LOCUS       X14904                   568 bp    mRNA    linear   HUM 27-MAR-1995
DEFINITION  Human IAPP mRNA for islet amyloid polypeptide precursor (IAP-cI).
ACCESSION   X14904 Y07495
VERSION     X14904.1
KEYWORDS    IAPP gene; islet amyloid polypeptide.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 568)
  AUTHORS   Mosselman S.
  JOURNAL   Submitted (31-MAR-1989) to the INSDC. Mosselman S., Institute of
            Molecular Biology and Medical Biotechnology, University of Utrecht,
            Padualaan 8, 3584 CH Utrecht, The Netherlands.
REFERENCE   2  (bases 1 to 568)
  AUTHORS   Mosselman S., Hoeppener J.W.M., Lips C.J.M., Jansz H.S.
  TITLE     The complete islet amyloid polypeptide precursor is encoded by two
            exons
  JOURNAL   FEBS Lett. 247(1), 154-158(1989).
   PUBMED   2651160
COMMENT     The sequence overlaps with that reported by Sanke et. al. in
            J. Biol. Chem. 263:17243-17246(1988) J04422 and by Mosselmann
            et. al. in FEBS letters 239:227-232(1988).
FEATURES             Location/Qualifiers
     source          1..568
                     /db_xref="H-InvDB:HIT000321471"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /clone_lib="lambda gt10"
                     /clone="lambda hIAP-c1"
                     /tissue_type="insulinoma"
                     /db_xref="taxon:9606"
     misc_feature    83..84
                     /note="exon 1/exon 2 boundary"
     CDS             99..368
                     /note="IAPP precursor (AA 1-89)"
                     /db_xref="GOA:P10997"
                     /db_xref="H-InvDB:HIT000321471.14"
                     /db_xref="HGNC:HGNC:5329"
                     /db_xref="InterPro:IPR000443"
                     /db_xref="InterPro:IPR001693"
                     /db_xref="InterPro:IPR018360"
                     /db_xref="InterPro:IPR021116"
                     /db_xref="InterPro:IPR021117"
                     /db_xref="PDB:1KUW"
                     /db_xref="PDB:2G48"
                     /db_xref="PDB:2KB8"
                     /db_xref="PDB:2L86"
                     /db_xref="PDB:3DG1"
                     /db_xref="PDB:3FPO"
                     /db_xref="PDB:3FR1"
                     /db_xref="PDB:3FTH"
                     /db_xref="PDB:3FTK"
                     /db_xref="PDB:3FTL"
                     /db_xref="PDB:3FTR"
                     /db_xref="PDB:3G7V"
                     /db_xref="PDB:3G7W"
                     /db_xref="PDB:3HGZ"
                     /db_xref="PDB:5K5G"
                     /db_xref="PDB:5KNZ"
                     /db_xref="PDB:5KO0"
                     /db_xref="PDB:5MGQ"
                     /db_xref="UniProtKB/Swiss-Prot:P10997"
                     /protein_id="CAA33032.1"
                     /translation="MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQR
                     LANFLVHSSNNFGAILSSTNVGSNTYGKRNAVEVLKREPLNYLPL"
     misc_feature    178..179
                     /note="exon 2/exon 3 boundary"
     mat_peptide     198..308
                     /note="mature IAPP (AA 34-70)"
     misc_feature    542..547
                     /note="pot. polyA signal"
     polyA_site      568..568
                     /note="polyA site"
BASE COUNT          168 a          106 c          110 g          184 t
ORIGIN      
        1 ggatacaagc ttggactctt ttcttgaagc tttctttcta tcagaagcat ttgctgatat
       61 tgctgacatt gaaacattaa aagaaaattt gagaagcaat gggcatcctg aagctgcaag
      121 tatttctcat tgtgctctct gttgcattga accatctgaa agctacaccc attgaaagtc
      181 atcaggtgga aaagcggaaa tgcaacactg ccacatgtgc aacgcagcgc ctggcaaatt
      241 ttttagttca ttccagcaac aactttggtg ccattctctc atctaccaac gtgggatcca
      301 atacatatgg caagaggaat gcagtagagg ttttaaagag agagccactg aattacttgc
      361 ccctttagag gacaatgtaa ctctatagtt attgttttat gttctagtga tttcctgtat
      421 aatttaacag tgcccttttc atctccagtg tgaatatatg gtctgtgtgt ctgatgtttg
      481 ttgctaggac atataccttc tcaaaagatt gttttatatg tagtactaac taaggtccca
      541 taataaaaag atagtatctt ttaaaatg
//