LOCUS X06818 126 bp mRNA linear HUM 13-DEC-1994 DEFINITION Human mRNA for hU1-70K snRNP protein (RNPH2, part 1). ACCESSION X06818 Y00886 VERSION X06818.1 KEYWORDS alternate splicing; small nuclear ribonucleoprotein; U1 small nuclear RNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 126) AUTHORS Spritz R.A. JOURNAL Submitted (15-FEB-1988) to the INSDC. Spritz R.A., University of Wisconsin, 309 Laboratory of Genetics 445 Henry Mall, Madison, WI 53706. REFERENCE 2 (bases 1 to 126) AUTHORS Spritz R.A., Strunk K., Surowy C.S.O., Hoch S., Barton D.E., Francke U. TITLE The human U1-70K snRNP protein: cDNA cloning, chromosomal localization, expression, alternative splicing and RNA-binding JOURNAL Nucleic Acids Res. 15(24), 10373-10391(1987). PUBMED 2447561 COMMENT 1200 bp of the clone have not been determined. See also x07403. FEATURES Location/Qualifiers source 1..126 /db_xref="H-InvDB:HIT000321218" /organism="Homo sapiens" /chromosome="chromosome 19" /mol_type="mRNA" /clone="RNPH2" /tissue_type="liver" /db_xref="taxon:9606" CDS <1..>126 /codon_start=1 /note="hU1-70K protein (42 AA)" /db_xref="H-InvDB:HIT000321218.11" /db_xref="UniProtKB/TrEMBL:Q15688" /protein_id="CAA29967.1" /translation="FWPSLPPVTLFHTCHPWRNCHMKNTTINLIVALRRTFESLRT" BASE COUNT 30 a 43 c 23 g 30 t ORIGIN 1 ttctggccct ctttgccccc cgtgacccta ttccatacct gccacccctg gagaaactgc 61 cacatgaaaa acaccacaat caaccttatt gtggcattgc gccgtacatt cgagagtttg 121 aggacc //