LOCUS X06817 243 bp mRNA linear HUM 13-DEC-1994 DEFINITION Human mRNA for hU1-70k snRNP protein (RNPH1, part 1). ACCESSION X06817 Y00886 VERSION X06817.1 KEYWORDS alternate splicing; small nuclear ribonucleoprotein; U1 small nuclear RNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 243) AUTHORS Spritz R.A. JOURNAL Submitted (15-FEB-1988) to the INSDC. Spritz R.A., University of Wisconsin, 309 Laboratory of Genetics 445 Henry Mall, Madison, WI 53706. REFERENCE 2 (bases 1 to 243) AUTHORS Spritz R.A., Strunk K., Surowy C.S.O., Hoch S., Barton D.E., Francke U. TITLE The human U1-70K snRNP protein: cDNA cloning, chromosomal localization, expression, alternative splicing and RNA-binding JOURNAL Nucleic Acids Res. 15(24), 10373-10391(1987). PUBMED 2447561 COMMENT The clone has only been partially sequenced. See also x07402. 1200 bp have not been determined. FEATURES Location/Qualifiers source 1..243 /db_xref="H-InvDB:HIT000321217" /organism="Homo sapiens" /mol_type="mRNA" /clone="RNPH1" /tissue_type="liver" /db_xref="taxon:9606" CDS <1..>243 /codon_start=2 /note="hU1-70k protein (81 AA)" /db_xref="GOA:P08621" /db_xref="H-InvDB:HIT000321217.14" /db_xref="HGNC:HGNC:11150" /db_xref="InterPro:IPR000504" /db_xref="InterPro:IPR012677" /db_xref="InterPro:IPR022023" /db_xref="InterPro:IPR034143" /db_xref="InterPro:IPR035979" /db_xref="PDB:2L5I" /db_xref="PDB:2L5J" /db_xref="PDB:3CW1" /db_xref="PDB:3PGW" /db_xref="PDB:4PJO" /db_xref="PDB:4PKD" /db_xref="PDB:6QX9" /db_xref="UniProtKB/Swiss-Prot:P08621" /protein_id="CAA29966.1" /translation="GPTPCSSRYRRPRGWLSSGLVRSLSGRRNQTDVDAPGVEAEAGV VVAEGLPQPPRASGQTPERGGATRLGKMTQFLPPNLL" BASE COUNT 41 a 80 c 88 g 34 t ORIGIN 1 gggacccacc ccctgctcca gtcgctatcg gaggccgcgc gggtggctga gcagcggcct 61 ggtgcgctcg cttagcgggc gacggaatca gacggacgtg gacgcccccg gagtggaagc 121 cgaagcagga gttgttgttg ctgaggggct gccgcagccg ccgcgagcct ccggacagac 181 gccagagcga ggaggcgcta cgcgacttgg caagatgacc cagttcctgc cgcccaacct 241 tct //