LOCUS       X52351                   168 bp    mRNA    linear   HUM 18-APR-2005
DEFINITION  Human Kox20 mRNA for zinc finger protein, partial.
ACCESSION   X52351
VERSION     X52351.1
KEYWORDS    DNA-binding protein; Kox gene; zinc finger protein.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 168)
  AUTHORS   Thiesen H.J.
  JOURNAL   Submitted (30-MAR-1990) to the INSDC. Thiesen H.-J., Basel
            Institute for Immunology, Grenzacherstr. 487, CH-4005 Basel,
            Switzerland.
REFERENCE   2  (bases 1 to 168)
  AUTHORS   Thiesen H.J.
  TITLE     Multiple genes encoding zinc finger domains are expressed in human
            T cells
  JOURNAL   New Biol. 2(4), 363-374(1990).
   PUBMED   2288909
COMMENT     See <X52332>-<X52361> for other Kox mRNAs.
FEATURES             Location/Qualifiers
     source          1..168
                     /db_xref="H-InvDB:HIT000321764_03"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /clone_lib="lambda gt10"
                     /cell_line="Jurkat"
                     /cell_type="T cell"
                     /tissue_type="lymphoid"
                     /db_xref="taxon:9606"
     CDS             <1..>168
                     /codon_start=1
                     /product="KOX 20 protein (56 AA)"
                     /db_xref="GOA:P17031"
                     /db_xref="H-InvDB:HIT000321764_02.4"
                     /db_xref="HGNC:HGNC:13053"
                     /db_xref="InterPro:IPR001909"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR036051"
                     /db_xref="InterPro:IPR036236"
                     /db_xref="UniProtKB/Swiss-Prot:P17031"
                     /protein_id="CAA36577.1"
                     /translation="YECNECEKAYPRKASLQIHQKTHSGEKPFKCSECGKAFTQKSSL
                     SEHQRVHTGEKP"
BASE COUNT           63 a           35 c           35 g           35 t
ORIGIN      
        1 tatgaatgca atgaatgtga aaaagcctac cctaggaagg catcacttca gatacaccag
       61 aaaactcatt cgggagagaa accttttaaa tgcagtgaat gtggaaaagc cttcactcag
      121 aagtcatctc tcagtgaaca tcagagagtt cacactggag agaaacca
//