LOCUS       X58235                   149 bp    mRNA    linear   HUM 07-OCT-2008
DEFINITION  Human mRNA for anti-lectin antibody epitope (clone p36/8-9).
ACCESSION   X58235
VERSION     X58235.1
KEYWORDS    anti-lectin antibody epitope; antigen; lectin.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 149)
  AUTHORS   Aldridge F.L.
  JOURNAL   Submitted (11-MAR-1991) to the INSDC. F.L. Aldridge, ICI
            Pharmaceuticals, Alderley Park, Macclesfield, Cheshire, SK10  4TG,
            uk
REFERENCE   3  (bases 1 to 149)
  AUTHORS   Abbott W.M., Mellor A., Edwards Y., Feizi T.
  TITLE     Soluble bovine galactose-binding lectin
  JOURNAL   Biochem. J. 259(1), 283-290(1989).
   PUBMED   2470348
FEATURES             Location/Qualifiers
     source          1..149
                     /db_xref="H-InvDB:HIT000322204"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /clone_lib="lambda gt11"
                     /clone="p36/8-9"
                     /tissue_type="intestine"
                     /db_xref="taxon:9606"
     CDS             <1..>149
                     /codon_start=1
                     /product="36/8-9 fusion protein with epitope for
                     anti-lectin antibody"
                     /db_xref="H-InvDB:HIT000322204.12"
                     /db_xref="UniProtKB/TrEMBL:V9H1C8"
                     /protein_id="CAA41193.1"
                     /translation="RPWGAEPSAPRPSPRHGQYGAAGAAPSVSVTVSHGIAGILLGEM
                     AVCAK"
     mRNA            <1..>149
                     /note="36/8-9 fusion protein"
                     /experiment="experimental evidence, no additional details
                     recorded"
BASE COUNT           22 a           47 c           60 g           20 t
ORIGIN      
        1 cgcccgtggg gagccgagcc gagcgccccc cgccccagcc cccggcatgg gcagtacggg
       61 gccgccgggg cggcgccgag cgtgagcgtg acggtctccc atgggattgc tgggatcttg
      121 ctgggtgaga tggcagtgtg tgcaaaaaa
//