LOCUS       X65666                   162 bp    mRNA    linear   HUM 18-APR-2005
DEFINITION  H.sapiens Sox-10 mRNA.
ACCESSION   X65666
VERSION     X65666.1
KEYWORDS    DNA binding; sox-10 gene; Sry-related sequence.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 162)
  AUTHORS   Denny P.
  JOURNAL   Submitted (23-APR-1992) to the INSDC. P. Denny, Institute of Cancer
            Research, Chester Beatty Laboratories, Fulham Road, London SW3 6JB,
            UK
REFERENCE   2  (bases 1 to 162)
  AUTHORS   Denny P., Swift S., Brand N., Dabhade N., Barton P., Ashworth A.
  TITLE     A conserved family of genes related to the testis determining gene,
            SRY
  JOURNAL   Nucleic Acids Res. 20(11), 2887-2887(1992).
   PUBMED   1614875
FEATURES             Location/Qualifiers
     source          1..162
                     /db_xref="H-InvDB:HIT000322756"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /dev_stage="adult and fetal"
                     /tissue_type="heart muscle"
                     /db_xref="taxon:9606"
     CDS             <1..>162
                     /codon_start=1
                     /gene="sox-10"
                     /product="SOX-10"
                     /db_xref="GOA:Q9Y651"
                     /db_xref="H-InvDB:HIT000322756.12"
                     /db_xref="HGNC:HGNC:11197"
                     /db_xref="InterPro:IPR009071"
                     /db_xref="InterPro:IPR022097"
                     /db_xref="InterPro:IPR036910"
                     /db_xref="UniProtKB/Swiss-Prot:Q9Y651"
                     /protein_id="CAA46617.1"
                     /translation="SRAQRRKMAQENPKMHNSEISKRLGAEWKLLTESEKRPFIDEAK
                     RLRAMHMKEH"
     misc_binding    <1..>162
                     /bound_moiety="DNA"
     regulatory      <1..>162
                     /note="HMG box"
                     /regulatory_class="other"
BASE COUNT           41 a           48 c           54 g           19 t
ORIGIN      
        1 tcgcgggctc agcggcgcaa gatggcccag gagaacccca agatgcacaa ctcggagatc
       61 agcaagcgct tgggcgccga gtggaaactg ctcacggagt cggagaagcg gccgttcatc
      121 gacgaggcca agcgtctacg cgccatgcac atgaaggagc ac
//