LOCUS X79200 709 bp mRNA linear HUM 22-DEC-1999 DEFINITION Homo spaiens mRNA for SYT-SSX protein. ACCESSION X79200 VERSION X79200.1 KEYWORDS synovial sarcoma; synovial sarcoma translocation junction. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 AUTHORS Clark J., Rocques P.J., Crew A.J., Gill S., Shipley J., Chan A.M., Gusterson B.A., Cooper C.S. TITLE Identification of novel genes, SYT and SSX, involved in the t(X;18)(p11.2;q11.2) translocation found in human synovial sarcoma JOURNAL Nat Genet 7(4), 502-508(1994). PUBMED 7951320 REFERENCE 2 (bases 1 to 709) AUTHORS Cooper C.S. JOURNAL Submitted (09-MAY-1994) to the INSDC. C.S. Cooper, Institute of Cancer Research, 15 Cotswold Road, Belmount Sutton, Surrey SM2 5NG, UK FEATURES Location/Qualifiers source 1..709 /db_xref="H-InvDB:HIT000323729_04" /organism="Homo sapiens" /chromosome="t(X;18)" /mol_type="mRNA" /clone_lib="A2243" /db_xref="taxon:9606" source 1..60 /organism="Homo sapiens" /chromosome="18" /mol_type="mRNA" /db_xref="taxon:9606" source 61..297 /organism="Homo sapiens" /chromosome="X" /mol_type="mRNA" /db_xref="taxon:9606" misc_feature 1..709 /note="synovial sarcoma translocation junction" CDS <1..297 /product="SYT-SSX protein" /db_xref="GOA:Q9Y444" /db_xref="H-InvDB:HIT000323729_03.4" /db_xref="InterPro:IPR019041" /db_xref="InterPro:IPR028804" /db_xref="UniProtKB/TrEMBL:Q9Y444" /protein_id="CAB36970.1" /translation="RPTQPGPPQPPQQRPYGYDQIMPKKPAEEGNDSEEVPEASGPQN DGKELCPPGKPTTSEKIHERSGPKRGEHAWTHRLRERKQLVIYEEISDPEEDDE" BASE COUNT 207 a 167 c 168 g 167 t ORIGIN 1 agaccaacac agcctggacc accacagcca ccccagcaga ggccttatgg atatgaccag 61 atcatgccca agaagccagc agaggaagga aatgattcgg aggaagtgcc agaagcatct 121 ggcccacaaa atgatgggaa agagctgtgc cccccgggaa aaccaactac ctctgagaag 181 attcacgaga gatctggacc caaaaggggg gaacatgcct ggacccacag actgcgtgag 241 agaaaacagc tggtgattta tgaagagatc agcgaccctg aggaagatga cgagtaactc 301 cctcaggata cgacacatgc ccatgatgag aagcagaacg tggtgacctt tcacgaacat 361 gggcatggct gcggacccct cgtcatcagg tgcatagcaa gtgaaagcaa gtgttcacaa 421 cagtgaaaag ttgagcgtca tttttcttag tgtgccaaga gttcgatgtt agcgtttacg 481 ttgtattttc ttacactgtg tcattctgtt agatactaac attttcattg atgagcaaga 541 catacttaat gcatattttg gtttgtgtat ccatgcacct accttagaaa acaagtattg 601 tcggttacct ctgcatggaa cagcattacc ctcctctctc cccagatgtg actactgagg 661 gcagttctga gtgtttaatt tcagattttt cctctgcatt tacacacac //