LOCUS       X12517                   733 bp    mRNA    linear   HUM 07-OCT-2008
DEFINITION  Human mRNA for U1 small nuclear RNP-specific C protein.
ACCESSION   X12517
VERSION     X12517.1
KEYWORDS    U1 snRNP-specific protein C.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 733)
  AUTHORS   Sillekens P.T.G.
  JOURNAL   Submitted (29-JUL-1988) to the INSDC. Sillekens P.T.G., Department
            of Biochemistry, University of Nijmegen, St. Adelbertusplein 1, PO
            Box 9101, 6500 HB Nijmegen, The Netherlands.
REFERENCE   2  (bases 1 to 733)
  AUTHORS   Sillekens P.T.G., Beijer R.P., Habets W.J., van Venrooij W.J.
  TITLE     Human U1 snRNP-specific C protein: complete cDNA and protein
            sequence and identification of a multigene family in mammals
  JOURNAL   Nucleic Acids Res. 16(17), 8307-8321(1988).
   PUBMED   2971157
COMMENT     The sequence overlaps with that reported by Yamamoto et al.in
            J.Immunol. 140:311-317(1988), M18465.
FEATURES             Location/Qualifiers
     source          1..733
                     /db_xref="H-InvDB:HIT000321310"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /clone_lib="lambda gt11"
                     /clone="pHC1"
                     /tissue_type="teratocarcinoma"
                     /db_xref="taxon:9606"
     CDS             16..495
                     /note="C protein (AA 1-159)"
                     /db_xref="GOA:P09234"
                     /db_xref="H-InvDB:HIT000321310.12"
                     /db_xref="HGNC:HGNC:11157"
                     /db_xref="InterPro:IPR000690"
                     /db_xref="InterPro:IPR003604"
                     /db_xref="InterPro:IPR013085"
                     /db_xref="InterPro:IPR017340"
                     /db_xref="InterPro:IPR036236"
                     /db_xref="PDB:2VRD"
                     /db_xref="PDB:3CW1"
                     /db_xref="PDB:4PJO"
                     /db_xref="PDB:6ELD"
                     /db_xref="PDB:6QX9"
                     /db_xref="UniProtKB/Swiss-Prot:P09234"
                     /protein_id="CAA31037.1"
                     /translation="MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEE
                     QAQSLIDKTTAAFQQGKIPPTPFSAPPPAGAMIPPPPSLPGPPRPGMMPAPHMGGPPM
                     MPMMGPPPPGMMPVGPAPGMRPPMGGHMPMMPGPPMMRPPARPMMVPTRPGMTRPDR"
     misc_feature    88..88
                     /note="T is C in ref M18465"
     misc_feature    94..94
                     /note="G is A in ref M18465"
     misc_feature    295..295
                     /note="G is A in ref M18465"
     misc_feature    298..298
                     /note="C is a gap in ref M18465"
     misc_feature    306..306
                     /note="C is a gap in ref M18465"
     misc_feature    316..316
                     /note="C is a gap in ref M18465"
     misc_feature    399..399
                     /note="C is a gap in ref M18465"
     misc_feature    691..697
                     /note="poyA signal"
BASE COUNT          202 a          186 c          175 g          170 t
ORIGIN      
        1 gaattccaga gcaacatgcc caagttttat tgtgactact gcgatacata cctcacccat
       61 gactctccat ctgtgagaaa gacacactgc agtggaagga aacacaaaga gaatgtgaaa
      121 gactattatc agaaatggat ggaagagcag gctcagagcc tgattgacaa aacaacggct
      181 gcatttcaac aaggaaagat acctcctact ccattctctg ctcctcctcc tgcaggggcg
      241 atgataccac ctccccccag ccttccgggt cctcctcgcc ctggtatgat gccagcaccc
      301 catatggggg gccctcccat gatgccaatg atgggccctc ctcctcctgg gatgatgcca
      361 gtgggacctg ctcctggaat gaggccgccc atgggaggcc atatgccaat gatgcctggg
      421 cccccaatga tgagacctcc tgcccgtccc atgatggtgc ccactcggcc cggaatgact
      481 cgaccagaca gataaggata gaggggaggc cttattgtat cggttttata ttacctgttc
      541 tgcttcacca ggagatcatg ctgctgtgat actgagtttt ctaaacagca taaggaagac
      601 ttgctcccct gtcctatgaa agagaatagt tttggagggg agaagtggga caaaaaagat
      661 gcagttttcc tttgtattgg gaaatgtgaa aataaaattg tcaactcttt cagttaaaaa
      721 aaaaaaggaa ttc
//