LOCUS       X02308                  1536 bp    mRNA    linear   HUM 23-OCT-2008
DEFINITION  Human mRNA for thymidylate synthase (EC 2.1.1.45).
ACCESSION   X02308
VERSION     X02308.1
KEYWORDS    inverted repeat; synthetase; tandem repeat.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1536)
  AUTHORS   Takeishi K., Kaneda S., Ayusawa D., Shimizu K., Gotoh O., Seno T.
  TITLE     Nucleotide sequence of a functional cDNA for human thymidylate
            synthase
  JOURNAL   Nucleic Acids Res. 13(6), 2035-2043(1985).
   PUBMED   2987839
COMMENT     Data kindly reviewed (22-OCT-1985) by Seno T.
FEATURES             Location/Qualifiers
     source          1..1536
                     /db_xref="H-InvDB:HIT000320915"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     misc_feature    14..103
                     /note="triple tandemly repeated elements"
     repeat_region   14..16
                     /note="direct repeat 1"
     misc_feature    35..103
                     /note="pot. stem-loop structure"
     misc_feature    35..69
                     /note="pot. stem-loop structure"
     repeat_region   35..41
                     /note="inverted repeat A"
     repeat_region   42..44
                     /note="direct repeat 1"
     misc_feature    63..103
                     /note="pot. stem-loop structure"
     repeat_region   63..69
                     /note="inverted repeat A'"
     repeat_region   70..72
                     /note="direct repeat 1"
     repeat_region   97..103
                     /note="inverted repeat A''"
     repeat_region   104..106
                     /note="direct repeat 1"
     CDS             106..1047
                     /note="thymidylate synthase (aa 1-313)"
                     /db_xref="GOA:P04818"
                     /db_xref="H-InvDB:HIT000320915.12"
                     /db_xref="HGNC:HGNC:12441"
                     /db_xref="InterPro:IPR000398"
                     /db_xref="InterPro:IPR020940"
                     /db_xref="InterPro:IPR023451"
                     /db_xref="InterPro:IPR036926"
                     /db_xref="PDB:1HVY"
                     /db_xref="PDB:1HW3"
                     /db_xref="PDB:1HW4"
                     /db_xref="PDB:1HZW"
                     /db_xref="PDB:1I00"
                     /db_xref="PDB:1JU6"
                     /db_xref="PDB:1JUJ"
                     /db_xref="PDB:1YPV"
                     /db_xref="PDB:2ONB"
                     /db_xref="PDB:2RD8"
                     /db_xref="PDB:2RDA"
                     /db_xref="PDB:3EAW"
                     /db_xref="PDB:3EBU"
                     /db_xref="PDB:3ED7"
                     /db_xref="PDB:3EDW"
                     /db_xref="PDB:3EF9"
                     /db_xref="PDB:3EGY"
                     /db_xref="PDB:3EHI"
                     /db_xref="PDB:3EJL"
                     /db_xref="PDB:3GG5"
                     /db_xref="PDB:3GH0"
                     /db_xref="PDB:3GH2"
                     /db_xref="PDB:3H9K"
                     /db_xref="PDB:3HB8"
                     /db_xref="PDB:3N5E"
                     /db_xref="PDB:3N5G"
                     /db_xref="PDB:3OB7"
                     /db_xref="PDB:4E28"
                     /db_xref="PDB:4FGT"
                     /db_xref="PDB:4G2O"
                     /db_xref="PDB:4G6W"
                     /db_xref="PDB:4GD7"
                     /db_xref="PDB:4GYH"
                     /db_xref="PDB:4H1I"
                     /db_xref="PDB:4JEF"
                     /db_xref="PDB:4KPW"
                     /db_xref="PDB:4O1U"
                     /db_xref="PDB:4O1X"
