LOCUS X58235 149 bp mRNA linear HUM 07-OCT-2008 DEFINITION Human mRNA for anti-lectin antibody epitope (clone p36/8-9). ACCESSION X58235 VERSION X58235.1 KEYWORDS anti-lectin antibody epitope; antigen; lectin. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 149) AUTHORS Aldridge F.L. JOURNAL Submitted (11-MAR-1991) to the INSDC. F.L. Aldridge, ICI Pharmaceuticals, Alderley Park, Macclesfield, Cheshire, SK10 4TG, uk REFERENCE 3 (bases 1 to 149) AUTHORS Abbott W.M., Mellor A., Edwards Y., Feizi T. TITLE Soluble bovine galactose-binding lectin JOURNAL Biochem. J. 259(1), 283-290(1989). PUBMED 2470348 FEATURES Location/Qualifiers source 1..149 /db_xref="H-InvDB:HIT000322204" /organism="Homo sapiens" /mol_type="mRNA" /clone_lib="lambda gt11" /clone="p36/8-9" /tissue_type="intestine" /db_xref="taxon:9606" CDS <1..>149 /codon_start=1 /product="36/8-9 fusion protein with epitope for anti-lectin antibody" /db_xref="H-InvDB:HIT000322204.12" /db_xref="UniProtKB/TrEMBL:V9H1C8" /protein_id="CAA41193.1" /translation="RPWGAEPSAPRPSPRHGQYGAAGAAPSVSVTVSHGIAGILLGEM AVCAK" mRNA <1..>149 /note="36/8-9 fusion protein" /experiment="experimental evidence, no additional details recorded" BASE COUNT 22 a 47 c 60 g 20 t ORIGIN 1 cgcccgtggg gagccgagcc gagcgccccc cgccccagcc cccggcatgg gcagtacggg 61 gccgccgggg cggcgccgag cgtgagcgtg acggtctccc atgggattgc tgggatcttg 121 ctgggtgaga tggcagtgtg tgcaaaaaa //