LOCUS X52351 168 bp mRNA linear HUM 18-APR-2005 DEFINITION Human Kox20 mRNA for zinc finger protein, partial. ACCESSION X52351 VERSION X52351.1 KEYWORDS DNA-binding protein; Kox gene; zinc finger protein. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 168) AUTHORS Thiesen H.J. JOURNAL Submitted (30-MAR-1990) to the INSDC. Thiesen H.-J., Basel Institute for Immunology, Grenzacherstr. 487, CH-4005 Basel, Switzerland. REFERENCE 2 (bases 1 to 168) AUTHORS Thiesen H.J. TITLE Multiple genes encoding zinc finger domains are expressed in human T cells JOURNAL New Biol. 2(4), 363-374(1990). PUBMED 2288909 COMMENT See <X52332>-<X52361> for other Kox mRNAs. FEATURES Location/Qualifiers source 1..168 /db_xref="H-InvDB:HIT000321764_03" /organism="Homo sapiens" /mol_type="mRNA" /clone_lib="lambda gt10" /cell_line="Jurkat" /cell_type="T cell" /tissue_type="lymphoid" /db_xref="taxon:9606" CDS <1..>168 /codon_start=1 /product="KOX 20 protein (56 AA)" /db_xref="GOA:P17031" /db_xref="H-InvDB:HIT000321764_02.4" /db_xref="HGNC:HGNC:13053" /db_xref="InterPro:IPR001909" /db_xref="InterPro:IPR013087" /db_xref="InterPro:IPR036051" /db_xref="InterPro:IPR036236" /db_xref="UniProtKB/Swiss-Prot:P17031" /protein_id="CAA36577.1" /translation="YECNECEKAYPRKASLQIHQKTHSGEKPFKCSECGKAFTQKSSL SEHQRVHTGEKP" BASE COUNT 63 a 35 c 35 g 35 t ORIGIN 1 tatgaatgca atgaatgtga aaaagcctac cctaggaagg catcacttca gatacaccag 61 aaaactcatt cgggagagaa accttttaaa tgcagtgaat gtggaaaagc cttcactcag 121 aagtcatctc tcagtgaaca tcagagagtt cacactggag agaaacca //