LOCUS       X79200                   709 bp    mRNA    linear   HUM 22-DEC-1999
DEFINITION  Homo spaiens mRNA for SYT-SSX protein.
ACCESSION   X79200
VERSION     X79200.1
KEYWORDS    synovial sarcoma; synovial sarcoma translocation junction.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1
  AUTHORS   Clark J., Rocques P.J., Crew A.J., Gill S., Shipley J., Chan A.M.,
            Gusterson B.A., Cooper C.S.
  TITLE     Identification of novel genes, SYT and SSX, involved in the
            t(X;18)(p11.2;q11.2) translocation found in human synovial sarcoma
  JOURNAL   Nat Genet 7(4), 502-508(1994).
   PUBMED   7951320
REFERENCE   2  (bases 1 to 709)
  AUTHORS   Cooper C.S.
  JOURNAL   Submitted (09-MAY-1994) to the INSDC. C.S. Cooper, Institute of
            Cancer Research, 15 Cotswold Road, Belmount Sutton, Surrey SM2 5NG,
            UK
FEATURES             Location/Qualifiers
     source          1..709
                     /db_xref="H-InvDB:HIT000323729_04"
                     /organism="Homo sapiens"
                     /chromosome="t(X;18)"
                     /mol_type="mRNA"
                     /clone_lib="A2243"
                     /db_xref="taxon:9606"
     source          1..60
                     /organism="Homo sapiens"
                     /chromosome="18"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     source          61..297
                     /organism="Homo sapiens"
                     /chromosome="X"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     misc_feature    1..709
                     /note="synovial sarcoma translocation junction"
     CDS             <1..297
                     /product="SYT-SSX protein"
                     /db_xref="GOA:Q9Y444"
                     /db_xref="H-InvDB:HIT000323729_03.4"
                     /db_xref="InterPro:IPR019041"
                     /db_xref="InterPro:IPR028804"
                     /db_xref="UniProtKB/TrEMBL:Q9Y444"
                     /protein_id="CAB36970.1"
                     /translation="RPTQPGPPQPPQQRPYGYDQIMPKKPAEEGNDSEEVPEASGPQN
                     DGKELCPPGKPTTSEKIHERSGPKRGEHAWTHRLRERKQLVIYEEISDPEEDDE"
BASE COUNT          207 a          167 c          168 g          167 t
ORIGIN      
        1 agaccaacac agcctggacc accacagcca ccccagcaga ggccttatgg atatgaccag
       61 atcatgccca agaagccagc agaggaagga aatgattcgg aggaagtgcc agaagcatct
      121 ggcccacaaa atgatgggaa agagctgtgc cccccgggaa aaccaactac ctctgagaag
      181 attcacgaga gatctggacc caaaaggggg gaacatgcct ggacccacag actgcgtgag
      241 agaaaacagc tggtgattta tgaagagatc agcgaccctg aggaagatga cgagtaactc
      301 cctcaggata cgacacatgc ccatgatgag aagcagaacg tggtgacctt tcacgaacat
      361 gggcatggct gcggacccct cgtcatcagg tgcatagcaa gtgaaagcaa gtgttcacaa
      421 cagtgaaaag ttgagcgtca tttttcttag tgtgccaaga gttcgatgtt agcgtttacg
      481 ttgtattttc ttacactgtg tcattctgtt agatactaac attttcattg atgagcaaga
      541 catacttaat gcatattttg gtttgtgtat ccatgcacct accttagaaa acaagtattg
      601 tcggttacct ctgcatggaa cagcattacc ctcctctctc cccagatgtg actactgagg
      661 gcagttctga gtgtttaatt tcagattttt cctctgcatt tacacacac
//