LOCUS X86106 168 bp mRNA linear HUM 15-FEB-1996 DEFINITION H.sapiens mRNA for T cell receptor, V beta 13.3, J beta 2.2 , C beta 2. ACCESSION X86106 VERSION X86106.1 KEYWORDS HLA-B27; reactive arthritis; T-cell receptor; T-cell receptor beta chain. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 AUTHORS Duchmann R., May E., Ackermann B., Goergen B., Meyer zum Bueschenfelde K.H., Hermann E. TITLE HLA-B27-restricted cytotoxic T lymphocyte responses to arthritogenic enterobacteria or self-antigens are dominated by closely related TCRBV gene segments. A study in patients with reactive arthritis JOURNAL Scand. J. Immunol. 43(1), 101-108(1996). PUBMED 8560188 REFERENCE 2 (bases 1 to 168) AUTHORS May E. JOURNAL Submitted (28-FEB-1995) to the INSDC. E. May, Univ. of Mainz, 1.Med. Klinik, J.Gutenberg Univ. Mainz, Klinische Immunologie II, Langenbeckstr. 1, D- 55101 Mainz, FRG FEATURES Location/Qualifiers source 1..168 /db_xref="H-InvDB:HIT000324194" /organism="Homo sapiens" /isolate="patient with Yersinia enterocolitica 03-induced acute Reiter's syndrome" /mol_type="mRNA" /haplotype="HLA-B27" /clone="P1.5.104" /cell_type="synovial T-lymphocyte" /db_xref="taxon:9606" CDS <1..>168 /codon_start=1 /gene="TCRB" /product="T-cell receptor beta chain" /db_xref="H-InvDB:HIT000324194.7" /protein_id="CAA60059.1" /translation="SRLNKREFSLRLESAAPSQTSVYFCASSRQGDTGELFFGEGSRL TVLEDLKNVFPP" mRNA 1..168 /experiment="experimental evidence, no additional details recorded" BASE COUNT 36 a 47 c 48 g 37 t ORIGIN 1 tccagattaa acaaacggga gttctcgctc aggctggagt cggctgctcc ctcccagaca 61 tctgtgtact tctgtgccag cagtcgacag ggcgacaccg gggagctgtt ttttggagaa 121 ggctctaggc tgaccgtact ggaggacctg aaaaacgtgt tcccaccc //