LOCUS       X91399                   546 bp    mRNA    linear   HUM 17-JUN-2008
DEFINITION  H.sapiens mRNA for HLA-A11 antigen.
ACCESSION   X91399
VERSION     X91399.1
KEYWORDS    HLA-A11 antigen.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1
  AUTHORS   Tijssen H.J., Sistermans E.A., van den Beucken M.J.G., Krausa P.,
            Joosten I.
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 546)
  AUTHORS   Tijssen H.
  JOURNAL   Submitted (12-SEP-1995) to the INSDC. H. Tijssen, Radboud
            University Hospital, Bloodtransf.s. Transplantat.Serology, P.O.Box
            9101, 6500 HB Nijmegen, NETHERLANDS
FEATURES             Location/Qualifiers
     source          1..546
                     /db_xref="H-InvDB:HIT000324459_05"
                     /organism="Homo sapiens"
                     /chromosome="6"
                     /map="p21.3"
                     /mol_type="mRNA"
                     /cell_line="MAD61"
                     /cell_type="PBL"
                     /tissue_type="blood"
                     /germline
                     /note="allele HLA-A11"
                     /db_xref="taxon:9606"
     CDS             join(<1..270,271..>546)
                     /codon_start=3
                     /gene="HLA-A"
                     /product="MHC alpha chain"
                     /db_xref="GOA:P13746"
                     /db_xref="HGNC:HGNC:4931"
                     /db_xref="InterPro:IPR001039"
                     /db_xref="InterPro:IPR003006"
                     /db_xref="InterPro:IPR003597"
                     /db_xref="InterPro:IPR007110"
                     /db_xref="InterPro:IPR010579"
                     /db_xref="InterPro:IPR011161"
                     /db_xref="InterPro:IPR011162"
                     /db_xref="InterPro:IPR013783"
                     /db_xref="InterPro:IPR036179"
                     /db_xref="InterPro:IPR037055"
                     /db_xref="PDB:1Q94"
                     /db_xref="PDB:1QVO"
                     /db_xref="PDB:1X7Q"
                     /db_xref="PDB:2HN7"
                     /db_xref="PDB:4MJ5"
                     /db_xref="PDB:4MJ6"
                     /db_xref="PDB:4N8V"
                     /db_xref="PDB:4UQ2"
                     /db_xref="PDB:5GRD"
                     /db_xref="PDB:5GRG"
                     /db_xref="PDB:5GSD"
                     /db_xref="PDB:5WJL"
                     /db_xref="PDB:5WJN"
                     /db_xref="PDB:5WKF"
                     /db_xref="PDB:5WKH"
                     /db_xref="PDB:6ID4"
                     /db_xref="UniProtKB/Swiss-Prot:P13746"
                     /protein_id="CAA62745.1"
                     /translation="SHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRM
                     EPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEDGSHTIQIMYGCDV
                     GPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAREAEQQRAYLE
                     GRCVEWLRRYLENGKETLQRT"
     exon            1..270
                     /number=2
     exon            271..546
                     /number=3
BASE COUNT          110 a          163 c          199 g           74 t
ORIGIN      
        1 gctcccactc catgaggtat ttctacacct ccgtgtcccg gcccggccgc ggggagcccc
       61 gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg
      121 cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg
      181 accaggagac acggaatgtg aaggcccagt cacagactga ccgagtggac ctggggaccc
      241 tgcgcggcta ctacaaccag agcgaggacg gttctcacac catccagata atgtatggct
      301 gcgacgtggg gccggacggg cgcttcctcc gcgggtaccg gcaggacgcc tacgacggca
      361 aggattacat cgccctgaac gaggacctgc gctcttggac cgcggcggac atggcagctc
      421 agatcaccaa gcgcaagtgg gaggcggccc gtgaggcgga gcagcagaga gcctacctgg
      481 agggccggtg cgtggagtgg ctccgcagat acctggagaa cgggaaggag acgctgcagc
      541 gcacgg
//