LOCUS X14904 568 bp mRNA linear HUM 27-MAR-1995 DEFINITION Human IAPP mRNA for islet amyloid polypeptide precursor (IAP-cI). ACCESSION X14904 Y07495 VERSION X14904.1 KEYWORDS IAPP gene; islet amyloid polypeptide. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 568) AUTHORS Mosselman S. JOURNAL Submitted (31-MAR-1989) to the INSDC. Mosselman S., Institute of Molecular Biology and Medical Biotechnology, University of Utrecht, Padualaan 8, 3584 CH Utrecht, The Netherlands. REFERENCE 2 (bases 1 to 568) AUTHORS Mosselman S., Hoeppener J.W.M., Lips C.J.M., Jansz H.S. TITLE The complete islet amyloid polypeptide precursor is encoded by two exons JOURNAL FEBS Lett. 247(1), 154-158(1989). PUBMED 2651160 COMMENT The sequence overlaps with that reported by Sanke et. al. in J. Biol. Chem. 263:17243-17246(1988) J04422 and by Mosselmann et. al. in FEBS letters 239:227-232(1988). FEATURES Location/Qualifiers source 1..568 /db_xref="H-InvDB:HIT000321471" /organism="Homo sapiens" /mol_type="mRNA" /clone_lib="lambda gt10" /clone="lambda hIAP-c1" /tissue_type="insulinoma" /db_xref="taxon:9606" misc_feature 83..84 /note="exon 1/exon 2 boundary" CDS 99..368 /note="IAPP precursor (AA 1-89)" /db_xref="GOA:P10997" /db_xref="H-InvDB:HIT000321471.14" /db_xref="HGNC:HGNC:5329" /db_xref="InterPro:IPR000443" /db_xref="InterPro:IPR001693" /db_xref="InterPro:IPR018360" /db_xref="InterPro:IPR021116" /db_xref="InterPro:IPR021117" /db_xref="PDB:1KUW" /db_xref="PDB:2G48" /db_xref="PDB:2KB8" /db_xref="PDB:2L86" /db_xref="PDB:3DG1" /db_xref="PDB:3FPO" /db_xref="PDB:3FR1" /db_xref="PDB:3FTH" /db_xref="PDB:3FTK" /db_xref="PDB:3FTL" /db_xref="PDB:3FTR" /db_xref="PDB:3G7V" /db_xref="PDB:3G7W" /db_xref="PDB:3HGZ" /db_xref="PDB:5K5G" /db_xref="PDB:5KNZ" /db_xref="PDB:5KO0" /db_xref="PDB:5MGQ" /db_xref="UniProtKB/Swiss-Prot:P10997" /protein_id="CAA33032.1" /translation="MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQR LANFLVHSSNNFGAILSSTNVGSNTYGKRNAVEVLKREPLNYLPL" misc_feature 178..179 /note="exon 2/exon 3 boundary" mat_peptide 198..308 /note="mature IAPP (AA 34-70)" misc_feature 542..547 /note="pot. polyA signal" polyA_site 568..568 /note="polyA site" BASE COUNT 168 a 106 c 110 g 184 t ORIGIN 1 ggatacaagc ttggactctt ttcttgaagc tttctttcta tcagaagcat ttgctgatat 61 tgctgacatt gaaacattaa aagaaaattt gagaagcaat gggcatcctg aagctgcaag 121 tatttctcat tgtgctctct gttgcattga accatctgaa agctacaccc attgaaagtc 181 atcaggtgga aaagcggaaa tgcaacactg ccacatgtgc aacgcagcgc ctggcaaatt 241 ttttagttca ttccagcaac aactttggtg ccattctctc atctaccaac gtgggatcca 301 atacatatgg caagaggaat gcagtagagg ttttaaagag agagccactg aattacttgc 361 ccctttagag gacaatgtaa ctctatagtt attgttttat gttctagtga tttcctgtat 421 aatttaacag tgcccttttc atctccagtg tgaatatatg gtctgtgtgt ctgatgtttg 481 ttgctaggac atataccttc tcaaaagatt gttttatatg tagtactaac taaggtccca 541 taataaaaag atagtatctt ttaaaatg //