LOCUS X52053 482 bp mRNA linear HUM 07-OCT-2008 DEFINITION Human mRNA for HP-1, a member of the corticostatin/defensin family. ACCESSION X52053 VERSION X52053.1 KEYWORDS corticostatin/defensin family; HP-1 protein. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 482) AUTHORS Mars W.M. JOURNAL Submitted (26-FEB-1990) to the INSDC. Mars W.M., University of Texas M D Anderson Cancer Centre, Biochemistry & Molecular Biology / Box 117, 1515 Holcombe Boulevard, Houston Texas 77030, USA. REFERENCE 2 (bases 1 to 482) AUTHORS Mars W.M., Patmasiriwat P., Maity T., Huff V., Weil M.M. TITLE Inheritance of unequal numbers of the genes encoding the human neutrophil defensins HP-1 and HP-3 JOURNAL J Biol Chem 270(51), 30371-30376(1995). PUBMED 8530462 COMMENT For conflicting sequences see <M22160>, <M23281> and <M26602>. Data kindly reviewed (09-APR-1990) by Mars W.M. FEATURES Location/Qualifiers source 1..482 /db_xref="H-InvDB:HIT000321716_06" /organism="Homo sapiens" /chromosome="8p23" /mol_type="mRNA" /clone="pUC4A" /tissue_type="hematopoietic from AML patient" /db_xref="taxon:9606" CDS 73..357 /note="HP-1 (AA 1-94)" /db_xref="GOA:P59665" /db_xref="H-InvDB:HIT000321716_04.4" /db_xref="HGNC:HGNC:2761" /db_xref="HGNC:HGNC:33596" /db_xref="InterPro:IPR002366" /db_xref="InterPro:IPR006080" /db_xref="InterPro:IPR006081" /db_xref="InterPro:IPR016327" /db_xref="PDB:2KHT" /db_xref="PDB:2PM1" /db_xref="PDB:3GNY" /db_xref="PDB:3H6C" /db_xref="PDB:3HJ2" /db_xref="PDB:3HJD" /db_xref="PDB:3LO1" /db_xref="PDB:3LO2" /db_xref="PDB:3LO4" /db_xref="PDB:3LO6" /db_xref="PDB:3LO9" /db_xref="PDB:3LOE" /db_xref="PDB:3LVX" /db_xref="PDB:4DU0" /db_xref="PDB:4LB1" /db_xref="PDB:4LB7" /db_xref="PDB:4LBB" /db_xref="PDB:4LBF" /db_xref="UniProtKB/Swiss-Prot:P59665" /protein_id="CAA36280.1" /translation="MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVV VSLAWDESLAPKHPGSRKNMACYCRIPACIAGERRYGTCIYQGRLWAFCC" BASE COUNT 119 a 132 c 120 g 111 t ORIGIN 1 cacctgggac agaggactgc tgtctgccct ctctggtcac cctgcctagc tagaggatct 61 gtgaccccag ccatgaggac cctcgccatc cttgctgcca ttctcctggt ggccctgcag 121 gcccaggctg agccactcca ggcaagagct gatgaggttg ctgcagcccc ggagcagatt 181 gcagcggaca tcccagaagt ggttgtttcc cttgcatggg acgaaagctt ggctccaaag 241 catccaggct caaggaaaaa catggcctgc tattgcagaa taccagcgtg cattgcagga 301 gaacgtcgct atggaacctg catctaccag ggaagactct gggcattctg ctgctgagct 361 tgcagaaaaa gaaaaatgag ctcaaaattt gctttgagag ctacagggaa ttgctattac 421 tcatgtacct tctgctcaat ttcctttcct catctcaaat aaatgccttg ttacaagaaa 481 ag //