LOCUS       X63423                   691 bp    mRNA    linear   HUM 11-NOV-2005
DEFINITION  Home sapiens mRNA for delta-subunit of mitochondrial F1F0
            ATP-synthase (clone #5).
ACCESSION   X63423
VERSION     X63423.1
KEYWORDS    ATP synthase delta subunit; delta subunit; F1F0-ATP synthase;
            H+-translocation.
SOURCE      mitochondrion Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 691)
  AUTHORS   Breen G.A.M.
  JOURNAL   Submitted (02-DEC-1991) to the INSDC. G.A.M. Breen, The Univesity
            of Texas at Dallas, Biology Programs, FO 3.1, P.O.Box 830688,
            Richardson, TX 75083-0688, USA
REFERENCE   2  (bases 1 to 691)
  AUTHORS   Jordan E.M., Breen G.A.
  TITLE     Molecular cloning of an import precursor of the delta-subunit of
            the human mitochondrial ATP synthase complex
  JOURNAL   Biochim. Biophys. Acta 1130(1), 123-126(1992).
   PUBMED   1531933
COMMENT     See also X63422
FEATURES             Location/Qualifiers
     source          1..691
                     /db_xref="H-InvDB:HIT000367397"
                     /organism="Homo sapiens"
                     /organelle="mitochondrion"
                     /mol_type="mRNA"
                     /clone_lib="cDNA in lambda YES-R"
                     /clone="#5"
                     /db_xref="taxon:9606"
     5'UTR           1..83
     sig_peptide     84..149
     CDS             84..590
                     /transl_table=2
                     /product="H(+)-transporting ATP synthase"
                     /EC_number="3.6.1.34"
                     /note="delta-subunit of mitochondrial F1F0 ATP synthase"
                     /db_xref="GOA:P30049"
                     /db_xref="H-InvDB:HIT000367397.11"
                     /db_xref="HGNC:HGNC:837"
                     /db_xref="InterPro:IPR001469"
                     /db_xref="InterPro:IPR020546"
                     /db_xref="InterPro:IPR036771"
                     /db_xref="InterPro:IPR036794"
                     /db_xref="UniProtKB/Swiss-Prot:P30049"
                     /protein_id="CAA45017.1"
                     /translation="MLPAALLRRPGLGRLVRHARAYAEAAAAPAAASGPNQMSFTFAS
                     PTQVFFNGANVRQVDVPTLTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSKYFVSSG
                     SIAVNADSSVQLLAEEAVTLDMLDLGAAKANLEKAQAELVGTADEATRAEIQIRIEAN
                     EALVKALE"
     mat_peptide     150..587
                     /product="H(+)-transporting ATP synthase"
                     /EC_number="3.6.1.34"
                     /note="delta-subunit of mitochondrial F1F0 ATP synthase"
     3'UTR           591..681
     regulatory      662..667
                     /regulatory_class="polyA_signal_sequence"
     polyA_site      681
BASE COUNT          114 a          258 c          214 g          105 t
ORIGIN      
        1 gtcctcctcg ccctccaggc cgcccgcgcc gcgccggagt ccgctgtccg ccagctaccc
       61 gcttcctgcc gcccgccgct gccatgctgc ccgccgcgct gctccgccgc ccgggacttg
      121 gccgcctcgt ccgccacgcc cgtgcctatg ccgaggccgc cgccgccccg gctgccgcct
      181 ctggccccaa ccagatgtcc ttcaccttcg cctctcccac gcaggtgttc ttcaacggtg
      241 ccaacgtccg gcaggtggac gtgcccacgc tgaccggagc cttcggcatc ctggcggccc
      301 acgtgcccac gctgcaggtc ctgcggccgg ggctggtcgt ggtgcatgca gaggacggca
      361 ccacctccaa atactttgtg agcagcggtt ccatcgcagt gaacgccgac tcttcggtgc
      421 agttgttggc cgaagaggcc gtgacgctgg acatgttgga cctgggggca gccaaggcaa
      481 acttggagaa ggcccaggcg gagctggtgg ggacagctga cgaggccacg cgggcagaga
      541 tccagatccg aatcgaggcc aacgaggccc tggtgaaggc cctggagtag gcgagccagc
      601 cgccaaggtt gacctcagct tcggagccac ctctggatga actgccccca gcccccgccc
      661 cattaaagac ccggaagcct gaaaaaaaaa a
//