                     /db_xref="PDB:4UP1"
                     /db_xref="PDB:5HS3"
                     /db_xref="PDB:5WRN"
                     /db_xref="PDB:5X4W"
                     /db_xref="PDB:5X4X"
                     /db_xref="PDB:5X4Y"
                     /db_xref="PDB:5X5A"
                     /db_xref="PDB:5X5D"
                     /db_xref="PDB:5X5Q"
                     /db_xref="PDB:5X66"
                     /db_xref="PDB:5X67"
                     /db_xref="PDB:5X69"
                     /db_xref="PDB:6OJU"
                     /db_xref="PDB:6OJV"
                     /db_xref="PDB:6QXG"
                     /db_xref="PDB:6QXH"
                     /db_xref="PDB:6QYQ"
                     /db_xref="PDB:6R2E"
                     /db_xref="UniProtKB/Swiss-Prot:P04818"
                     /protein_id="CAA26178.1"
                     /translation="MPVAGSELPRRPLPPAAQERDAEPRPPHGELQYLGQIQHILRCG
                     VRKDDRTGTGTLSVFGMQARYSLRDEFPLLTTKRVFWKGVLEELLWFIKGSTNAKELS
                     SKGVKIWDANGSRDFLDSLGFSTREEGDLGPVYGFQWRHFGAEYRDMESDYSGQGVDQ
                     LQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVNSELSCQLYQRSGD
                     MGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPF
                     PKLRILRKVEKIDDFKAEDFQIEGYNPHPTIKMEMAV"
     misc_feature    1231..1236
                     /note="pot. polyadenylation signal"
     misc_feature    1519..1524
                     /note="pot. polyadenylation signal"
     polyA_site      1536..1536
                     /note="polyadenylation site"
BASE COUNT          390 a          369 c          399 g          378 t
ORIGIN      
        1 gggggggggg ggaccacttg gcctgcctcc gtcccgccgc gccacttggc ctgcctccgt
       61 cccgccgcgc cacttcgcct gcctccgtcc cccgcccgcc gcgccatgcc tgtggccggc
      121 tcggagctgc cgcgccggcc cttgcccccc gccgcacagg agcgggacgc cgagccgcgt
      181 ccgccgcacg gggagctgca gtacctgggg cagatccaac acatcctccg ctgcggcgtc
      241 aggaaggacg accgcacggg caccggcacc ctgtcggtat tcggcatgca ggcgcgctac
      301 agcctgagag atgaattccc tctgctgaca accaaacgtg tgttctggaa gggtgttttg
      361 gaggagttgc tgtggtttat caagggatcc acaaatgcta aagagctgtc ttccaaggga
      421 gtgaaaatct gggatgccaa tggatcccga gactttttgg acagcctggg attctccacc
      481 agagaagaag gggacttggg cccagtttat ggcttccagt ggaggcattt tggggcagaa
      541 tacagagata tggaatcaga ttattcagga cagggagttg accaactgca aagagtgatt
      601 gacaccatca aaaccaaccc tgacgacaga agaatcatca tgtgcgcttg gaatccaaga
      661 gatcttcctc tgatggcgct gcctccatgc catgccctct gccagttcta tgtggtgaac
      721 agtgagctgt cctgccagct gtaccagaga tcgggagaca tgggcctcgg tgtgcctttc
      781 aacatcgcca gctacgccct gctcacgtac atgattgcgc acatcacggg cctgaagcca
      841 ggtgacttta tacacacttt gggagatgca catatttacc tgaatcacat cgagccactg
      901 aaaattcagc ttcagcgaga acccagacct ttcccaaagc tcaggattct tcgaaaagtt
      961 gagaaaattg atgacttcaa agctgaagac tttcagattg aagggtacaa tccgcatcca
     1021 actattaaaa tggaaatggc tgtttagggt gctttcaaag gagcttgaag gatattgtca
     1081 gtctttaggg gttgggctgg atgccgaggt aaaagttctt tttgctctaa aagaaaaagg
     1141 aactaggtca aaaatctgtc cgtgacctat cagttattaa tttttaagga tgttgccact
     1201 ggcaaatgta actgtgccag ttctttccat aataaaaggc tttgagttaa ctcactgagg
     1261 gtatctgaca atgctgaggt tatgaacaaa gtgaggagaa tgaaatgtat gtgctcttag
     1321 caaaaacatg tatgtgcatt tcaatcccac gtacttataa agaaggttgg tgaatttcac
     1381 aagctatttt tggaatattt ttagaatatt ttaagaattt cacaagctat tccctcaaat
     1441 ctgagggagc tgagtaacac catcgatcat gatgtagagt gtggttatga actttatagt
     1501 tgttttatat gttgctataa taaagaagtg ttctgc
//