LOCUS X54413 130 bp mRNA linear HUM 23-MAR-1995 DEFINITION Human mRNA for alpha1(IX) collagen (short form), part. ACCESSION X54413 VERSION X54413.1 KEYWORDS collagen; collagen type IX. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 130) AUTHORS Olsen B.R. JOURNAL Submitted (28-JUN-1990) to the INSDC. Olsen B.R., Dept. of Anatomy & Cellular Biology, Harvard Medical School, 220 Long Wood Ave., Boston, MA 02115, USA. REFERENCE 2 (bases 1 to 130) AUTHORS Muragaki Y., Kimura T., Ninomiya Y., Olsen B.R. TITLE The complete primary structure of two distinct forms of human alpha 1 (IX) collagen chains JOURNAL Eur. J. Biochem. 192(3), 703-708(1990). PUBMED 2209617 FEATURES Location/Qualifiers source 1..130 /db_xref="H-InvDB:HIT000321893" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" CDS 1..>130 /note="alpha1(IX) collagen precursor" /db_xref="GOA:P20849" /db_xref="H-InvDB:HIT000321893.12" /db_xref="HGNC:HGNC:2217" /db_xref="InterPro:IPR001791" /db_xref="InterPro:IPR008160" /db_xref="InterPro:IPR013320" /db_xref="PDB:2UUR" /db_xref="PDB:5CTD" /db_xref="PDB:5CTI" /db_xref="PDB:5CVA" /db_xref="PDB:5CVB" /db_xref="UniProtKB/Swiss-Prot:P20849" /protein_id="CAA38277.1" /translation="MAWTARDRGALGLLLLGLCLCAAQRGPPGEQGPPGASGPPGVP" sig_peptide 1..69 /note="signal peptide" mat_peptide 70..>130 /note="mature alpha1(IX) collagen (130 is 1st base in codon)" BASE COUNT 11 a 44 c 52 g 23 t ORIGIN 1 atggcctgga ctgcgcggga ccgcggggcc ctggggctgc tgctgttggg gctctgcttg 61 tgcgcggctc aaagaggtcc cccgggtgag cagggtcctc ccggggcctc cggcccccct 121 ggagttccag //