LOCUS       X54413                   130 bp    mRNA    linear   HUM 23-MAR-1995
DEFINITION  Human mRNA for alpha1(IX) collagen (short form), part.
ACCESSION   X54413
VERSION     X54413.1
KEYWORDS    collagen; collagen type IX.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 130)
  AUTHORS   Olsen B.R.
  JOURNAL   Submitted (28-JUN-1990) to the INSDC. Olsen B.R., Dept. of Anatomy
            & Cellular Biology, Harvard Medical School, 220 Long Wood Ave.,
            Boston, MA 02115, USA.
REFERENCE   2  (bases 1 to 130)
  AUTHORS   Muragaki Y., Kimura T., Ninomiya Y., Olsen B.R.
  TITLE     The complete primary structure of two distinct forms of human alpha
            1 (IX) collagen chains
  JOURNAL   Eur. J. Biochem. 192(3), 703-708(1990).
   PUBMED   2209617
FEATURES             Location/Qualifiers
     source          1..130
                     /db_xref="H-InvDB:HIT000321893"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     CDS             1..>130
                     /note="alpha1(IX) collagen precursor"
                     /db_xref="GOA:P20849"
                     /db_xref="H-InvDB:HIT000321893.12"
                     /db_xref="HGNC:HGNC:2217"
                     /db_xref="InterPro:IPR001791"
                     /db_xref="InterPro:IPR008160"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="PDB:2UUR"
                     /db_xref="PDB:5CTD"
                     /db_xref="PDB:5CTI"
                     /db_xref="PDB:5CVA"
                     /db_xref="PDB:5CVB"
                     /db_xref="UniProtKB/Swiss-Prot:P20849"
                     /protein_id="CAA38277.1"
                     /translation="MAWTARDRGALGLLLLGLCLCAAQRGPPGEQGPPGASGPPGVP"
     sig_peptide     1..69
                     /note="signal peptide"
     mat_peptide     70..>130
                     /note="mature alpha1(IX) collagen (130 is 1st base in
                     codon)"
BASE COUNT           11 a           44 c           52 g           23 t
ORIGIN      
        1 atggcctgga ctgcgcggga ccgcggggcc ctggggctgc tgctgttggg gctctgcttg
       61 tgcgcggctc aaagaggtcc cccgggtgag cagggtcctc ccggggcctc cggcccccct
      121 ggagttccag
//