref="GOA:P09471" /db_xref="H-InvDB:HIT000326074.11" /db_xref="HGNC:HGNC:4389" /db_xref="InterPro:IPR001019" /db_xref="InterPro:IPR001408" /db_xref="InterPro:IPR011025" /db_xref="InterPro:IPR027417" /db_xref="PDB:6FUF" /db_xref="PDB:6G79" /db_xref="PDB:6OIK" /db_xref="UniProtKB/Swiss-Prot:P09471" /protein_id="CAB46639.1" /translation="ESLKLFDSICNNKWFTDTSIILFLNKKDIFEEKIKKSPLTICFP EYTGPSAFTEAVAYIQAQYESKNKSAHKEIYTHVTCATDTNNIQFVFDAVTDVIIAKN LRGCGLY" exon <1..143 /number=7 /note="7B" exon 144..357 /number=8 /note="8B" misc_difference 217 /replace="a" /note="conflict" /citation=[3] misc_difference 228 /replace="g" /note="conflict" /citation=[3] 3'UTR 332..357 BASE COUNT 98 a 114 c 74 g 71 t ORIGIN 1 cgaatccctg aagctttttg acagcatctg caacaacaaa tggttcacag acacgtccat 61 catcctgttt cttaacaaga aggacatatt tgaagagaag atcaagaagt ccccgctcac 121 catctgcttt cctgaatata caggccccag cgccttcaca gaagccgtgg cttacatcca 181 ggcccagtac gagagcaaga acaagtcagc ccacaaggag atctacaccc acgtcacctg 241 cgccacggac accaacaaca tccagtttgt ctttgatgct gtgacggacg tcatcatcgc 301 caaaaacctg cggggctgtg gactctactg agcccagccg ccctgcccgg caccctt //