LOCUS X63423 691 bp mRNA linear HUM 11-NOV-2005 DEFINITION Home sapiens mRNA for delta-subunit of mitochondrial F1F0 ATP-synthase (clone #5). ACCESSION X63423 VERSION X63423.1 KEYWORDS ATP synthase delta subunit; delta subunit; F1F0-ATP synthase; H+-translocation. SOURCE mitochondrion Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 691) AUTHORS Breen G.A.M. JOURNAL Submitted (02-DEC-1991) to the INSDC. G.A.M. Breen, The Univesity of Texas at Dallas, Biology Programs, FO 3.1, P.O.Box 830688, Richardson, TX 75083-0688, USA REFERENCE 2 (bases 1 to 691) AUTHORS Jordan E.M., Breen G.A. TITLE Molecular cloning of an import precursor of the delta-subunit of the human mitochondrial ATP synthase complex JOURNAL Biochim. Biophys. Acta 1130(1), 123-126(1992). PUBMED 1531933 COMMENT See also X63422 FEATURES Location/Qualifiers source 1..691 /db_xref="H-InvDB:HIT000367397" /organism="Homo sapiens" /organelle="mitochondrion" /mol_type="mRNA" /clone_lib="cDNA in lambda YES-R" /clone="#5" /db_xref="taxon:9606" 5'UTR 1..83 sig_peptide 84..149 CDS 84..590 /transl_table=2 /product="H(+)-transporting ATP synthase" /EC_number="3.6.1.34" /note="delta-subunit of mitochondrial F1F0 ATP synthase" /db_xref="GOA:P30049" /db_xref="H-InvDB:HIT000367397.11" /db_xref="HGNC:HGNC:837" /db_xref="InterPro:IPR001469" /db_xref="InterPro:IPR020546" /db_xref="InterPro:IPR036771" /db_xref="InterPro:IPR036794" /db_xref="UniProtKB/Swiss-Prot:P30049" /protein_id="CAA45017.1" /translation="MLPAALLRRPGLGRLVRHARAYAEAAAAPAAASGPNQMSFTFAS PTQVFFNGANVRQVDVPTLTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSKYFVSSG SIAVNADSSVQLLAEEAVTLDMLDLGAAKANLEKAQAELVGTADEATRAEIQIRIEAN EALVKALE" mat_peptide 150..587 /product="H(+)-transporting ATP synthase" /EC_number="3.6.1.34" /note="delta-subunit of mitochondrial F1F0 ATP synthase" 3'UTR 591..681 regulatory 662..667 /regulatory_class="polyA_signal_sequence" polyA_site 681 BASE COUNT 114 a 258 c 214 g 105 t ORIGIN 1 gtcctcctcg ccctccaggc cgcccgcgcc gcgccggagt ccgctgtccg ccagctaccc 61 gcttcctgcc gcccgccgct gccatgctgc ccgccgcgct gctccgccgc ccgggacttg 121 gccgcctcgt ccgccacgcc cgtgcctatg ccgaggccgc cgccgccccg gctgccgcct 181 ctggccccaa ccagatgtcc ttcaccttcg cctctcccac gcaggtgttc ttcaacggtg 241 ccaacgtccg gcaggtggac gtgcccacgc tgaccggagc cttcggcatc ctggcggccc 301 acgtgcccac gctgcaggtc ctgcggccgg ggctggtcgt ggtgcatgca gaggacggca 361 ccacctccaa atactttgtg agcagcggtt ccatcgcagt gaacgccgac tcttcggtgc 421 agttgttggc cgaagaggcc gtgacgctgg acatgttgga cctgggggca gccaaggcaa 481 acttggagaa ggcccaggcg gagctggtgg ggacagctga cgaggccacg cgggcagaga 541 tccagatccg aatcgaggcc aacgaggccc tggtgaaggc cctggagtag gcgagccagc 601 cgccaaggtt gacctcagct tcggagccac ctctggatga actgccccca gcccccgccc 661 cattaaagac ccggaagcct gaaaaaaaaa a //