LOCUS       X51792                   160 bp    mRNA    linear   HUM 05-AUG-1995
DEFINITION  Human mRNA for T-cell antigen receptor beta-chain from cytotoxic
            T-cell clone CTL 64.8P.
ACCESSION   X51792
VERSION     X51792.1
KEYWORDS    constant region; Ig D-minigene; joining exon; T-cell receptor;
            T-cell receptor beta; variable region.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 160)
  AUTHORS   Lopez de Castro J.A.
  JOURNAL   Submitted (06-FEB-1990) to the INSDC. Lopez de Castro J.A., Dept of
            Immunology , Fundacion Jimenez Diaz, Avda. Reyes Catolicos 2, 28040
            Madrid, Spain.
REFERENCE   2  (bases 1 to 160)
  AUTHORS   Bragado R., Lauzurica P., Lopez D., Lopez de Castro J.A.
  TITLE     T cell receptor V beta gene usage in a human alloreactive response.
            Shared structural features among HLA-B27-specific T cell clones
  JOURNAL   J. Exp. Med. 171(4), 1189-1204(1990).
   PUBMED   1691261
COMMENT     See <X51785> to <X51796> for other CTL clones.
            See also <M13836> and <M14159> for overlapping sequences.
FEATURES             Location/Qualifiers
     source          1..160
                     /db_xref="H-InvDB:HIT000321691"
                     /organism="Homo sapiens"
                     /map="7q32-35"
                     /mol_type="mRNA"
                     /cell_line="CTL 64.8P"
                     /cell_type="cytotoxic anti-HLA-B27 cytotoxic T-cell"
                     /db_xref="taxon:9606"
     CDS             <1..>160
                     /codon_start=1
                     /product="T-cell receptor beta-chain (53 AA)"
                     /db_xref="H-InvDB:HIT000321691.7"
                     /protein_id="CAA36088.1"
                     /translation="SLLNLHLHALQPEDSALYLCASSQHRGGSSGANVLTFGAGSRLT
                     VLEDLKNVF"
     V_segment       1..72
                     /note="V-beta 7 segment (partial)"
     misc_feature    73..86
                     /note="put. N and D segments"
     J_segment       87..138
                     /note="J-beta 2.6 segment"
     C_region        139..160
                     /note="C-beta 2 segment (partial)"
BASE COUNT           33 a           53 c           45 g           29 t
ORIGIN      
        1 tctctcttaa accttcacct acacgccctg cagccagaag actcagccct gtatctctgc
       61 gccagcagcc aacacagggg ggggagctct ggggccaacg tcctgacttt cggggccggc
      121 agcaggctga ccgtgctgga ggacctgaaa aacgtgttcc
//