LOCUS X04731 224 bp mRNA linear HUM 13-JUL-1995 DEFINITION Human mRNA for plasminogen activator inhibitor type 1 C-terminus. ACCESSION X04731 VERSION X04731.1 KEYWORDS plasminogen activator inhibitor type 1. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 224) AUTHORS Andreasen P.A., Riccio A., Welinder K.G., Douglas R., Sartorio R., Nielsen L.S., Oppenheimer C., Blasi F., Dano K. TITLE Plasminogen activator inhibitor type-1: reactive center and amino-terminal heterogeneity determined by protein and cDNA sequencing JOURNAL FEBS Lett. 209(2), 213-218(1986). PUBMED 3025016 COMMENT PAI1 is inactivated by proteolytic attack of the urokinase-type (u-PA) and the tissue-type (tPA), cleaving an Arg-Met bond 33 residues from the carboxy-terminus. FEATURES Location/Qualifiers source 1..224 /db_xref="H-InvDB:HIT000321063" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" CDS <1..120 /codon_start=1 /product="PAI1 carboxy-terminus (39AA)" /db_xref="GOA:P05121" /db_xref="H-InvDB:HIT000321063.12" /db_xref="HGNC:HGNC:8583" /db_xref="InterPro:IPR000215" /db_xref="InterPro:IPR023795" /db_xref="InterPro:IPR023796" /db_xref="InterPro:IPR036186" /db_xref="InterPro:IPR042178" /db_xref="InterPro:IPR042185" /db_xref="PDB:1A7C" /db_xref="PDB:1B3K" /db_xref="PDB:1C5G" /db_xref="PDB:1DB2" /db_xref="PDB:1DVM" /db_xref="PDB:1DVN" /db_xref="PDB:1LJ5" /db_xref="PDB:1OC0" /db_xref="PDB:3CVM" /db_xref="PDB:3EOX" /db_xref="PDB:3PB1" /db_xref="PDB:3Q02" /db_xref="PDB:3Q03" /db_xref="PDB:3R4L" /db_xref="PDB:3UT3" /db_xref="PDB:4AQH" /db_xref="PDB:4G8O" /db_xref="PDB:4G8R" /db_xref="PDB:4IC0" /db_xref="PDB:5BRR" /db_xref="PDB:5ZLZ" /db_xref="PDB:6I8S" /db_xref="PDB:9PAI" /db_xref="UniProtKB/Swiss-Prot:P05121" /protein_id="CAA28442.1" /translation="VIVSARMAPEEIIMDRPFLFVVRHNPTGTVLFMGQVMEP" misc_feature 18..19 /note="u-PA and t-PA cleavage site" BASE COUNT 65 a 57 c 55 g 47 t ORIGIN 1 gtcatagtct cagcccgcat ggcccccgag gagatcatca tggacagacc cttcctcttt 61 gtggtccggc acaaccccac aggaacagtc cttttcatgg gccaagtgat ggaaccctga 121 accctgggga aagacgcctt catctgggac aaaactggag atgcatcggg aaagaagaaa 181 ctccgaagaa aagaatttta tgttatgact ctttctgaag gaaa //