LOCUS       X06160                   580 bp    RNA     linear   HUM 12-JUN-2003
DEFINITION  Homo sapiens  pre-mRNA for insulin-like growth factor II precursor,
            clone P21.
ACCESSION   X06160 Y00693
VERSION     X06160.1
KEYWORDS    insulin-like growth factor II; somatomedin.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 580)
  AUTHORS   Le Bouc Y.
  JOURNAL   Submitted (04-NOV-1987) to the INSDC. Le Bouc Y., Inserm U 142,
            Hopital Trousseau, 26 Avenue Docteur Netter, 75012 Paris, France.
REFERENCE   2  (bases 1 to 580)
  AUTHORS   Le Bouc Y., Noguiez P., Sondermeijer P., Dreyer D., Girard F.,
            Binoux M.
  TITLE     A new 5'-non-coding region for human placental insulin-like growth
            factor II mRNA expression
  JOURNAL   FEBS Lett. 222(1), 181-185(1987).
   PUBMED   3653397
COMMENT     Data kindly reviewed (10-DEC-1988) by le Bouc Y.
FEATURES             Location/Qualifiers
     source          1..580
                     /db_xref="H-InvDB:HIT000367394"
                     /organism="Homo sapiens"
                     /mol_type="transcribed RNA"
                     /clone_lib="lambda gt10"
                     /clone="P21"
                     /tissue_type="placenta"
                     /db_xref="taxon:9606"
     prim_transcript 1..580
                     /note="primary transcript"
     misc_feature    1..88
                     /note="5' UT-region"
     repeat_region   21..53
                     /note="trinucleotide tandem repeat"
     misc_feature    82..83
                     /note="splice site"
     CDS             89..>580
                     /product="insulin-like growth factor II precursor"
                     /note="precursor polypeptide (AA -24 to 140)"
                     /db_xref="GOA:P01344"
                     /db_xref="H-InvDB:HIT000367394.8"
                     /db_xref="HGNC:HGNC:5466"
                     /db_xref="InterPro:IPR013576"
                     /db_xref="InterPro:IPR016179"
                     /db_xref="InterPro:IPR022334"
                     /db_xref="InterPro:IPR022350"
                     /db_xref="InterPro:IPR022352"
                     /db_xref="InterPro:IPR022353"
                     /db_xref="InterPro:IPR036438"
                     /db_xref="PDB:1GF2"
                     /db_xref="PDB:1IGL"
                     /db_xref="PDB:2L29"
                     /db_xref="PDB:2V5P"
                     /db_xref="PDB:3E4Z"
                     /db_xref="PDB:3KR3"
                     /db_xref="PDB:5L3L"
                     /db_xref="PDB:5L3M"
                     /db_xref="PDB:5L3N"
                     /db_xref="UniProtKB/Swiss-Prot:P01344"
                     /protein_id="CAA29517.1"
                     /translation="MGIPMGKSMLVLLTFLAFASCCIAAYRPSETLCGGELVDTLQFV
                     CGDRGFYFRLPGRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSERDVSTPPT
                     VLPDNFPRYPVGKFFQYDTWKQSTQRLRRGLPALLRARRGHVLAKELEAFREAKRHRP
                     LIAL"
     sig_peptide     89..160
                     /note="signal peptide (AA -24 to -1)"
     mat_peptide     161..>580
                     /product="insulin-like growth factor II precursor"
     misc_feature    245..256
                     /note="IGF-II coding seq. variation (AA 29)"
BASE COUNT           89 a          206 c          160 g          125 t
ORIGIN      
        1 tcctgtaaag agacttccag cttcctcctc ctcctcttcc tcctcctcct cctgccccag
       61 cgagccttct gctgagctgt agacaccaat gggaatccca atggggaagt cgatgctggt
      121 gcttctcacc ttcttggcct tcgcctcgtg ctgcattgct gcttaccgcc ccagtgagac
      181 cctgtgcggc ggggagctgg tggacaccct ccagttcgtc tgtggggacc gcggcttcta
      241 cttcagactt ccaggcaggc ccgcaagccg tgtgagccgt cgcagccgtg gcatcgttga
      301 ggagtgctgt ttccgcagct gtgacctggc cctcctggag acgtactgtg ctacccccgc
      361 caagtccgag agggacgtgt cgacccctcc gaccgtgctt ccggacaact tccccagata
      421 ccccgtgggc aagttcttcc aatatgacac ctggaagcag tccacccagc gcctgcgcag
      481 gggcctgcct gccctcctgc gtgcccgccg gggtcacgtg ctcgccaagg agctcgaggc
      541 gttcagggag gccaaacgtc accgtcccct gattgctcta
//