LOCUS       X00356                   791 bp    mRNA    linear   HUM 18-APR-2005
DEFINITION  Human calcitonin precursor mRNA Calcitonin (CT) is a hypocalcemic
            hypophosphatemic hormone.
ACCESSION   X00356 J00109
VERSION     X00356.1
KEYWORDS    calcitonin; complementary DNA; signal peptide.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 791)
  AUTHORS   Le Moullec J.M., Jullienne A., Chenais J., Lasmoles F.,
            Guliana J.M., Milhaud G., Moukhtar M.S.
  TITLE     The complete sequence of human preprocalcitonin
  JOURNAL   FEBS Lett. 167(1), 93-97(1984).
   PUBMED   6546550
REFERENCE   2  (bases 1 to 791)
  AUTHORS   Bracq S., Machairas M., Clement B., Pidoux E., Andreoletti M.,
            Moukhtar M.S., Jullienne A.
  TITLE     Calcitonin gene expression in normal human liver
  JOURNAL   FEBS Lett. 331(1-2), 15-18(1993).
   PUBMED   8405394
COMMENT     Data kindly reviewed (21-MAY-1984) by A. Jullienne
FEATURES             Location/Qualifiers
     source          1..791
                     /db_xref="H-InvDB:HIT000320860"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     CDS             71..496
                     /product="preprocalcitonin"
                     /db_xref="GOA:P01258"
                     /db_xref="H-InvDB:HIT000320860.14"
                     /db_xref="HGNC:HGNC:1437"
                     /db_xref="InterPro:IPR001693"
                     /db_xref="InterPro:IPR018360"
                     /db_xref="InterPro:IPR021116"
                     /db_xref="InterPro:IPR021117"
                     /db_xref="InterPro:IPR021118"
                     /db_xref="PDB:2JXZ"
                     /db_xref="UniProtKB/Swiss-Prot:P01258"
                     /protein_id="CAA25103.1"
                     /translation="MGFQKFSPFLALSILVLLQAGSLHAAPFRSALESSPADPATLSE
                     DEARLLLAALVQDYVQMKASELEQEQEREGSSLDSPRSKRCGNLSTCMLGTYTQDFNK
                     FHTFPQTAIGVGAPGKKRDMSSDLERDHRPHVSMPQNAN"
     sig_peptide     71..322
                     /note="amino-terminal cryptic and leader peptide"
     mat_peptide     323..418
                     /product="calcitonin"
     misc_feature    419..493
                     /note="carboxy-terminal cryptic peptide"
     polyA_site      791..791
BASE COUNT          176 a          224 c          210 g          181 t
ORIGIN      
        1 ctctggctgg acgccgccgc cgccgctgcc accgcctctg atccaagcca cctcccgcca
       61 gagaggtgtc atgggcttcc aaaagttctc ccccttcctg gctctcagca tcttggtcct
      121 gttgcaggca ggcagcctcc atgcagcacc attcaggtct gccctggaga gcagcccagc
      181 agacccggcc acgctcagtg aggacgaagc gcgcctcctg ctggctgcac tggtgcagga
      241 ctatgtgcag atgaaggcca gtgagctgga gcaggagcaa gagagagagg gctccagcct
      301 ggacagcccc agatctaagc ggtgcggtaa tctgagtact tgcatgctgg gcacatacac
      361 gcaggacttc aacaagtttc acacgttccc ccaaactgca attggggttg gagcacctgg
      421 aaagaaaagg gatatgtcca gcgacttgga gagagaccat cgccctcatg ttagcatgcc
      481 ccagaatgcc aactaaactc ctccctttcc ttcctaattt cccttcttgc atccttccta
      541 taacttgatg catgtggttt ggttcctctc tggtggctct ttgggctggt attggtggct
      601 ttccttgtgg cagaggatgt ctcaaacttc agatgggagg aaagagagca ggactcacag
      661 gttggaagag aatcacctgg gaaaatacca gaaaatgagg gccgctttga gtcccccaga
      721 gatgtcatca gagctcctct gtcctgcttc tgaatgtgct gatcatttga ggaataaaat
      781 tatttttccc c
//