LOCUS       X06818                   126 bp    mRNA    linear   HUM 13-DEC-1994
DEFINITION  Human mRNA for hU1-70K snRNP protein (RNPH2, part 1).
ACCESSION   X06818 Y00886
VERSION     X06818.1
KEYWORDS    alternate splicing; small nuclear ribonucleoprotein; U1 small
            nuclear RNA.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 126)
  AUTHORS   Spritz R.A.
  JOURNAL   Submitted (15-FEB-1988) to the INSDC. Spritz R.A., University of
            Wisconsin, 309 Laboratory of Genetics 445 Henry Mall, Madison, WI
            53706.
REFERENCE   2  (bases 1 to 126)
  AUTHORS   Spritz R.A., Strunk K., Surowy C.S.O., Hoch S., Barton D.E.,
            Francke U.
  TITLE     The human U1-70K snRNP protein: cDNA cloning, chromosomal
            localization, expression, alternative splicing and RNA-binding
  JOURNAL   Nucleic Acids Res. 15(24), 10373-10391(1987).
   PUBMED   2447561
COMMENT     1200 bp of the clone have not been determined. See also x07403.
FEATURES             Location/Qualifiers
     source          1..126
                     /db_xref="H-InvDB:HIT000321218"
                     /organism="Homo sapiens"
                     /chromosome="chromosome 19"
                     /mol_type="mRNA"
                     /clone="RNPH2"
                     /tissue_type="liver"
                     /db_xref="taxon:9606"
     CDS             <1..>126
                     /codon_start=1
                     /note="hU1-70K protein (42 AA)"
                     /db_xref="H-InvDB:HIT000321218.11"
                     /db_xref="UniProtKB/TrEMBL:Q15688"
                     /protein_id="CAA29967.1"
                     /translation="FWPSLPPVTLFHTCHPWRNCHMKNTTINLIVALRRTFESLRT"
BASE COUNT           30 a           43 c           23 g           30 t
ORIGIN      
        1 ttctggccct ctttgccccc cgtgacccta ttccatacct gccacccctg gagaaactgc
       61 cacatgaaaa acaccacaat caaccttatt gtggcattgc gccgtacatt cgagagtttg
      121 aggacc
//