LOCUS       X52112                   390 bp    mRNA    linear   HUM 11-MAR-1999
DEFINITION  Human mRNA for immunoglobulin light chain VJ region, lambda-V
            family (cell line Pag-1).
ACCESSION   X52112
VERSION     X52112.1
KEYWORDS    Ig light chain; immunoglobulin; joining region; variable region.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 390)
  AUTHORS   Hughes-Jones N.C.
  JOURNAL   Submitted (15-MAR-1990) to the INSDC. Hughes-Jones N.C., Institute
            of Animal Physiology & Genetics Research, Babraham Hall, Cambridge
            CB2 4AT, U K.
REFERENCE   2  (bases 1 to 390)
  AUTHORS   Hughes-Jones N.C., Bye J.M., Beale D., Coadwell J.
  TITLE     Nucleotide sequences and three-dimensional modelling of the VH and
            VL domains of two human monoclonal antibodies specific for the D
            antigen of the human Rh-blood-group system
  JOURNAL   Biochem. J. 268(1), 135-140(1990).
   PUBMED   2111699
FEATURES             Location/Qualifiers
     source          1..390
                     /db_xref="H-InvDB:HIT000321724"
                     /organism="Homo sapiens"
                     /chromosome="22"
                     /strain="blood donor PA"
                     /mol_type="mRNA"
                     /cell_line="Pag-1"
                     /cell_type="B lymphocytes"
                     /db_xref="taxon:9606"
     CDS             1..>390
                     /product="immunoglobulin light chain"
                     /note="precursor polypeptide"
                     /protein_id="CAA36351.1"
                     /translation="MAWTVLLLGLLSHCTGSVTSYVLTQPPSVSVAPGQTARITCGGN
                     NIGRKSVHWYQQKPGQAPVLVVYGASDRPSGIPERFSGSNSGNTATLTISRVAAGDEA
                     DYYCQVWDSSSAHPGVVFGGGTKLTVLG"
     sig_peptide     1..57
     misc_feature    58..>390
                     /note="VJ region (AA 1 to 108)"
     misc_feature    58..351
                     /note="Vl region (AA 1 to 95)"
     misc_feature    352..>390
                     /note="J region (AA 96 to 108)"
BASE COUNT           73 a          117 c          120 g           80 t
ORIGIN      
        1 atggcctgga ccgttctcct cctcggcctc ctctctcact gcacaggctc tgtgacctcc
       61 tatgtgctga ctcagccacc ctcggtgtca gtggccccag gacagacggc caggattacc
      121 tgtgggggaa acaacattgg acgtaaaagt gtgcactggt accagcagaa gccaggccag
      181 gcccctgtgc tggtcgtcta tggtgctagc gaccggccct cagggatccc tgagcgattc
      241 tctggctcca actctgggaa cacggccacc ctgaccatca gcagggtcgc agccggggat
      301 gaggccgact attactgtca ggtgtgggat agtagtagtg ctcatccggg ggtggtattc
      361 ggcggaggga ccaagctgac cgtcctaggt
//