LOCUS       X00491                   425 bp    mRNA    linear   HUM 18-APR-2005
DEFINITION  Human pancreatic polypeptide(PP) and icosapeptide precursor.
ACCESSION   X00491
VERSION     X00491.1
KEYWORDS    complementary DNA; hormone; signal peptide.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 425)
  AUTHORS   Boel E., Schwartz T.W., Norris K.E., Fiil N.P.
  TITLE     A cDNA encoding a small common precursor for human pancreatic
            polypeptide and pancreatic icosapeptide
  JOURNAL   EMBO J. 3(4), 909-912(1984).
   PUBMED   6373251
COMMENT     Data kindly reviewed (18-JUN-1984) by E. Boel
FEATURES             Location/Qualifiers
     source          1..425
                     /db_xref="H-InvDB:HIT000320867"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     CDS             15..302
                     /note="common precursor"
                     /db_xref="GOA:P01298"
                     /db_xref="H-InvDB:HIT000320867.14"
                     /db_xref="HGNC:HGNC:9327"
                     /db_xref="InterPro:IPR001955"
                     /db_xref="InterPro:IPR015480"
                     /db_xref="InterPro:IPR020392"
                     /db_xref="PDB:1TZ4"
                     /db_xref="PDB:1TZ5"
                     /db_xref="UniProtKB/Swiss-Prot:P01298"
                     /protein_id="CAA25161.1"
                     /translation="MAAARLCLSLLLLSTCVALLLQPLLGAQGAPLEPVYPGDNATPE
                     QMAQYAADLRRYINMLTRPRYGKRHKEDTLAFSEWGSPHAAVPRELSPLDL"
     sig_peptide     15..101
                     /note="signal peptide"
     mat_peptide     102..209
                     /note="pancreatic polypeptide"
     misc_feature    210..218
                     /note="cleavage and amidation site between PP and
                     icosapeptide"
     mat_peptide     219..278
                     /note="icosapeptide"
     misc_feature    407..412
                     /note="polyadenylation signal"
     polyA_site      425..425
                     /note="polyadenylation site"
BASE COUNT           86 a          150 c          107 g           82 t
ORIGIN      
        1 actctggact ccggatggct gccgcacgcc tctgcctctc cctgctgctc ctgtccacct
       61 gcgtggctct gttactacag ccactgctgg gtgcccaggg agccccactg gagccagtgt
      121 acccagggga caatgccaca ccagagcaga tggcccagta tgcagctgat ctccgtagat
      181 acatcaacat gctgaccagg cctaggtatg ggaaaagaca caaagaggac acgctggcct
      241 tctcggagtg ggggtccccg catgctgctg tccccaggga gctcagcccg ctggacttat
      301 aatgccacct tctgtctcct acgactccat gagcagcgcc agcccagctc tcccctctgc
      361 acccttggct ctggccaaag cttgctccct gctcccacac aggctcaata aagcaagtca
      421 aagcc
//