LOCUS       X06817                   243 bp    mRNA    linear   HUM 13-DEC-1994
DEFINITION  Human mRNA for hU1-70k snRNP protein (RNPH1, part 1).
ACCESSION   X06817 Y00886
VERSION     X06817.1
KEYWORDS    alternate splicing; small nuclear ribonucleoprotein; U1 small
            nuclear RNA.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 243)
  AUTHORS   Spritz R.A.
  JOURNAL   Submitted (15-FEB-1988) to the INSDC. Spritz R.A., University of
            Wisconsin, 309 Laboratory of Genetics 445 Henry Mall, Madison, WI
            53706.
REFERENCE   2  (bases 1 to 243)
  AUTHORS   Spritz R.A., Strunk K., Surowy C.S.O., Hoch S., Barton D.E.,
            Francke U.
  TITLE     The human U1-70K snRNP protein: cDNA cloning, chromosomal
            localization, expression, alternative splicing and RNA-binding
  JOURNAL   Nucleic Acids Res. 15(24), 10373-10391(1987).
   PUBMED   2447561
COMMENT     The clone has only been partially sequenced. See also x07402.
            1200 bp have not been determined.
FEATURES             Location/Qualifiers
     source          1..243
                     /db_xref="H-InvDB:HIT000321217"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /clone="RNPH1"
                     /tissue_type="liver"
                     /db_xref="taxon:9606"
     CDS             <1..>243
                     /codon_start=2
                     /note="hU1-70k protein (81 AA)"
                     /db_xref="GOA:P08621"
                     /db_xref="H-InvDB:HIT000321217.14"
                     /db_xref="HGNC:HGNC:11150"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR022023"
                     /db_xref="InterPro:IPR034143"
                     /db_xref="InterPro:IPR035979"
                     /db_xref="PDB:2L5I"
                     /db_xref="PDB:2L5J"
                     /db_xref="PDB:3CW1"
                     /db_xref="PDB:3PGW"
                     /db_xref="PDB:4PJO"
                     /db_xref="PDB:4PKD"
                     /db_xref="PDB:6QX9"
                     /db_xref="UniProtKB/Swiss-Prot:P08621"
                     /protein_id="CAA29966.1"
                     /translation="GPTPCSSRYRRPRGWLSSGLVRSLSGRRNQTDVDAPGVEAEAGV
                     VVAEGLPQPPRASGQTPERGGATRLGKMTQFLPPNLL"
BASE COUNT           41 a           80 c           88 g           34 t
ORIGIN      
        1 gggacccacc ccctgctcca gtcgctatcg gaggccgcgc gggtggctga gcagcggcct
       61 ggtgcgctcg cttagcgggc gacggaatca gacggacgtg gacgcccccg gagtggaagc
      121 cgaagcagga gttgttgttg ctgaggggct gccgcagccg ccgcgagcct ccggacagac
      181 gccagagcga ggaggcgcta cgcgacttgg caagatgacc cagttcctgc cgcccaacct
      241 tct
//