LOCUS X00356 791 bp mRNA linear HUM 18-APR-2005 DEFINITION Human calcitonin precursor mRNA Calcitonin (CT) is a hypocalcemic hypophosphatemic hormone. ACCESSION X00356 J00109 VERSION X00356.1 KEYWORDS calcitonin; complementary DNA; signal peptide. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 791) AUTHORS Le Moullec J.M., Jullienne A., Chenais J., Lasmoles F., Guliana J.M., Milhaud G., Moukhtar M.S. TITLE The complete sequence of human preprocalcitonin JOURNAL FEBS Lett. 167(1), 93-97(1984). PUBMED 6546550 REFERENCE 2 (bases 1 to 791) AUTHORS Bracq S., Machairas M., Clement B., Pidoux E., Andreoletti M., Moukhtar M.S., Jullienne A. TITLE Calcitonin gene expression in normal human liver JOURNAL FEBS Lett. 331(1-2), 15-18(1993). PUBMED 8405394 COMMENT Data kindly reviewed (21-MAY-1984) by A. Jullienne FEATURES Location/Qualifiers source 1..791 /db_xref="H-InvDB:HIT000320860" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" CDS 71..496 /product="preprocalcitonin" /db_xref="GOA:P01258" /db_xref="H-InvDB:HIT000320860.14" /db_xref="HGNC:HGNC:1437" /db_xref="InterPro:IPR001693" /db_xref="InterPro:IPR018360" /db_xref="InterPro:IPR021116" /db_xref="InterPro:IPR021117" /db_xref="InterPro:IPR021118" /db_xref="PDB:2JXZ" /db_xref="UniProtKB/Swiss-Prot:P01258" /protein_id="CAA25103.1" /translation="MGFQKFSPFLALSILVLLQAGSLHAAPFRSALESSPADPATLSE DEARLLLAALVQDYVQMKASELEQEQEREGSSLDSPRSKRCGNLSTCMLGTYTQDFNK FHTFPQTAIGVGAPGKKRDMSSDLERDHRPHVSMPQNAN" sig_peptide 71..322 /note="amino-terminal cryptic and leader peptide" mat_peptide 323..418 /product="calcitonin" misc_feature 419..493 /note="carboxy-terminal cryptic peptide" polyA_site 791..791 BASE COUNT 176 a 224 c 210 g 181 t ORIGIN 1 ctctggctgg acgccgccgc cgccgctgcc accgcctctg atccaagcca cctcccgcca 61 gagaggtgtc atgggcttcc aaaagttctc ccccttcctg gctctcagca tcttggtcct 121 gttgcaggca ggcagcctcc atgcagcacc attcaggtct gccctggaga gcagcccagc 181 agacccggcc acgctcagtg aggacgaagc gcgcctcctg ctggctgcac tggtgcagga 241 ctatgtgcag atgaaggcca gtgagctgga gcaggagcaa gagagagagg gctccagcct 301 ggacagcccc agatctaagc ggtgcggtaa tctgagtact tgcatgctgg gcacatacac 361 gcaggacttc aacaagtttc acacgttccc ccaaactgca attggggttg gagcacctgg 421 aaagaaaagg gatatgtcca gcgacttgga gagagaccat cgccctcatg ttagcatgcc 481 ccagaatgcc aactaaactc ctccctttcc ttcctaattt cccttcttgc atccttccta 541 taacttgatg catgtggttt ggttcctctc tggtggctct ttgggctggt attggtggct 601 ttccttgtgg cagaggatgt ctcaaacttc agatgggagg aaagagagca ggactcacag 661 gttggaagag aatcacctgg gaaaatacca gaaaatgagg gccgctttga gtcccccaga 721 gatgtcatca gagctcctct gtcctgcttc tgaatgtgct gatcatttga ggaataaaat 781 tatttttccc c //