LOCUS       X04731                   224 bp    mRNA    linear   HUM 13-JUL-1995
DEFINITION  Human mRNA for plasminogen activator inhibitor type 1 C-terminus.
ACCESSION   X04731
VERSION     X04731.1
KEYWORDS    plasminogen activator inhibitor type 1.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 224)
  AUTHORS   Andreasen P.A., Riccio A., Welinder K.G., Douglas R., Sartorio R.,
            Nielsen L.S., Oppenheimer C., Blasi F., Dano K.
  TITLE     Plasminogen activator inhibitor type-1: reactive center and
            amino-terminal heterogeneity determined by protein and cDNA
            sequencing
  JOURNAL   FEBS Lett. 209(2), 213-218(1986).
   PUBMED   3025016
COMMENT     PAI1 is inactivated by proteolytic attack of the urokinase-type
            (u-PA) and the tissue-type (tPA), cleaving an Arg-Met bond 33
            residues from the carboxy-terminus.
FEATURES             Location/Qualifiers
     source          1..224
                     /db_xref="H-InvDB:HIT000321063"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     CDS             <1..120
                     /codon_start=1
                     /product="PAI1 carboxy-terminus (39AA)"
                     /db_xref="GOA:P05121"
                     /db_xref="H-InvDB:HIT000321063.12"
                     /db_xref="HGNC:HGNC:8583"
                     /db_xref="InterPro:IPR000215"
                     /db_xref="InterPro:IPR023795"
                     /db_xref="InterPro:IPR023796"
                     /db_xref="InterPro:IPR036186"
                     /db_xref="InterPro:IPR042178"
                     /db_xref="InterPro:IPR042185"
                     /db_xref="PDB:1A7C"
                     /db_xref="PDB:1B3K"
                     /db_xref="PDB:1C5G"
                     /db_xref="PDB:1DB2"
                     /db_xref="PDB:1DVM"
                     /db_xref="PDB:1DVN"
                     /db_xref="PDB:1LJ5"
                     /db_xref="PDB:1OC0"
                     /db_xref="PDB:3CVM"
                     /db_xref="PDB:3EOX"
                     /db_xref="PDB:3PB1"
                     /db_xref="PDB:3Q02"
                     /db_xref="PDB:3Q03"
                     /db_xref="PDB:3R4L"
                     /db_xref="PDB:3UT3"
                     /db_xref="PDB:4AQH"
                     /db_xref="PDB:4G8O"
                     /db_xref="PDB:4G8R"
                     /db_xref="PDB:4IC0"
                     /db_xref="PDB:5BRR"
                     /db_xref="PDB:5ZLZ"
                     /db_xref="PDB:6I8S"
                     /db_xref="PDB:9PAI"
                     /db_xref="UniProtKB/Swiss-Prot:P05121"
                     /protein_id="CAA28442.1"
                     /translation="VIVSARMAPEEIIMDRPFLFVVRHNPTGTVLFMGQVMEP"
     misc_feature    18..19
                     /note="u-PA and t-PA cleavage site"
BASE COUNT           65 a           57 c           55 g           47 t
ORIGIN      
        1 gtcatagtct cagcccgcat ggcccccgag gagatcatca tggacagacc cttcctcttt
       61 gtggtccggc acaaccccac aggaacagtc cttttcatgg gccaagtgat ggaaccctga
      121 accctgggga aagacgcctt catctgggac aaaactggag atgcatcggg aaagaagaaa
      181 ctccgaagaa aagaatttta tgttatgact ctttctgaag gaaa
//