LOCUS X52112 390 bp mRNA linear HUM 11-MAR-1999 DEFINITION Human mRNA for immunoglobulin light chain VJ region, lambda-V family (cell line Pag-1). ACCESSION X52112 VERSION X52112.1 KEYWORDS Ig light chain; immunoglobulin; joining region; variable region. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 390) AUTHORS Hughes-Jones N.C. JOURNAL Submitted (15-MAR-1990) to the INSDC. Hughes-Jones N.C., Institute of Animal Physiology & Genetics Research, Babraham Hall, Cambridge CB2 4AT, U K. REFERENCE 2 (bases 1 to 390) AUTHORS Hughes-Jones N.C., Bye J.M., Beale D., Coadwell J. TITLE Nucleotide sequences and three-dimensional modelling of the VH and VL domains of two human monoclonal antibodies specific for the D antigen of the human Rh-blood-group system JOURNAL Biochem. J. 268(1), 135-140(1990). PUBMED 2111699 FEATURES Location/Qualifiers source 1..390 /db_xref="H-InvDB:HIT000321724" /organism="Homo sapiens" /chromosome="22" /strain="blood donor PA" /mol_type="mRNA" /cell_line="Pag-1" /cell_type="B lymphocytes" /db_xref="taxon:9606" CDS 1..>390 /product="immunoglobulin light chain" /note="precursor polypeptide" /protein_id="CAA36351.1" /translation="MAWTVLLLGLLSHCTGSVTSYVLTQPPSVSVAPGQTARITCGGN NIGRKSVHWYQQKPGQAPVLVVYGASDRPSGIPERFSGSNSGNTATLTISRVAAGDEA DYYCQVWDSSSAHPGVVFGGGTKLTVLG" sig_peptide 1..57 misc_feature 58..>390 /note="VJ region (AA 1 to 108)" misc_feature 58..351 /note="Vl region (AA 1 to 95)" misc_feature 352..>390 /note="J region (AA 96 to 108)" BASE COUNT 73 a 117 c 120 g 80 t ORIGIN 1 atggcctgga ccgttctcct cctcggcctc ctctctcact gcacaggctc tgtgacctcc 61 tatgtgctga ctcagccacc ctcggtgtca gtggccccag gacagacggc caggattacc 121 tgtgggggaa acaacattgg acgtaaaagt gtgcactggt accagcagaa gccaggccag 181 gcccctgtgc tggtcgtcta tggtgctagc gaccggccct cagggatccc tgagcgattc 241 tctggctcca actctgggaa cacggccacc ctgaccatca gcagggtcgc agccggggat 301 gaggccgact attactgtca ggtgtgggat agtagtagtg ctcatccggg ggtggtattc 361 ggcggaggga ccaagctgac cgtcctaggt //