LOCUS X51792 160 bp mRNA linear HUM 05-AUG-1995 DEFINITION Human mRNA for T-cell antigen receptor beta-chain from cytotoxic T-cell clone CTL 64.8P. ACCESSION X51792 VERSION X51792.1 KEYWORDS constant region; Ig D-minigene; joining exon; T-cell receptor; T-cell receptor beta; variable region. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 160) AUTHORS Lopez de Castro J.A. JOURNAL Submitted (06-FEB-1990) to the INSDC. Lopez de Castro J.A., Dept of Immunology , Fundacion Jimenez Diaz, Avda. Reyes Catolicos 2, 28040 Madrid, Spain. REFERENCE 2 (bases 1 to 160) AUTHORS Bragado R., Lauzurica P., Lopez D., Lopez de Castro J.A. TITLE T cell receptor V beta gene usage in a human alloreactive response. Shared structural features among HLA-B27-specific T cell clones JOURNAL J. Exp. Med. 171(4), 1189-1204(1990). PUBMED 1691261 COMMENT See <X51785> to <X51796> for other CTL clones. See also <M13836> and <M14159> for overlapping sequences. FEATURES Location/Qualifiers source 1..160 /db_xref="H-InvDB:HIT000321691" /organism="Homo sapiens" /map="7q32-35" /mol_type="mRNA" /cell_line="CTL 64.8P" /cell_type="cytotoxic anti-HLA-B27 cytotoxic T-cell" /db_xref="taxon:9606" CDS <1..>160 /codon_start=1 /product="T-cell receptor beta-chain (53 AA)" /db_xref="H-InvDB:HIT000321691.7" /protein_id="CAA36088.1" /translation="SLLNLHLHALQPEDSALYLCASSQHRGGSSGANVLTFGAGSRLT VLEDLKNVF" V_segment 1..72 /note="V-beta 7 segment (partial)" misc_feature 73..86 /note="put. N and D segments" J_segment 87..138 /note="J-beta 2.6 segment" C_region 139..160 /note="C-beta 2 segment (partial)" BASE COUNT 33 a 53 c 45 g 29 t ORIGIN 1 tctctcttaa accttcacct acacgccctg cagccagaag actcagccct gtatctctgc 61 gccagcagcc aacacagggg ggggagctct ggggccaacg tcctgacttt cggggccggc 121 agcaggctga ccgtgctgga ggacctgaaa aacgtgttcc //