LOCUS X06160 580 bp RNA linear HUM 12-JUN-2003 DEFINITION Homo sapiens pre-mRNA for insulin-like growth factor II precursor, clone P21. ACCESSION X06160 Y00693 VERSION X06160.1 KEYWORDS insulin-like growth factor II; somatomedin. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 580) AUTHORS Le Bouc Y. JOURNAL Submitted (04-NOV-1987) to the INSDC. Le Bouc Y., Inserm U 142, Hopital Trousseau, 26 Avenue Docteur Netter, 75012 Paris, France. REFERENCE 2 (bases 1 to 580) AUTHORS Le Bouc Y., Noguiez P., Sondermeijer P., Dreyer D., Girard F., Binoux M. TITLE A new 5'-non-coding region for human placental insulin-like growth factor II mRNA expression JOURNAL FEBS Lett. 222(1), 181-185(1987). PUBMED 3653397 COMMENT Data kindly reviewed (10-DEC-1988) by le Bouc Y. FEATURES Location/Qualifiers source 1..580 /db_xref="H-InvDB:HIT000367394" /organism="Homo sapiens" /mol_type="transcribed RNA" /clone_lib="lambda gt10" /clone="P21" /tissue_type="placenta" /db_xref="taxon:9606" prim_transcript 1..580 /note="primary transcript" misc_feature 1..88 /note="5' UT-region" repeat_region 21..53 /note="trinucleotide tandem repeat" misc_feature 82..83 /note="splice site" CDS 89..>580 /product="insulin-like growth factor II precursor" /note="precursor polypeptide (AA -24 to 140)" /db_xref="GOA:P01344" /db_xref="H-InvDB:HIT000367394.8" /db_xref="HGNC:HGNC:5466" /db_xref="InterPro:IPR013576" /db_xref="InterPro:IPR016179" /db_xref="InterPro:IPR022334" /db_xref="InterPro:IPR022350" /db_xref="InterPro:IPR022352" /db_xref="InterPro:IPR022353" /db_xref="InterPro:IPR036438" /db_xref="PDB:1GF2" /db_xref="PDB:1IGL" /db_xref="PDB:2L29" /db_xref="PDB:2V5P" /db_xref="PDB:3E4Z" /db_xref="PDB:3KR3" /db_xref="PDB:5L3L" /db_xref="PDB:5L3M" /db_xref="PDB:5L3N" /db_xref="UniProtKB/Swiss-Prot:P01344" /protein_id="CAA29517.1" /translation="MGIPMGKSMLVLLTFLAFASCCIAAYRPSETLCGGELVDTLQFV CGDRGFYFRLPGRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSERDVSTPPT VLPDNFPRYPVGKFFQYDTWKQSTQRLRRGLPALLRARRGHVLAKELEAFREAKRHRP LIAL" sig_peptide 89..160 /note="signal peptide (AA -24 to -1)" mat_peptide 161..>580 /product="insulin-like growth factor II precursor" misc_feature 245..256 /note="IGF-II coding seq. variation (AA 29)" BASE COUNT 89 a 206 c 160 g 125 t ORIGIN 1 tcctgtaaag agacttccag cttcctcctc ctcctcttcc tcctcctcct cctgccccag 61 cgagccttct gctgagctgt agacaccaat gggaatccca atggggaagt cgatgctggt 121 gcttctcacc ttcttggcct tcgcctcgtg ctgcattgct gcttaccgcc ccagtgagac 181 cctgtgcggc ggggagctgg tggacaccct ccagttcgtc tgtggggacc gcggcttcta 241 cttcagactt ccaggcaggc ccgcaagccg tgtgagccgt cgcagccgtg gcatcgttga 301 ggagtgctgt ttccgcagct gtgacctggc cctcctggag acgtactgtg ctacccccgc 361 caagtccgag agggacgtgt cgacccctcc gaccgtgctt ccggacaact tccccagata 421 ccccgtgggc aagttcttcc aatatgacac ctggaagcag tccacccagc gcctgcgcag 481 gggcctgcct gccctcctgc gtgcccgccg gggtcacgtg ctcgccaagg agctcgaggc 541 gttcagggag gccaaacgtc accgtcccct gattgctcta //