LOCUS X00491 425 bp mRNA linear HUM 18-APR-2005 DEFINITION Human pancreatic polypeptide(PP) and icosapeptide precursor. ACCESSION X00491 VERSION X00491.1 KEYWORDS complementary DNA; hormone; signal peptide. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 425) AUTHORS Boel E., Schwartz T.W., Norris K.E., Fiil N.P. TITLE A cDNA encoding a small common precursor for human pancreatic polypeptide and pancreatic icosapeptide JOURNAL EMBO J. 3(4), 909-912(1984). PUBMED 6373251 COMMENT Data kindly reviewed (18-JUN-1984) by E. Boel FEATURES Location/Qualifiers source 1..425 /db_xref="H-InvDB:HIT000320867" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" CDS 15..302 /note="common precursor" /db_xref="GOA:P01298" /db_xref="H-InvDB:HIT000320867.14" /db_xref="HGNC:HGNC:9327" /db_xref="InterPro:IPR001955" /db_xref="InterPro:IPR015480" /db_xref="InterPro:IPR020392" /db_xref="PDB:1TZ4" /db_xref="PDB:1TZ5" /db_xref="UniProtKB/Swiss-Prot:P01298" /protein_id="CAA25161.1" /translation="MAAARLCLSLLLLSTCVALLLQPLLGAQGAPLEPVYPGDNATPE QMAQYAADLRRYINMLTRPRYGKRHKEDTLAFSEWGSPHAAVPRELSPLDL" sig_peptide 15..101 /note="signal peptide" mat_peptide 102..209 /note="pancreatic polypeptide" misc_feature 210..218 /note="cleavage and amidation site between PP and icosapeptide" mat_peptide 219..278 /note="icosapeptide" misc_feature 407..412 /note="polyadenylation signal" polyA_site 425..425 /note="polyadenylation site" BASE COUNT 86 a 150 c 107 g 82 t ORIGIN 1 actctggact ccggatggct gccgcacgcc tctgcctctc cctgctgctc ctgtccacct 61 gcgtggctct gttactacag ccactgctgg gtgcccaggg agccccactg gagccagtgt 121 acccagggga caatgccaca ccagagcaga tggcccagta tgcagctgat ctccgtagat 181 acatcaacat gctgaccagg cctaggtatg ggaaaagaca caaagaggac acgctggcct 241 tctcggagtg ggggtccccg catgctgctg tccccaggga gctcagcccg ctggacttat 301 aatgccacct tctgtctcct acgactccat gagcagcgcc agcccagctc tcccctctgc 361 acccttggct ctggccaaag cttgctccct gctcccacac aggctcaata aagcaagtca 421 aagcc //