LOCUS       X52053                   482 bp    mRNA    linear   HUM 07-OCT-2008
DEFINITION  Human mRNA for HP-1, a member of the corticostatin/defensin family.
ACCESSION   X52053
VERSION     X52053.1
KEYWORDS    corticostatin/defensin family; HP-1 protein.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 482)
  AUTHORS   Mars W.M.
  JOURNAL   Submitted (26-FEB-1990) to the INSDC. Mars W.M., University of
            Texas  M D Anderson Cancer Centre, Biochemistry & Molecular Biology
            / Box 117, 1515 Holcombe Boulevard, Houston Texas  77030, USA.
REFERENCE   2  (bases 1 to 482)
  AUTHORS   Mars W.M., Patmasiriwat P., Maity T., Huff V., Weil M.M.
  TITLE     Inheritance of unequal numbers of the genes encoding the human
            neutrophil defensins HP-1 and HP-3
  JOURNAL   J Biol Chem 270(51), 30371-30376(1995).
   PUBMED   8530462
COMMENT     For conflicting sequences see <M22160>, <M23281> and <M26602>.
            
            Data kindly reviewed (09-APR-1990) by Mars W.M.
FEATURES             Location/Qualifiers
     source          1..482
                     /db_xref="H-InvDB:HIT000321716_06"
                     /organism="Homo sapiens"
                     /chromosome="8p23"
                     /mol_type="mRNA"
                     /clone="pUC4A"
                     /tissue_type="hematopoietic from AML patient"
                     /db_xref="taxon:9606"
     CDS             73..357
                     /note="HP-1 (AA 1-94)"
                     /db_xref="GOA:P59665"
                     /db_xref="H-InvDB:HIT000321716_04.4"
                     /db_xref="HGNC:HGNC:2761"
                     /db_xref="HGNC:HGNC:33596"
                     /db_xref="InterPro:IPR002366"
                     /db_xref="InterPro:IPR006080"
                     /db_xref="InterPro:IPR006081"
                     /db_xref="InterPro:IPR016327"
                     /db_xref="PDB:2KHT"
                     /db_xref="PDB:2PM1"
                     /db_xref="PDB:3GNY"
                     /db_xref="PDB:3H6C"
                     /db_xref="PDB:3HJ2"
                     /db_xref="PDB:3HJD"
                     /db_xref="PDB:3LO1"
                     /db_xref="PDB:3LO2"
                     /db_xref="PDB:3LO4"
                     /db_xref="PDB:3LO6"
                     /db_xref="PDB:3LO9"
                     /db_xref="PDB:3LOE"
                     /db_xref="PDB:3LVX"
                     /db_xref="PDB:4DU0"
                     /db_xref="PDB:4LB1"
                     /db_xref="PDB:4LB7"
                     /db_xref="PDB:4LBB"
                     /db_xref="PDB:4LBF"
                     /db_xref="UniProtKB/Swiss-Prot:P59665"
                     /protein_id="CAA36280.1"
                     /translation="MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVV
                     VSLAWDESLAPKHPGSRKNMACYCRIPACIAGERRYGTCIYQGRLWAFCC"
BASE COUNT          119 a          132 c          120 g          111 t
ORIGIN      
        1 cacctgggac agaggactgc tgtctgccct ctctggtcac cctgcctagc tagaggatct
       61 gtgaccccag ccatgaggac cctcgccatc cttgctgcca ttctcctggt ggccctgcag
      121 gcccaggctg agccactcca ggcaagagct gatgaggttg ctgcagcccc ggagcagatt
      181 gcagcggaca tcccagaagt ggttgtttcc cttgcatggg acgaaagctt ggctccaaag
      241 catccaggct caaggaaaaa catggcctgc tattgcagaa taccagcgtg cattgcagga
      301 gaacgtcgct atggaacctg catctaccag ggaagactct gggcattctg ctgctgagct
      361 tgcagaaaaa gaaaaatgag ctcaaaattt gctttgagag ctacagggaa ttgctattac
      421 tcatgtacct tctgctcaat ttcctttcct catctcaaat aaatgccttg ttacaagaaa
      481 ag
//