LOCUS X04729 284 bp mRNA linear HUM 30-MAR-1995 DEFINITION Human mRNA for plasminogen activator inhibitor type 1 N-terminus. ACCESSION X04729 VERSION X04729.1 KEYWORDS plasminogen activator inhibitor type 1; signal peptide. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 284) AUTHORS Andreasen P.A., Riccio A., Welinder K.G., Douglas R., Sartorio R., Nielsen L.S., Oppenheimer C., Blasi F., Dano K. TITLE Plasminogen activator inhibitor type-1: reactive center and amino-terminal heterogeneity determined by protein and cDNA sequencing JOURNAL FEBS Lett. 209(2), 213-218(1986). PUBMED 3025016 FEATURES Location/Qualifiers source 1..284 /db_xref="H-InvDB:HIT000321062" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" CDS 144..>284 /note="precursor polypeptide (AA -21 to 26)" /db_xref="GOA:P05121" /db_xref="H-InvDB:HIT000321062.13" /db_xref="HGNC:HGNC:8583" /db_xref="InterPro:IPR000215" /db_xref="InterPro:IPR023795" /db_xref="InterPro:IPR023796" /db_xref="InterPro:IPR036186" /db_xref="InterPro:IPR042178" /db_xref="InterPro:IPR042185" /db_xref="PDB:1A7C" /db_xref="PDB:1B3K" /db_xref="PDB:1C5G" /db_xref="PDB:1DB2" /db_xref="PDB:1DVM" /db_xref="PDB:1DVN" /db_xref="PDB:1LJ5" /db_xref="PDB:1OC0" /db_xref="PDB:3CVM" /db_xref="PDB:3EOX" /db_xref="PDB:3PB1" /db_xref="PDB:3Q02" /db_xref="PDB:3Q03" /db_xref="PDB:3R4L" /db_xref="PDB:3UT3" /db_xref="PDB:4AQH" /db_xref="PDB:4G8O" /db_xref="PDB:4G8R" /db_xref="PDB:4IC0" /db_xref="PDB:5BRR" /db_xref="PDB:5ZLZ" /db_xref="PDB:6I8S" /db_xref="PDB:9PAI" /db_xref="UniProtKB/Swiss-Prot:P05121" /protein_id="CAA28438.1" /translation="MQMSPALTCLVLGLTLVFGEGSAVHHPPSYVAHLASDFGVRVFQ QVA" sig_peptide 144..206 /note="signal peptide (AA -21 to -1)" mat_peptide 207..>284 /note="PAI1 (AA 1-26)" BASE COUNT 52 a 97 c 81 g 54 t ORIGIN 1 acagctgtgt ttggctgcag ggccaagagc gctgtcaaga agacccacac gcccccctcc 61 agcagctgaa ttcctgcagc tccgggcagc cgccgccaga gcaggacgac cgccaatcgc 121 aaggcacctc tgagaacttc aggatgcaga tgtctccagc cctcacctgc ctagtcctgg 181 gcctgaccct tgtctttggt gaagggtctg ctgtgcacca tcccccatcc tacgtggccc 241 acctggcctc agacttcggg gtgagggtgt ttcagcaggt ggcg //