LOCUS       Y18213                   357 bp    mRNA    linear   HUM 14-NOV-2006
DEFINITION  Homo sapiens mRNA for Go protein, partial.
ACCESSION   Y18213
VERSION     Y18213.1
KEYWORDS    Go protein; heterotrimeric guanine nucleotide-binding protein.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1
  AUTHORS   Duc-Goiran P., Bourgeois C., Mignot T.M., Robert B., Tanguy G.,
            Ferre F.
  TITLE     Identification and expression of Go1 and Go2 alpha-subunit
            transcripts in human myometrium in relation to pregnancy
  JOURNAL   Biol. Reprod. 60(6), 1528-1535(1999).
   PUBMED   10330115
REFERENCE   2  (bases 1 to 357)
  AUTHORS   Duc-Goiran P.
  JOURNAL   Submitted (12-OCT-1998) to the INSDC. P. Duc-Goiran, INSERM, U.361
            INSERM pavillon Baudelocque, 123, boulevard de Port-Royal,
            75014-Paris, FRANCE
REFERENCE   3
  AUTHORS   Tsukamoto T., Toyama R., Itoh H., Kozasa T., Matsuoka M., Kaziro Y.
  TITLE     Structure of the human gene and two rat cDNAs encoding the alpha
            chain of GTP-binding regulatory protein Go: two different mRNAs are
            generated by alternative splicing
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 88(8), 2974-2978(1991).
   PUBMED   1901650
COMMENT     Related sequences M60161, M60162
FEATURES             Location/Qualifiers
     source          1..357
                     /db_xref="H-InvDB:HIT000326074"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /tissue_type="myometrium"
                     /db_xref="taxon:9606"
     CDS             <1..331
                     /codon_start=2
                     /product="Go protein"
                     /db_xref="GOA:P09471"
                     /db_xref="H-InvDB:HIT000326074.11"
                     /db_xref="HGNC:HGNC:4389"
                     /db_xref="InterPro:IPR001019"
                     /db_xref="InterPro:IPR001408"
                     /db_xref="InterPro:IPR011025"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PDB:6FUF"
                     /db_xref="PDB:6G79"
                     /db_xref="PDB:6OIK"
                     /db_xref="UniProtKB/Swiss-Prot:P09471"
                     /protein_id="CAB46639.1"
                     /translation="ESLKLFDSICNNKWFTDTSIILFLNKKDIFEEKIKKSPLTICFP
                     EYTGPSAFTEAVAYIQAQYESKNKSAHKEIYTHVTCATDTNNIQFVFDAVTDVIIAKN
                     LRGCGLY"
     exon            <1..143
                     /number=7
                     /note="7B"
     exon            144..357
                     /number=8
                     /note="8B"
     misc_difference 217
                     /replace="a"
                     /note="conflict"
                     /citation=[3]
     misc_difference 228
                     /replace="g"
                     /note="conflict"
                     /citation=[3]
     3'UTR           332..357
BASE COUNT           98 a          114 c           74 g           71 t
ORIGIN      
        1 cgaatccctg aagctttttg acagcatctg caacaacaaa tggttcacag acacgtccat
       61 catcctgttt cttaacaaga aggacatatt tgaagagaag atcaagaagt ccccgctcac
      121 catctgcttt cctgaatata caggccccag cgccttcaca gaagccgtgg cttacatcca
      181 ggcccagtac gagagcaaga acaagtcagc ccacaaggag atctacaccc acgtcacctg
      241 cgccacggac accaacaaca tccagtttgt ctttgatgct gtgacggacg tcatcatcgc
      301 caaaaacctg cggggctgtg gactctactg agcccagccg ccctgcccgg caccctt
//