LOCUS X12517 733 bp mRNA linear HUM 07-OCT-2008 DEFINITION Human mRNA for U1 small nuclear RNP-specific C protein. ACCESSION X12517 VERSION X12517.1 KEYWORDS U1 snRNP-specific protein C. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 733) AUTHORS Sillekens P.T.G. JOURNAL Submitted (29-JUL-1988) to the INSDC. Sillekens P.T.G., Department of Biochemistry, University of Nijmegen, St. Adelbertusplein 1, PO Box 9101, 6500 HB Nijmegen, The Netherlands. REFERENCE 2 (bases 1 to 733) AUTHORS Sillekens P.T.G., Beijer R.P., Habets W.J., van Venrooij W.J. TITLE Human U1 snRNP-specific C protein: complete cDNA and protein sequence and identification of a multigene family in mammals JOURNAL Nucleic Acids Res. 16(17), 8307-8321(1988). PUBMED 2971157 COMMENT The sequence overlaps with that reported by Yamamoto et al.in J.Immunol. 140:311-317(1988), M18465. FEATURES Location/Qualifiers source 1..733 /db_xref="H-InvDB:HIT000321310" /organism="Homo sapiens" /mol_type="mRNA" /clone_lib="lambda gt11" /clone="pHC1" /tissue_type="teratocarcinoma" /db_xref="taxon:9606" CDS 16..495 /note="C protein (AA 1-159)" /db_xref="GOA:P09234" /db_xref="H-InvDB:HIT000321310.12" /db_xref="HGNC:HGNC:11157" /db_xref="InterPro:IPR000690" /db_xref="InterPro:IPR003604" /db_xref="InterPro:IPR013085" /db_xref="InterPro:IPR017340" /db_xref="InterPro:IPR036236" /db_xref="PDB:2VRD" /db_xref="PDB:3CW1" /db_xref="PDB:4PJO" /db_xref="PDB:6ELD" /db_xref="PDB:6QX9" /db_xref="UniProtKB/Swiss-Prot:P09234" /protein_id="CAA31037.1" /translation="MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEE QAQSLIDKTTAAFQQGKIPPTPFSAPPPAGAMIPPPPSLPGPPRPGMMPAPHMGGPPM MPMMGPPPPGMMPVGPAPGMRPPMGGHMPMMPGPPMMRPPARPMMVPTRPGMTRPDR" misc_feature 88..88 /note="T is C in ref M18465" misc_feature 94..94 /note="G is A in ref M18465" misc_feature 295..295 /note="G is A in ref M18465" misc_feature 298..298 /note="C is a gap in ref M18465" misc_feature 306..306 /note="C is a gap in ref M18465" misc_feature 316..316 /note="C is a gap in ref M18465" misc_feature 399..399 /note="C is a gap in ref M18465" misc_feature 691..697 /note="poyA signal" BASE COUNT 202 a 186 c 175 g 170 t ORIGIN 1 gaattccaga gcaacatgcc caagttttat tgtgactact gcgatacata cctcacccat 61 gactctccat ctgtgagaaa gacacactgc agtggaagga aacacaaaga gaatgtgaaa 121 gactattatc agaaatggat ggaagagcag gctcagagcc tgattgacaa aacaacggct 181 gcatttcaac aaggaaagat acctcctact ccattctctg ctcctcctcc tgcaggggcg 241 atgataccac ctccccccag ccttccgggt cctcctcgcc ctggtatgat gccagcaccc 301 catatggggg gccctcccat gatgccaatg atgggccctc ctcctcctgg gatgatgcca 361 gtgggacctg ctcctggaat gaggccgccc atgggaggcc atatgccaat gatgcctggg 421 cccccaatga tgagacctcc tgcccgtccc atgatggtgc ccactcggcc cggaatgact 481 cgaccagaca gataaggata gaggggaggc cttattgtat cggttttata ttacctgttc 541 tgcttcacca ggagatcatg ctgctgtgat actgagtttt ctaaacagca taaggaagac 601 ttgctcccct gtcctatgaa agagaatagt tttggagggg agaagtggga caaaaaagat 661 gcagttttcc tttgtattgg gaaatgtgaa aataaaattg tcaactcttt cagttaaaaa 721 aaaaaaggaa ttc //