LOCUS       X04729                   284 bp    mRNA    linear   HUM 30-MAR-1995
DEFINITION  Human mRNA for plasminogen activator inhibitor type 1 N-terminus.
ACCESSION   X04729
VERSION     X04729.1
KEYWORDS    plasminogen activator inhibitor type 1; signal peptide.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 284)
  AUTHORS   Andreasen P.A., Riccio A., Welinder K.G., Douglas R., Sartorio R.,
            Nielsen L.S., Oppenheimer C., Blasi F., Dano K.
  TITLE     Plasminogen activator inhibitor type-1: reactive center and
            amino-terminal heterogeneity determined by protein and cDNA
            sequencing
  JOURNAL   FEBS Lett. 209(2), 213-218(1986).
   PUBMED   3025016
FEATURES             Location/Qualifiers
     source          1..284
                     /db_xref="H-InvDB:HIT000321062"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     CDS             144..>284
                     /note="precursor polypeptide (AA -21 to 26)"
                     /db_xref="GOA:P05121"
                     /db_xref="H-InvDB:HIT000321062.13"
                     /db_xref="HGNC:HGNC:8583"
                     /db_xref="InterPro:IPR000215"
                     /db_xref="InterPro:IPR023795"
                     /db_xref="InterPro:IPR023796"
                     /db_xref="InterPro:IPR036186"
                     /db_xref="InterPro:IPR042178"
                     /db_xref="InterPro:IPR042185"
                     /db_xref="PDB:1A7C"
                     /db_xref="PDB:1B3K"
                     /db_xref="PDB:1C5G"
                     /db_xref="PDB:1DB2"
                     /db_xref="PDB:1DVM"
                     /db_xref="PDB:1DVN"
                     /db_xref="PDB:1LJ5"
                     /db_xref="PDB:1OC0"
                     /db_xref="PDB:3CVM"
                     /db_xref="PDB:3EOX"
                     /db_xref="PDB:3PB1"
                     /db_xref="PDB:3Q02"
                     /db_xref="PDB:3Q03"
                     /db_xref="PDB:3R4L"
                     /db_xref="PDB:3UT3"
                     /db_xref="PDB:4AQH"
                     /db_xref="PDB:4G8O"
                     /db_xref="PDB:4G8R"
                     /db_xref="PDB:4IC0"
                     /db_xref="PDB:5BRR"
                     /db_xref="PDB:5ZLZ"
                     /db_xref="PDB:6I8S"
                     /db_xref="PDB:9PAI"
                     /db_xref="UniProtKB/Swiss-Prot:P05121"
                     /protein_id="CAA28438.1"
                     /translation="MQMSPALTCLVLGLTLVFGEGSAVHHPPSYVAHLASDFGVRVFQ
                     QVA"
     sig_peptide     144..206
                     /note="signal peptide (AA -21 to -1)"
     mat_peptide     207..>284
                     /note="PAI1 (AA 1-26)"
BASE COUNT           52 a           97 c           81 g           54 t
ORIGIN      
        1 acagctgtgt ttggctgcag ggccaagagc gctgtcaaga agacccacac gcccccctcc
       61 agcagctgaa ttcctgcagc tccgggcagc cgccgccaga gcaggacgac cgccaatcgc
      121 aaggcacctc tgagaacttc aggatgcaga tgtctccagc cctcacctgc ctagtcctgg
      181 gcctgaccct tgtctttggt gaagggtctg ctgtgcacca tcccccatcc tacgtggccc
      241 acctggcctc agacttcggg gtgagggtgt ttcagcaggt ggcg
//